MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	Jesper-CellSystems_Tryp-46fracs
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20240105\20240105214924627233^10.242.132.48^taba@jp\PeakList.MaxQuantPlist1\20150410_QE3_UPLC9_DBJ_SA_46fractions_Rep1_5.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20240105\20240105214924627233^10.242.132.48^taba@jp\Psearch.MaxQuantExec1\20150410_QE3_UPLC9_DBJ_SA_46fractions_Rep1_5.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=20
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	72.0	null		0.07	72.0	14	2	0
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	70.0	null		0.10	70.0	7	3	1
PRT	sp|P07910-3|HNRPC_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	69.0	null	171-UNIMOD:35	0.15	69.0	6	1	0
PRT	sp|O60936|NOL3_HUMAN	Nucleolar protein 3 OS=Homo sapiens OX=9606 GN=NOL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	67.0	null		0.38	67.0	8	4	1
PRT	sp|P80723|BASP1_HUMAN	Brain acid soluble protein 1 OS=Homo sapiens OX=9606 GN=BASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	66.0	null		0.33	66.0	15	4	3
PRT	sp|Q9UKM9-2|RALY_HUMAN	Isoform 1 of RNA-binding protein Raly OS=Homo sapiens OX=9606 GN=RALY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	66.0	null		0.11	66.0	5	1	0
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	64.0	null	495-UNIMOD:35,425-UNIMOD:35	0.12	64.0	27	4	2
PRT	sp|Q32MZ4-3|LRRF1_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	64.0	null	670-UNIMOD:4,686-UNIMOD:4,588-UNIMOD:4	0.11	64.0	6	5	2
PRT	sp|Q9UNF1-2|MAGD2_HUMAN	Isoform 2 of Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	61.0	null		0.06	61.0	3	1	0
PRT	sp|Q9BTT0-3|AN32E_HUMAN	Isoform 3 of Acidic leucine-rich nuclear phosphoprotein 32 family member E OS=Homo sapiens OX=9606 GN=ANP32E	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	61.0	null		0.15	61.0	24	2	1
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	61.0	null		0.08	61.0	5	2	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	60.0	null	522-UNIMOD:35,549-UNIMOD:35	0.11	60.0	19	4	1
PRT	sp|P19447|ERCC3_HUMAN	General transcription and DNA repair factor IIH helicase subunit XPB OS=Homo sapiens OX=9606 GN=ERCC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	60.0	null		0.04	60.0	3	2	1
PRT	sp|Q12797|ASPH_HUMAN	Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	60.0	null	111-UNIMOD:27	0.05	60.0	4	1	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	59.0	null	33-UNIMOD:35,211-UNIMOD:35,175-UNIMOD:35	0.26	59.0	34	9	3
PRT	sp|Q13838|DX39B_HUMAN	Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	59.0	null	2-UNIMOD:1	0.10	59.0	22	3	1
PRT	sp|Q8NFQ8|TOIP2_HUMAN	Torsin-1A-interacting protein 2 OS=Homo sapiens OX=9606 GN=TOR1AIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	59.0	null	2-UNIMOD:1	0.14	59.0	5	3	1
PRT	sp|Q8NC51-4|PAIRB_HUMAN	Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58.0	null		0.12	58.0	9	2	0
PRT	sp|Q02952-3|AKA12_HUMAN	Isoform 3 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58.0	null	473-UNIMOD:4,345-UNIMOD:35,1416-UNIMOD:4	0.12	58.0	18	10	3
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	58.0	null	759-UNIMOD:35,737-UNIMOD:28,254-UNIMOD:4	0.21	58.0	84	9	3
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	58.0	null	467-UNIMOD:35,451-UNIMOD:35,348-UNIMOD:35,343-UNIMOD:27	0.09	58.0	9	3	1
PRT	sp|Q9ULW3|ABT1_HUMAN	Activator of basal transcription 1 OS=Homo sapiens OX=9606 GN=ABT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	57.0	null	37-UNIMOD:4	0.13	57.0	5	2	0
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	57.0	null	905-UNIMOD:4	0.03	57.0	10	5	2
PRT	sp|Q6NXS1|IPP2B_HUMAN	Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	57.0	null	183-UNIMOD:35,174-UNIMOD:35	0.30	57.0	7	2	1
PRT	sp|Q8IYN2|TCAL8_HUMAN	Transcription elongation factor A protein-like 8 OS=Homo sapiens OX=9606 GN=TCEAL8 PE=3 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	56.0	null		0.30	56.0	2	1	0
PRT	sp|Q96T88|UHRF1_HUMAN	E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	56.0	null	97-UNIMOD:4,98-UNIMOD:4	0.03	56.0	3	1	0
PRT	sp|Q7KZ85-3|SPT6H_HUMAN	Isoform 3 of Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56.0	null		0.04	56.0	4	2	0
PRT	sp|Q9H307|PININ_HUMAN	Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	56.0	null		0.06	56.0	41	2	0
PRT	sp|Q96GM8-2|TOE1_HUMAN	Isoform 2 of Target of EGR1 protein 1 OS=Homo sapiens OX=9606 GN=TOE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	null	291-UNIMOD:4	0.05	55.0	3	1	0
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	55.0	null		0.17	55.0	5	3	2
PRT	sp|Q9UKY7|CDV3_HUMAN	Protein CDV3 homolog OS=Homo sapiens OX=9606 GN=CDV3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	55.0	null		0.08	55.0	1	1	0
PRT	sp|Q9H0S4|DDX47_HUMAN	Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	55.0	null	2-UNIMOD:1	0.05	55.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	54.0	null	92-UNIMOD:27	0.12	54.0	5	2	1
PRT	sp|Q9NS69|TOM22_HUMAN	Mitochondrial import receptor subunit TOM22 homolog OS=Homo sapiens OX=9606 GN=TOMM22 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null		0.18	54.0	16	1	0
PRT	sp|P08621-2|RU17_HUMAN	Isoform 2 of U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null	307-UNIMOD:35	0.15	54.0	12	4	2
PRT	sp|Q92922|SMRC1_HUMAN	SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	54.0	null		0.03	54.0	12	2	0
PRT	sp|P41214|EIF2D_HUMAN	Eukaryotic translation initiation factor 2D OS=Homo sapiens OX=9606 GN=EIF2D PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null		0.08	54.0	4	3	2
PRT	sp|Q9H4I2|ZHX3_HUMAN	Zinc fingers and homeoboxes protein 3 OS=Homo sapiens OX=9606 GN=ZHX3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null		0.03	54.0	1	1	1
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	54.0	null	220-UNIMOD:35,232-UNIMOD:35	0.04	54.0	7	4	2
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	54.0	null	215-UNIMOD:28,223-UNIMOD:35	0.08	54.0	10	2	0
PRT	sp|O14497|ARI1A_HUMAN	AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	54.0	null		0.01	54.0	2	1	0
PRT	sp|Q96SY0-4|INT14_HUMAN	Isoform 4 of Integrator complex subunit 14 OS=Homo sapiens OX=9606 GN=INTS14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.06	53.0	2	1	0
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	null	672-UNIMOD:4	0.03	53.0	6	3	1
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	53.0	null	555-UNIMOD:35	0.07	53.0	9	3	1
PRT	sp|O75691|UTP20_HUMAN	Small subunit processome component 20 homolog OS=Homo sapiens OX=9606 GN=UTP20 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	53.0	null	2594-UNIMOD:4,874-UNIMOD:35	0.02	53.0	14	4	0
PRT	sp|Q9NVU0-3|RPC5_HUMAN	Isoform 3 of DNA-directed RNA polymerase III subunit RPC5 OS=Homo sapiens OX=9606 GN=POLR3E	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.05	53.0	2	2	2
PRT	sp|P08621|RU17_HUMAN	U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	53.0	null	316-UNIMOD:35,307-UNIMOD:27	0.09	53.0	14	2	0
PRT	sp|Q15527|SURF2_HUMAN	Surfeit locus protein 2 OS=Homo sapiens OX=9606 GN=SURF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	53.0	null		0.09	53.0	3	2	1
PRT	sp|Q8TAQ2-2|SMRC2_HUMAN	Isoform 2 of SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.04	52.0	2	2	1
PRT	sp|Q9UIQ6-3|LCAP_HUMAN	Isoform 3 of Leucyl-cystinyl aminopeptidase OS=Homo sapiens OX=9606 GN=LNPEP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.02	52.0	2	1	0
PRT	sp|P29692-2|EF1D_HUMAN	Isoform 2 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.04	52.0	3	2	1
PRT	sp|Q14694|UBP10_HUMAN	Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.03	52.0	1	1	1
PRT	sp|O75822-2|EIF3J_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.22	52.0	6	3	0
PRT	sp|Q8WVT3|TPC12_HUMAN	Trafficking protein particle complex subunit 12 OS=Homo sapiens OX=9606 GN=TRAPPC12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null	118-UNIMOD:4	0.06	52.0	1	1	1
PRT	sp|Q8NC51-3|PAIRB_HUMAN	Isoform 3 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	52.0	null		0.10	52.0	5	2	0
PRT	sp|Q6NS38|ALKB2_HUMAN	DNA oxidative demethylase ALKBH2 OS=Homo sapiens OX=9606 GN=ALKBH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	52.0	null	17-UNIMOD:28	0.08	52.0	2	2	0
PRT	sp|Q99536|VAT1_HUMAN	Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	52.0	null	2-UNIMOD:1	0.06	52.0	6	1	0
PRT	sp|Q13671|RIN1_HUMAN	Ras and Rab interactor 1 OS=Homo sapiens OX=9606 GN=RIN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	52.0	null		0.04	52.0	1	1	1
PRT	sp|P07996-2|TSP1_HUMAN	Isoform 2 of Thrombospondin-1 OS=Homo sapiens OX=9606 GN=THBS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	748-UNIMOD:4,751-UNIMOD:4,741-UNIMOD:35,338-UNIMOD:4,343-UNIMOD:4,321-UNIMOD:4	0.05	51.0	7	3	2
PRT	sp|P36956-6|SRBP1_HUMAN	Isoform SREBP-1cDelta of Sterol regulatory element-binding protein 1 OS=Homo sapiens OX=9606 GN=SREBF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.05	51.0	1	1	0
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	54-UNIMOD:4	0.10	51.0	6	3	1
PRT	sp|Q96GS4|BORC6_HUMAN	BLOC-1-related complex subunit 6 OS=Homo sapiens OX=9606 GN=BORCS6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.08	51.0	1	1	1
PRT	sp|O75461-2|E2F6_HUMAN	Isoform 2 of Transcription factor E2F6 OS=Homo sapiens OX=9606 GN=E2F6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.17	51.0	1	1	1
PRT	sp|Q9Y5S2|MRCKB_HUMAN	Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.01	51.0	4	2	0
PRT	sp|Q29RF7|PDS5A_HUMAN	Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	51.0	null		0.04	51.0	7	3	1
PRT	sp|Q562E7-3|WDR81_HUMAN	Isoform 3 of WD repeat-containing protein 81 OS=Homo sapiens OX=9606 GN=WDR81	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.03	51.0	2	1	0
PRT	sp|P14859-6|PO2F1_HUMAN	Isoform 6 of POU domain, class 2, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU2F1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	51.0	null	2-UNIMOD:1	0.03	51.0	2	1	0
PRT	sp|P20962|PTMS_HUMAN	Parathymosin OS=Homo sapiens OX=9606 GN=PTMS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	51.0	null		0.45	51.0	20	1	0
PRT	sp|O00461|GOLI4_HUMAN	Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	50.0	null	348-UNIMOD:35	0.12	50.0	4	4	4
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	50.0	null	269-UNIMOD:35,498-UNIMOD:27	0.08	50.0	18	6	2
PRT	sp|O75381-2|PEX14_HUMAN	Isoform 2 of Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	299-UNIMOD:4	0.08	50.0	3	2	1
PRT	sp|Q14865|ARI5B_HUMAN	AT-rich interactive domain-containing protein 5B OS=Homo sapiens OX=9606 GN=ARID5B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	50.0	null		0.03	50.0	4	2	0
PRT	sp|O15511|ARPC5_HUMAN	Actin-related protein 2/3 complex subunit 5 OS=Homo sapiens OX=9606 GN=ARPC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	50.0	null	45-UNIMOD:4	0.17	50.0	7	1	0
PRT	sp|Q9BY67-5|CADM1_HUMAN	Isoform 5 of Cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CADM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.06	50.0	2	1	0
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.06	50.0	6	5	4
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.13	50.0	4	1	0
PRT	sp|P19387|RPB3_HUMAN	DNA-directed RNA polymerase II subunit RPB3 OS=Homo sapiens OX=9606 GN=POLR2C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	50.0	null		0.09	50.0	6	1	0
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	49.0	null	266-UNIMOD:4,263-UNIMOD:35	0.05	49.0	46	2	0
PRT	sp|Q13330-2|MTA1_HUMAN	Isoform Short of Metastasis-associated protein MTA1 OS=Homo sapiens OX=9606 GN=MTA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	92-UNIMOD:35	0.07	49.0	2	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	49.0	null	608-UNIMOD:4,612-UNIMOD:4	0.02	49.0	7	2	0
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.05	49.0	2	2	2
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	353-UNIMOD:4	0.04	49.0	2	1	0
PRT	sp|P00167-2|CYB5_HUMAN	Isoform 2 of Cytochrome b5 OS=Homo sapiens OX=9606 GN=CYB5A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.22	49.0	2	1	0
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.20	49.0	4	1	0
PRT	sp|P35251-2|RFC1_HUMAN	Isoform 2 of Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	1118-UNIMOD:35	0.05	49.0	6	4	2
PRT	sp|Q9UG63|ABCF2_HUMAN	ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	49.0	null		0.03	49.0	9	2	0
PRT	sp|Q96A49|SYAP1_HUMAN	Synapse-associated protein 1 OS=Homo sapiens OX=9606 GN=SYAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	49.0	null	303-UNIMOD:28	0.05	49.0	10	2	0
PRT	sp|Q9BW27-3|NUP85_HUMAN	Isoform 3 of Nuclear pore complex protein Nup85 OS=Homo sapiens OX=9606 GN=NUP85	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.04	49.0	2	1	0
PRT	sp|Q9Y3D0|CIA2B_HUMAN	Cytosolic iron-sulfur assembly component 2B OS=Homo sapiens OX=9606 GN=CIAO2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.14	49.0	3	1	0
PRT	sp|Q68D20|PMS2L_HUMAN	Protein PMS2CL OS=Homo sapiens OX=9606 GN=PMS2CL PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	null	165-UNIMOD:4,174-UNIMOD:4	0.12	49.0	1	1	1
PRT	sp|Q8WY91|THAP4_HUMAN	THAP domain-containing protein 4 OS=Homo sapiens OX=9606 GN=THAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.04	48.0	1	1	1
PRT	sp|Q15058|KIF14_HUMAN	Kinesin-like protein KIF14 OS=Homo sapiens OX=9606 GN=KIF14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null	47-UNIMOD:4	0.02	48.0	5	2	0
PRT	sp|Q9UGI8-2|TES_HUMAN	Isoform 2 of Testin OS=Homo sapiens OX=9606 GN=TES	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	37-UNIMOD:4	0.04	48.0	3	1	0
PRT	sp|Q13409-6|DC1I2_HUMAN	Isoform 2F of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.10	48.0	10	5	1
PRT	sp|Q96JN0-3|LCOR_HUMAN	Isoform 3 of Ligand-dependent corepressor OS=Homo sapiens OX=9606 GN=LCOR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.06	48.0	7	3	1
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.04	48.0	4	3	2
PRT	sp|P05556-2|ITB1_HUMAN	Isoform 2 of Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	500-UNIMOD:4,502-UNIMOD:4,516-UNIMOD:4,75-UNIMOD:4	0.04	48.0	3	2	1
PRT	sp|P83916|CBX1_HUMAN	Chromobox protein homolog 1 OS=Homo sapiens OX=9606 GN=CBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null		0.16	48.0	27	3	2
PRT	sp|Q9Y6D6|BIG1_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens OX=9606 GN=ARFGEF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.02	48.0	1	1	1
PRT	sp|Q9H0S4-2|DDX47_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.05	48.0	3	2	1
PRT	sp|P53041|PPP5_HUMAN	Serine/threonine-protein phosphatase 5 OS=Homo sapiens OX=9606 GN=PPP5C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null	11-UNIMOD:4	0.04	48.0	6	1	0
PRT	sp|P12956-2|XRCC6_HUMAN	Isoform 2 of X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.06	48.0	4	2	0
PRT	sp|Q86TC9-2|MYPN_HUMAN	Isoform 2 of Myopalladin OS=Homo sapiens OX=9606 GN=MYPN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.02	48.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	48.0	null	707-UNIMOD:4,1196-UNIMOD:4,188-UNIMOD:4,2464-UNIMOD:4	0.03	48.0	24	6	2
PRT	sp|Q8IWT0|ARCH_HUMAN	Protein archease OS=Homo sapiens OX=9606 GN=ZBTB8OS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	48.0	null	2-UNIMOD:1	0.11	48.0	2	1	0
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	48.0	null	56-UNIMOD:27	0.20	48.0	15	6	2
PRT	sp|Q9Y3T9|NOC2L_HUMAN	Nucleolar complex protein 2 homolog OS=Homo sapiens OX=9606 GN=NOC2L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.02	47.0	2	1	0
PRT	sp|Q5JTH9-2|RRP12_HUMAN	Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	79-UNIMOD:35	0.04	47.0	4	2	1
PRT	sp|Q8IX12-2|CCAR1_HUMAN	Isoform 2 of Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.02	47.0	3	1	0
PRT	sp|Q86VM9-2|ZCH18_HUMAN	Isoform 2 of Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.08	47.0	4	3	2
PRT	sp|Q8N163-2|CCAR2_HUMAN	Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.03	47.0	5	4	3
PRT	sp|Q9BWU0|NADAP_HUMAN	Kanadaptin OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.05	47.0	3	2	1
PRT	sp|P50548-2|ERF_HUMAN	Isoform 2 of ETS domain-containing transcription factor ERF OS=Homo sapiens OX=9606 GN=ERF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	114-UNIMOD:4	0.09	47.0	3	2	1
PRT	sp|Q8N573-2|OXR1_HUMAN	Isoform 2 of Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.04	47.0	4	2	0
PRT	sp|Q7Z460-2|CLAP1_HUMAN	Isoform 2 of CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.02	47.0	2	1	0
PRT	sp|O95251-3|KAT7_HUMAN	Isoform 3 of Histone acetyltransferase KAT7 OS=Homo sapiens OX=9606 GN=KAT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.07	47.0	1	1	1
PRT	sp|Q9Y6B2|EID1_HUMAN	EP300-interacting inhibitor of differentiation 1 OS=Homo sapiens OX=9606 GN=EID1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	47.0	null	58-UNIMOD:35,66-UNIMOD:35	0.14	47.0	4	1	0
PRT	sp|Q96DH6|MSI2H_HUMAN	RNA-binding protein Musashi homolog 2 OS=Homo sapiens OX=9606 GN=MSI2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	null	1-UNIMOD:1	0.07	47.0	2	1	0
PRT	sp|Q9NQZ2|SAS10_HUMAN	Something about silencing protein 10 OS=Homo sapiens OX=9606 GN=UTP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	47.0	null	149-UNIMOD:28	0.05	47.0	5	1	0
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.04	46.0	4	3	2
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	46.0	null	152-UNIMOD:4,601-UNIMOD:35,593-UNIMOD:27	0.03	46.0	17	2	1
PRT	sp|Q9BXJ9|NAA15_HUMAN	N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.02	46.0	2	1	0
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.05	46.0	2	1	0
PRT	sp|O75459|PAGE1_HUMAN	P antigen family member 1 OS=Homo sapiens OX=9606 GN=PAGE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.17	46.0	2	1	0
PRT	sp|Q9H1E5|TMX4_HUMAN	Thioredoxin-related transmembrane protein 4 OS=Homo sapiens OX=9606 GN=TMX4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	326-UNIMOD:4	0.09	46.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	357-UNIMOD:35,368-UNIMOD:35	0.06	46.0	10	3	1
PRT	sp|O60828-10|PQBP1_HUMAN	Isoform 10 of Polyglutamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PQBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.45	46.0	3	1	0
PRT	sp|O00459|P85B_HUMAN	Phosphatidylinositol 3-kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PIK3R2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	608-UNIMOD:35	0.03	46.0	3	1	0
PRT	sp|P61201|CSN2_HUMAN	COP9 signalosome complex subunit 2 OS=Homo sapiens OX=9606 GN=COPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	46.0	null	179-UNIMOD:4,174-UNIMOD:28	0.04	46.0	3	1	0
PRT	sp|Q9BVJ6-2|UT14A_HUMAN	Isoform 2 of U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.03	46.0	1	1	1
PRT	sp|P39880-4|CUX1_HUMAN	Isoform 5 of Homeobox protein cut-like 1 OS=Homo sapiens OX=9606 GN=CUX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.02	46.0	1	1	1
PRT	sp|Q9UIF8-4|BAZ2B_HUMAN	Isoform 4 of Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	1136-UNIMOD:4	0.01	46.0	2	2	2
PRT	sp|Q9BRS8-2|LARP6_HUMAN	Isoform 2 of La-related protein 6 OS=Homo sapiens OX=9606 GN=LARP6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.25	46.0	3	1	0
PRT	sp|Q9NTJ3|SMC4_HUMAN	Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null		0.02	46.0	1	1	1
PRT	sp|Q8N3E9|PLCD3_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens OX=9606 GN=PLCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null		0.03	45.0	2	1	0
PRT	sp|Q12841-2|FSTL1_HUMAN	Isoform 2 of Follistatin-related protein 1 OS=Homo sapiens OX=9606 GN=FSTL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	198-UNIMOD:4,215-UNIMOD:4	0.08	45.0	2	1	0
PRT	sp|Q9Y4K1|CRBG1_HUMAN	Beta/gamma crystallin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CRYBG1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.01	45.0	2	1	0
PRT	sp|P01889|HLAB_HUMAN	HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.06	45.0	2	1	0
PRT	sp|P19793-2|RXRA_HUMAN	Isoform 2 of Retinoic acid receptor RXR-alpha OS=Homo sapiens OX=9606 GN=RXRA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.06	45.0	2	1	0
PRT	sp|Q9H1E3-2|NUCKS_HUMAN	Isoform 2 of Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	98-UNIMOD:35,66-UNIMOD:35	0.25	45.0	7	3	2
PRT	sp|Q8IX01|SUGP2_HUMAN	SURP and G-patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUGP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	891-UNIMOD:35	0.04	45.0	3	2	1
PRT	sp|Q9ULD4|BRPF3_HUMAN	Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens OX=9606 GN=BRPF3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.04	45.0	3	3	3
PRT	sp|Q9UKN8|TF3C4_HUMAN	General transcription factor 3C polypeptide 4 OS=Homo sapiens OX=9606 GN=GTF3C4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	665-UNIMOD:35	0.03	45.0	2	1	0
PRT	sp|Q7Z2Z2-2|EFL1_HUMAN	Isoform 2 of Elongation factor-like GTPase 1 OS=Homo sapiens OX=9606 GN=EFL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	870-UNIMOD:4,883-UNIMOD:4	0.03	45.0	1	1	1
PRT	sp|Q6UXH1-4|CREL2_HUMAN	Isoform 4 of Protein disulfide isomerase CRELD2 OS=Homo sapiens OX=9606 GN=CRELD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	260-UNIMOD:4,266-UNIMOD:4	0.05	45.0	1	1	0
PRT	sp|P18615-3|NELFE_HUMAN	Isoform 2 of Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.09	45.0	2	2	1
PRT	sp|Q96RU2|UBP28_HUMAN	Ubiquitin carboxyl-terminal hydrolase 28 OS=Homo sapiens OX=9606 GN=USP28 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	701-UNIMOD:4	0.04	45.0	3	2	1
PRT	sp|P50579|MAP2_HUMAN	Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	135-UNIMOD:4,59-UNIMOD:27	0.08	45.0	6	3	1
PRT	sp|Q8N157-3|AHI1_HUMAN	Isoform 3 of Jouberin OS=Homo sapiens OX=9606 GN=AHI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.08	45.0	2	2	1
PRT	sp|P78536|ADA17_HUMAN	Disintegrin and metalloproteinase domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ADAM17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	759-UNIMOD:35	0.04	45.0	4	2	1
PRT	sp|Q14571|ITPR2_HUMAN	Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens OX=9606 GN=ITPR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	2087-UNIMOD:4	0.01	45.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	187-UNIMOD:27,539-UNIMOD:27	0.07	45.0	12	6	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	20-UNIMOD:35	0.03	45.0	4	3	2
PRT	sp|Q6UX04-2|CWC27_HUMAN	Isoform 2 of Spliceosome-associated protein CWC27 homolog OS=Homo sapiens OX=9606 GN=CWC27	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.05	45.0	2	1	0
PRT	sp|P33993-2|MCM7_HUMAN	Isoform 2 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.05	45.0	3	1	0
PRT	sp|Q9NWV8-3|BABA1_HUMAN	Isoform 3 of BRISC and BRCA1-A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.14	45.0	1	1	1
PRT	sp|O15013-7|ARHGA_HUMAN	Isoform 3 of Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.01	45.0	2	1	0
PRT	sp|Q24JP5-4|T132A_HUMAN	Isoform 4 of Transmembrane protein 132A OS=Homo sapiens OX=9606 GN=TMEM132A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.03	45.0	2	1	0
PRT	sp|P43121|MUC18_HUMAN	Cell surface glycoprotein MUC18 OS=Homo sapiens OX=9606 GN=MCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.03	45.0	1	1	1
PRT	sp|Q8NAV1|PR38A_HUMAN	Pre-mRNA-splicing factor 38A OS=Homo sapiens OX=9606 GN=PRPF38A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	188-UNIMOD:35	0.08	45.0	3	1	0
PRT	sp|Q969G3|SMCE1_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Homo sapiens OX=9606 GN=SMARCE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	377-UNIMOD:35,340-UNIMOD:35	0.24	45.0	5	3	0
PRT	sp|Q96L73|NSD1_HUMAN	Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null		0.01	45.0	1	1	0
PRT	sp|Q96GM8|TOE1_HUMAN	Target of EGR1 protein 1 OS=Homo sapiens OX=9606 GN=TOE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	null	369-UNIMOD:28,371-UNIMOD:4	0.05	45.0	2	1	0
PRT	sp|Q6VMQ6|MCAF1_HUMAN	Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	360-UNIMOD:4,517-UNIMOD:4,481-UNIMOD:28	0.05	44.0	3	3	3
PRT	sp|Q8IVT5-4|KSR1_HUMAN	Isoform 4 of Kinase suppressor of Ras 1 OS=Homo sapiens OX=9606 GN=KSR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.05	44.0	1	1	1
PRT	sp|Q96CK0|ZN653_HUMAN	Zinc finger protein 653 OS=Homo sapiens OX=9606 GN=ZNF653 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.05	44.0	1	1	1
PRT	sp|Q96B23-2|CR025_HUMAN	Isoform 2 of Uncharacterized protein C18orf25 OS=Homo sapiens OX=9606 GN=C18orf25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.10	44.0	3	2	1
PRT	sp|Q93075|TATD2_HUMAN	Putative deoxyribonuclease TATDN2 OS=Homo sapiens OX=9606 GN=TATDN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.04	44.0	1	1	1
PRT	sp|Q12788|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.03	44.0	4	1	0
PRT	sp|P46939-2|UTRO_HUMAN	Isoform 2 of Utrophin OS=Homo sapiens OX=9606 GN=UTRN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	282-UNIMOD:4	0.01	44.0	2	2	2
PRT	sp|P20020-5|AT2B1_HUMAN	Isoform E of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.02	44.0	5	2	0
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	287-UNIMOD:35	0.12	44.0	10	3	1
PRT	sp|Q9NXC5-2|MIO_HUMAN	Isoform 2 of GATOR complex protein MIOS OS=Homo sapiens OX=9606 GN=MIOS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	377-UNIMOD:4	0.05	44.0	3	2	1
PRT	sp|Q969G3-3|SMCE1_HUMAN	Isoform 3 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Homo sapiens OX=9606 GN=SMARCE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	270-UNIMOD:35	0.32	44.0	11	5	0
PRT	sp|Q8WWQ0|PHIP_HUMAN	PH-interacting protein OS=Homo sapiens OX=9606 GN=PHIP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.02	44.0	5	3	1
PRT	sp|Q03701|CEBPZ_HUMAN	CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.04	44.0	4	3	2
PRT	sp|Q9H5I5-2|PIEZ2_HUMAN	Isoform 2 of Piezo-type mechanosensitive ion channel component 2 OS=Homo sapiens OX=9606 GN=PIEZO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.02	44.0	3	2	1
PRT	sp|Q8NB46|ANR52_HUMAN	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens OX=9606 GN=ANKRD52 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.02	44.0	2	2	2
PRT	sp|Q9UK97-3|FBX9_HUMAN	Isoform 3 of F-box only protein 9 OS=Homo sapiens OX=9606 GN=FBXO9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.05	44.0	1	1	1
PRT	sp|Q14BN4-2|SLMAP_HUMAN	Isoform 2 of Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.05	44.0	4	2	0
PRT	sp|P21675-10|TAF1_HUMAN	Isoform 2h of Transcription initiation factor TFIID subunit 1 OS=Homo sapiens OX=9606 GN=TAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.01	44.0	2	1	0
PRT	sp|Q12797-9|ASPH_HUMAN	Isoform 9 of Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.15	44.0	7	2	0
PRT	sp|Q9NY27|PP4R2_HUMAN	Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP4R2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	294-UNIMOD:28,296-UNIMOD:4,313-UNIMOD:35	0.06	44.0	2	1	0
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	44.0	null		0.12	44.0	3	3	3
PRT	sp|P49642|PRI1_HUMAN	DNA primase small subunit OS=Homo sapiens OX=9606 GN=PRIM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	44.0	null		0.05	44.0	2	1	0
PRT	sp|Q9BRP8-2|PYM1_HUMAN	Isoform 2 of Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.09	43.0	2	1	0
PRT	sp|Q8N3D4|EH1L1_HUMAN	EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	422-UNIMOD:4	0.03	43.0	3	3	3
PRT	sp|Q6NZI2|CAVN1_HUMAN	Caveolae-associated protein 1 OS=Homo sapiens OX=9606 GN=CAVIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	341-UNIMOD:35	0.07	43.0	17	2	0
PRT	sp|Q07954|LRP1_HUMAN	Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens OX=9606 GN=LRP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	43.0	null	47-UNIMOD:4,53-UNIMOD:4,64-UNIMOD:4,47-UNIMOD:385,3353-UNIMOD:4,3359-UNIMOD:4,3369-UNIMOD:4,3761-UNIMOD:4,3767-UNIMOD:4,3776-UNIMOD:4	0.01	43.0	7	3	1
PRT	sp|Q9Y2U8|MAN1_HUMAN	Inner nuclear membrane protein Man1 OS=Homo sapiens OX=9606 GN=LEMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null		0.03	43.0	5	2	1
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null		0.04	43.0	3	3	3
PRT	sp|Q4V328|GRAP1_HUMAN	GRIP1-associated protein 1 OS=Homo sapiens OX=9606 GN=GRIPAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.02	43.0	2	1	0
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	2211-UNIMOD:35,421-UNIMOD:4,423-UNIMOD:4,421-UNIMOD:385	0.01	43.0	6	4	2
PRT	sp|O14776-2|TCRG1_HUMAN	Isoform 2 of Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	593-UNIMOD:35,466-UNIMOD:35	0.04	43.0	13	2	0
PRT	sp|Q8TEY7|UBP33_HUMAN	Ubiquitin carboxyl-terminal hydrolase 33 OS=Homo sapiens OX=9606 GN=USP33 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	307-UNIMOD:35	0.04	43.0	5	2	1
PRT	sp|P19174|PLCG1_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.02	43.0	2	1	0
PRT	sp|Q6NS38-2|ALKB2_HUMAN	Isoform 2 of DNA oxidative demethylase ALKBH2 OS=Homo sapiens OX=9606 GN=ALKBH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.13	43.0	4	2	0
PRT	sp|Q5T0F9-3|C2D1B_HUMAN	Isoform 3 of Coiled-coil and C2 domain-containing protein 1B OS=Homo sapiens OX=9606 GN=CC2D1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.05	43.0	1	1	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	43.0	null	819-UNIMOD:35,817-UNIMOD:28,823-UNIMOD:35	0.04	43.0	10	3	1
PRT	sp|Q9NU22|MDN1_HUMAN	Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	5191-UNIMOD:35,4802-UNIMOD:35	0.03	43.0	17	10	5
PRT	sp|P16989-3|YBOX3_HUMAN	Isoform 3 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.07	43.0	2	1	0
PRT	sp|Q8TF64|GIPC3_HUMAN	PDZ domain-containing protein GIPC3 OS=Homo sapiens OX=9606 GN=GIPC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.07	43.0	4	2	0
PRT	sp|Q9NUJ3|T11L1_HUMAN	T-complex protein 11-like protein 1 OS=Homo sapiens OX=9606 GN=TCP11L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null		0.05	43.0	5	2	1
PRT	sp|P11274-2|BCR_HUMAN	Isoform 2 of Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	240-UNIMOD:4	0.02	43.0	2	1	0
PRT	sp|P51003|PAPOA_HUMAN	Poly(A) polymerase alpha OS=Homo sapiens OX=9606 GN=PAPOLA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	677-UNIMOD:4	0.03	43.0	1	1	1
PRT	sp|Q8TAF3-5|WDR48_HUMAN	Isoform 5 of WD repeat-containing protein 48 OS=Homo sapiens OX=9606 GN=WDR48	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.10	43.0	6	3	1
PRT	sp|Q9NWV8|BABA1_HUMAN	BRISC and BRCA1-A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	43.0	6	1	0
PRT	sp|O95757|HS74L_HUMAN	Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	43.0	null	540-UNIMOD:385,540-UNIMOD:4,810-UNIMOD:35	0.06	43.0	8	3	2
PRT	sp|Q9UGI8|TES_HUMAN	Testin OS=Homo sapiens OX=9606 GN=TES PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	46-UNIMOD:385,46-UNIMOD:4	0.04	43.0	3	1	0
PRT	sp|O75717-2|WDHD1_HUMAN	Isoform 2 of WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=WDHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	8	2	0
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null		0.01	42.0	2	2	2
PRT	sp|Q9BV44|THUM3_HUMAN	THUMP domain-containing protein 3 OS=Homo sapiens OX=9606 GN=THUMPD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.04	42.0	1	1	1
PRT	sp|Q9BT09|CNPY3_HUMAN	Protein canopy homolog 3 OS=Homo sapiens OX=9606 GN=CNPY3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.07	42.0	2	1	0
PRT	sp|Q8IVL6-2|P3H3_HUMAN	Isoform 2 of Prolyl 3-hydroxylase 3 OS=Homo sapiens OX=9606 GN=P3H3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	3	2	0
PRT	sp|Q15542-2|TAF5_HUMAN	Isoform Short of Transcription initiation factor TFIID subunit 5 OS=Homo sapiens OX=9606 GN=TAF5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	2	1	0
PRT	sp|Q92973-3|TNPO1_HUMAN	Isoform 3 of Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	6	1	0
PRT	sp|Q9BXP5-5|SRRT_HUMAN	Isoform 5 of Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	221-UNIMOD:35	0.04	42.0	4	2	1
PRT	sp|Q5SSJ5-5|HP1B3_HUMAN	Isoform 4 of Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.32	42.0	5	1	0
PRT	sp|Q96ST2-2|IWS1_HUMAN	Isoform 2 of Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	2	1	0
PRT	sp|Q08378-4|GOGA3_HUMAN	Isoform 3 of Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.01	42.0	2	1	0
PRT	sp|Q15276-2|RABE1_HUMAN	Isoform 2 of Rab GTPase-binding effector protein 1 OS=Homo sapiens OX=9606 GN=RABEP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	174-UNIMOD:35	0.03	42.0	7	4	1
PRT	sp|Q8TBB5-2|KLDC4_HUMAN	Isoform 2 of Kelch domain-containing protein 4 OS=Homo sapiens OX=9606 GN=KLHDC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	373-UNIMOD:4	0.05	42.0	2	1	0
PRT	sp|Q9HAU0-8|PKHA5_HUMAN	Isoform 8 of Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	3	2	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	538-UNIMOD:35	0.04	42.0	9	2	1
PRT	sp|Q5VZK9-2|CARL1_HUMAN	Isoform 2 of F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	708-UNIMOD:4	0.02	42.0	2	2	2
PRT	sp|Q8IZL8|PELP1_HUMAN	Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	1088-UNIMOD:35	0.02	42.0	13	1	0
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	854-UNIMOD:35	0.04	42.0	8	4	3
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	782-UNIMOD:35	0.07	42.0	4	2	1
PRT	sp|Q13416|ORC2_HUMAN	Origin recognition complex subunit 2 OS=Homo sapiens OX=9606 GN=ORC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null		0.03	42.0	3	1	0
PRT	sp|Q9BW27|NUP85_HUMAN	Nuclear pore complex protein Nup85 OS=Homo sapiens OX=9606 GN=NUP85 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null		0.03	42.0	1	1	0
PRT	sp|P07910|HNRPC_HUMAN	Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	251-UNIMOD:35	0.11	42.0	2	1	0
PRT	sp|Q8NDI1|EHBP1_HUMAN	EH domain-binding protein 1 OS=Homo sapiens OX=9606 GN=EHBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	180-UNIMOD:28	0.02	42.0	2	1	0
PRT	sp|O75683|SURF6_HUMAN	Surfeit locus protein 6 OS=Homo sapiens OX=9606 GN=SURF6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	189-UNIMOD:4	0.07	41.0	3	1	0
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	440-UNIMOD:35,29-UNIMOD:28	0.09	41.0	15	3	0
PRT	sp|Q8NI35-5|INADL_HUMAN	Isoform 5 of InaD-like protein OS=Homo sapiens OX=9606 GN=PATJ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	2	1	0
PRT	sp|Q66K14-2|TBC9B_HUMAN	Isoform 2 of TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1062-UNIMOD:4	0.03	41.0	2	2	2
PRT	sp|P10696|PPBN_HUMAN	Alkaline phosphatase, germ cell type OS=Homo sapiens OX=9606 GN=ALPG PE=2 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	2	1	0
PRT	sp|Q53EL6-2|PDCD4_HUMAN	Isoform 2 of Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	2	1	0
PRT	sp|Q8IWE2-2|NXP20_HUMAN	Isoform 2 of Protein NOXP20 OS=Homo sapiens OX=9606 GN=FAM114A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.06	41.0	1	1	1
PRT	sp|O43837-2|IDH3B_HUMAN	Isoform A of Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	2	1	0
PRT	sp|Q9NY27-3|PP4R2_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP4R2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	240-UNIMOD:4	0.20	41.0	6	3	1
PRT	sp|Q99729-3|ROAA_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.07	41.0	1	1	1
PRT	sp|P31689|DNJA1_HUMAN	DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.07	41.0	2	2	2
PRT	sp|P34741|SDC2_HUMAN	Syndecan-2 OS=Homo sapiens OX=9606 GN=SDC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	121-UNIMOD:35	0.08	41.0	3	2	1
PRT	sp|Q8NFG4|FLCN_HUMAN	Folliculin OS=Homo sapiens OX=9606 GN=FLCN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	2	1	0
PRT	sp|Q9Y2W2|WBP11_HUMAN	WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	337-UNIMOD:35	0.05	41.0	3	1	0
PRT	sp|Q9Y5S9-2|RBM8A_HUMAN	Isoform 2 of RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	49-UNIMOD:35	0.12	41.0	5	1	0
PRT	sp|O00629|IMA3_HUMAN	Importin subunit alpha-3 OS=Homo sapiens OX=9606 GN=KPNA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	57-UNIMOD:4	0.04	41.0	3	1	0
PRT	sp|P15408-3|FOSL2_HUMAN	Isoform 3 of Fos-related antigen 2 OS=Homo sapiens OX=9606 GN=FOSL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.07	41.0	1	1	0
PRT	sp|O43396|TXNL1_HUMAN	Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	105-UNIMOD:28	0.10	41.0	7	2	1
PRT	sp|Q96N67-7|DOCK7_HUMAN	Isoform 7 of Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	1	1	0
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.05	41.0	6	4	3
PRT	sp|O95613|PCNT_HUMAN	Pericentrin OS=Homo sapiens OX=9606 GN=PCNT PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	75-UNIMOD:4,93-UNIMOD:4,1-UNIMOD:1,321-UNIMOD:385,321-UNIMOD:4	0.02	41.0	7	5	3
PRT	sp|Q7LGA3-3|HS2ST_HUMAN	Isoform 3 of Heparan sulfate 2-O-sulfotransferase 1 OS=Homo sapiens OX=9606 GN=HS2ST1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	201-UNIMOD:4,209-UNIMOD:4	0.08	41.0	1	1	0
PRT	sp|Q92797|SYMPK_HUMAN	Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	3	2	1
PRT	sp|P01137|TGFB1_HUMAN	Transforming growth factor beta-1 proprotein OS=Homo sapiens OX=9606 GN=TGFB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.06	41.0	4	2	0
PRT	sp|O14929-2|HAT1_HUMAN	Isoform B of Histone acetyltransferase type B catalytic subunit OS=Homo sapiens OX=9606 GN=HAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	16-UNIMOD:4	0.05	41.0	3	1	0
PRT	sp|Q5JRA6|TGO1_HUMAN	Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.02	41.0	4	2	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.16	41.0	7	4	1
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	2-UNIMOD:1	0.04	41.0	3	1	0
PRT	sp|Q9Y4B5|MTCL1_HUMAN	Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	41.0	null	1056-UNIMOD:28	0.03	41.0	6	3	2
PRT	sp|P55209|NP1L1_HUMAN	Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	8-UNIMOD:27	0.07	41.0	2	1	0
PRT	sp|Q96SB4-4|SRPK1_HUMAN	Isoform 3 of SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	439-UNIMOD:4,47-UNIMOD:4	0.10	40.0	5	3	2
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	167-UNIMOD:35	0.03	40.0	2	1	0
PRT	sp|P36957|ODO2_HUMAN	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	104-UNIMOD:4	0.04	40.0	4	1	0
PRT	sp|Q8TAA9-2|VANG1_HUMAN	Isoform 2 of Vang-like protein 1 OS=Homo sapiens OX=9606 GN=VANGL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	2	1	0
PRT	sp|A0MZ66-7|SHOT1_HUMAN	Isoform 7 of Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.16	40.0	3	2	1
PRT	sp|Q63HN8|RN213_HUMAN	E3 ubiquitin-protein ligase RNF213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.01	40.0	8	5	2
PRT	sp|Q9P2N5|RBM27_HUMAN	RNA-binding protein 27 OS=Homo sapiens OX=9606 GN=RBM27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	2	2	2
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	1	1	1
PRT	sp|Q99590-2|SCAFB_HUMAN	Isoform 2 of Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	5	3	0
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null		0.25	40.0	4	3	2
PRT	sp|O76031|CLPX_HUMAN	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens OX=9606 GN=CLPX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null		0.06	40.0	7	3	2
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	3	2	1
PRT	sp|Q99549|MPP8_HUMAN	M-phase phosphoprotein 8 OS=Homo sapiens OX=9606 GN=MPHOSPH8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	2	1	0
PRT	sp|O14787-2|TNPO2_HUMAN	Isoform 2 of Transportin-2 OS=Homo sapiens OX=9606 GN=TNPO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	2	1	0
PRT	sp|Q96RK0|CIC_HUMAN	Protein capicua homolog OS=Homo sapiens OX=9606 GN=CIC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.01	40.0	1	1	1
PRT	sp|P78345|RPP38_HUMAN	Ribonuclease P protein subunit p38 OS=Homo sapiens OX=9606 GN=RPP38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.07	40.0	2	1	0
PRT	sp|Q9H4L7|SMRCD_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null		0.02	40.0	3	2	1
PRT	sp|Q92974-3|ARHG2_HUMAN	Isoform 3 of Rho guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=ARHGEF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	939-UNIMOD:35	0.04	40.0	4	4	2
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	4346-UNIMOD:35,4348-UNIMOD:35	0.01	40.0	11	4	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	941-UNIMOD:35,1373-UNIMOD:35,1379-UNIMOD:4,847-UNIMOD:35,843-UNIMOD:28,848-UNIMOD:35,1878-UNIMOD:28,1437-UNIMOD:4,1434-UNIMOD:28	0.06	40.0	64	10	2
PRT	sp|Q14149|MORC3_HUMAN	MORC family CW-type zinc finger protein 3 OS=Homo sapiens OX=9606 GN=MORC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	446-UNIMOD:4	0.04	40.0	4	3	2
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	203-UNIMOD:35	0.05	40.0	10	4	2
PRT	sp|P49959-2|MRE11_HUMAN	Isoform 2 of Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	2	1	0
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	2-UNIMOD:1	0.11	40.0	4	3	2
PRT	sp|P84157-2|MXRA7_HUMAN	Isoform 2 of Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.18	40.0	1	1	1
PRT	sp|Q71F23-3|CENPU_HUMAN	Isoform 3 of Centromere protein U OS=Homo sapiens OX=9606 GN=CENPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	1	1	0
PRT	sp|Q5QJE6|TDIF2_HUMAN	Deoxynucleotidyltransferase terminal-interacting protein 2 OS=Homo sapiens OX=9606 GN=DNTTIP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null		0.06	40.0	5	2	1
PRT	sp|O94763-2|RMP_HUMAN	Isoform 2 of Unconventional prefoldin RPB5 interactor 1 OS=Homo sapiens OX=9606 GN=URI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	367-UNIMOD:4,372-UNIMOD:4	0.06	40.0	2	2	2
PRT	sp|Q9UBU9-2|NXF1_HUMAN	Isoform 2 of Nuclear RNA export factor 1 OS=Homo sapiens OX=9606 GN=NXF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	2	1	0
PRT	sp|P02686-2|MBP_HUMAN	Isoform 2 of Myelin basic protein OS=Homo sapiens OX=9606 GN=MBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.16	40.0	1	1	1
PRT	sp|Q9BXV9|GON7_HUMAN	EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.27	40.0	1	1	1
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	40.0	null	850-UNIMOD:28,1011-UNIMOD:4,1906-UNIMOD:27	0.06	40.0	22	10	3
PRT	sp|Q02447-4|SP3_HUMAN	Isoform 4 of Transcription factor Sp3 OS=Homo sapiens OX=9606 GN=SP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	2	1	0
PRT	sp|Q8TAQ2|SMRC2_HUMAN	SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	388-UNIMOD:35	0.03	40.0	2	2	1
PRT	sp|Q86UP2|KTN1_HUMAN	Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	618-UNIMOD:28	0.03	40.0	3	2	1
PRT	sp|Q13895|BYST_HUMAN	Bystin OS=Homo sapiens OX=9606 GN=BYSL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	40.0	null	64-UNIMOD:28	0.10	40.0	6	3	1
PRT	sp|Q9Y5P4|CERT_HUMAN	Ceramide transfer protein OS=Homo sapiens OX=9606 GN=CERT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	2-UNIMOD:1	0.04	40.0	1	1	1
PRT	sp|Q9ULJ3|ZBT21_HUMAN	Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|Q8TEW0|PARD3_HUMAN	Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	945-UNIMOD:35	0.02	40.0	1	1	0
PRT	sp|P33527|MRP1_HUMAN	Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null		0.02	40.0	2	1	0
PRT	sp|Q86UP2-2|KTN1_HUMAN	Isoform 2 of Kinectin OS=Homo sapiens OX=9606 GN=KTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1076-UNIMOD:4	0.03	39.0	2	2	1
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	6	2	0
PRT	sp|Q93009|UBP7_HUMAN	Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	3	2	1
PRT	sp|O95359-3|TACC2_HUMAN	Isoform 3 of Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	1	1	1
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	2	1	0
PRT	sp|Q9H0E9-3|BRD8_HUMAN	Isoform 3 of Bromodomain-containing protein 8 OS=Homo sapiens OX=9606 GN=BRD8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	2	2	0
PRT	sp|Q99575|POP1_HUMAN	Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	777-UNIMOD:4	0.02	39.0	1	1	1
PRT	sp|Q6NYC8-2|PPR18_HUMAN	Isoform 2 of Phostensin OS=Homo sapiens OX=9606 GN=PPP1R18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	3	1	0
PRT	sp|O94776|MTA2_HUMAN	Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	2	2	2
PRT	sp|Q86W50|MET16_HUMAN	RNA N6-adenosine-methyltransferase METTL16 OS=Homo sapiens OX=9606 GN=METTL16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	448-UNIMOD:4	0.06	39.0	4	2	0
PRT	sp|P82970|HMGN5_HUMAN	High mobility group nucleosome-binding domain-containing protein 5 OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	68-UNIMOD:28,96-UNIMOD:27	0.15	39.0	18	3	1
PRT	sp|P09493-9|TPM1_HUMAN	Isoform 9 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	190-UNIMOD:4	0.09	39.0	7	2	0
PRT	sp|P55209-2|NP1L1_HUMAN	Isoform 2 of Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.07	39.0	3	1	0
PRT	sp|Q96LR5|UB2E2_HUMAN	Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens OX=9606 GN=UBE2E2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.08	39.0	2	1	0
PRT	sp|Q8IY81|SPB1_HUMAN	pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	354-UNIMOD:28,375-UNIMOD:35	0.05	39.0	3	2	1
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	39.0	null	1292-UNIMOD:35,1240-UNIMOD:27,580-UNIMOD:35,1305-UNIMOD:28	0.05	39.0	17	6	1
PRT	sp|P11171-7|41_HUMAN	Isoform 7 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	3	2	1
PRT	sp|Q9NZM1-2|MYOF_HUMAN	Isoform 2 of Myoferlin OS=Homo sapiens OX=9606 GN=MYOF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	5	1	0
PRT	sp|P41229-4|KDM5C_HUMAN	Isoform 4 of Lysine-specific demethylase 5C OS=Homo sapiens OX=9606 GN=KDM5C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	2	1	0
PRT	sp|Q9BTE3-2|MCMBP_HUMAN	Isoform 2 of Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	174-UNIMOD:35	0.03	39.0	3	1	0
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	659-UNIMOD:27	0.07	39.0	14	5	0
PRT	sp|Q9UHQ4|BAP29_HUMAN	B-cell receptor-associated protein 29 OS=Homo sapiens OX=9606 GN=BCAP29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	171-UNIMOD:4	0.10	39.0	5	2	1
PRT	sp|Q8TEW0-9|PARD3_HUMAN	Isoform 9 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	0
PRT	sp|O00566|MPP10_HUMAN	U3 small nucleolar ribonucleoprotein protein MPP10 OS=Homo sapiens OX=9606 GN=MPHOSPH10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	3	2	1
PRT	sp|Q16666-3|IF16_HUMAN	Isoform 3 of Gamma-interferon-inducible protein 16 OS=Homo sapiens OX=9606 GN=IFI16	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	2	1	0
PRT	sp|Q68DQ2|CRBG3_HUMAN	Very large A-kinase anchor protein OS=Homo sapiens OX=9606 GN=CRYBG3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	2136-UNIMOD:35,1450-UNIMOD:4	0.02	39.0	5	4	3
PRT	sp|Q99590|SCAFB_HUMAN	Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null		0.01	39.0	2	1	0
PRT	sp|Q86VM9|ZCH18_HUMAN	Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	122-UNIMOD:27	0.03	39.0	1	1	0
PRT	sp|Q9UKL0|RCOR1_HUMAN	REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	467-UNIMOD:35	0.09	39.0	5	2	0
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	97-UNIMOD:27	0.07	39.0	50	2	1
PRT	sp|Q5JVS0|HABP4_HUMAN	Intracellular hyaluronan-binding protein 4 OS=Homo sapiens OX=9606 GN=HABP4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	256-UNIMOD:35	0.08	39.0	4	1	0
PRT	sp|Q02446|SP4_HUMAN	Transcription factor Sp4 OS=Homo sapiens OX=9606 GN=SP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	3	1	0
PRT	sp|Q5VSL9-3|STRP1_HUMAN	Isoform 3 of Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	2	1	0
PRT	sp|Q07157-2|ZO1_HUMAN	Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	4	2	1
PRT	sp|O76080|ZFAN5_HUMAN	AN1-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=ZFAND5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	76-UNIMOD:4	0.09	38.0	1	1	1
PRT	sp|P11177-3|ODPB_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	43-UNIMOD:35	0.05	38.0	10	2	0
PRT	sp|Q9BZE2|PUS3_HUMAN	tRNA pseudouridine(38/39) synthase OS=Homo sapiens OX=9606 GN=PUS3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	453-UNIMOD:4	0.04	38.0	4	2	0
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.09	38.0	2	1	0
PRT	sp|Q9Y4A5-2|TRRAP_HUMAN	Isoform 2 of Transformation/transcription domain-associated protein OS=Homo sapiens OX=9606 GN=TRRAP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.00	38.0	2	1	0
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	943-UNIMOD:28,1320-UNIMOD:35,981-UNIMOD:28	0.03	38.0	9	6	3
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.12	38.0	7	3	0
PRT	sp|Q5T5Y3-2|CAMP1_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	4	2	1
PRT	sp|Q9UHD8-4|SEPT9_HUMAN	Isoform 4 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	2	1	0
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	755-UNIMOD:27,314-UNIMOD:27	0.04	38.0	24	2	0
PRT	sp|Q96A19|C102A_HUMAN	Coiled-coil domain-containing protein 102A OS=Homo sapiens OX=9606 GN=CCDC102A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	214-UNIMOD:4	0.06	38.0	3	2	1
PRT	sp|O94966-4|UBP19_HUMAN	Isoform 4 of Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1029-UNIMOD:4	0.01	38.0	1	1	1
PRT	sp|P06753|TPM3_HUMAN	Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.16	38.0	7	4	2
PRT	sp|Q96RL1-5|UIMC1_HUMAN	Isoform 5 of BRCA1-A complex subunit RAP80 OS=Homo sapiens OX=9606 GN=UIMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.11	38.0	2	1	0
PRT	sp|O15015-1|ZN646_HUMAN	Isoform 1 of Zinc finger protein 646 OS=Homo sapiens OX=9606 GN=ZNF646	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	2	1	0
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	3	2	1
PRT	sp|Q9GZR1-2|SENP6_HUMAN	Isoform 2 of Sentrin-specific protease 6 OS=Homo sapiens OX=9606 GN=SENP6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	1	1	0
PRT	sp|Q9BV57|MTND_HUMAN	1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase OS=Homo sapiens OX=9606 GN=ADI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.08	38.0	2	1	0
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	13-UNIMOD:35	0.02	38.0	2	1	0
PRT	sp|Q5VT06|CE350_HUMAN	Centrosome-associated protein 350 OS=Homo sapiens OX=9606 GN=CEP350 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	2	1	0
PRT	sp|O00231|PSD11_HUMAN	26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null		0.04	38.0	21	1	0
PRT	sp|Q9H3S7|PTN23_HUMAN	Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	3	1	0
PRT	sp|Q8IUD2-4|RB6I2_HUMAN	Isoform 4 of ELKS/Rab6-interacting/CAST family member 1 OS=Homo sapiens OX=9606 GN=ERC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	2	1	0
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	2	2	2
PRT	sp|Q5T5U3-3|RHG21_HUMAN	Isoform 3 of Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	3	2	1
PRT	sp|Q6ZVM7-4|TM1L2_HUMAN	Isoform 4 of TOM1-like protein 2 OS=Homo sapiens OX=9606 GN=TOM1L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.08	38.0	2	2	1
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.07	38.0	13	4	1
PRT	sp|Q14114-2|LRP8_HUMAN	Isoform 2 of Low-density lipoprotein receptor-related protein 8 OS=Homo sapiens OX=9606 GN=LRP8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q9NRL2-2|BAZ1A_HUMAN	Isoform 2 of Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens OX=9606 GN=BAZ1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1006-UNIMOD:35	0.03	38.0	8	3	1
PRT	sp|P82094|TMF1_HUMAN	TATA element modulatory factor OS=Homo sapiens OX=9606 GN=TMF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	431-UNIMOD:4,609-UNIMOD:28	0.03	38.0	3	2	1
PRT	sp|Q9BTT0|AN32E_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member E OS=Homo sapiens OX=9606 GN=ANP32E PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	38.0	null	224-UNIMOD:27	0.12	38.0	5	1	0
PRT	sp|Q7Z422|SZRD1_HUMAN	SUZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SZRD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	1-UNIMOD:1,1-UNIMOD:35	0.15	38.0	7	2	0
PRT	sp|Q99613|EIF3C_HUMAN	Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null		0.02	38.0	3	1	0
PRT	sp|Q13330|MTA1_HUMAN	Metastasis-associated protein MTA1 OS=Homo sapiens OX=9606 GN=MTA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	87-UNIMOD:35,92-UNIMOD:35	0.04	38.0	6	1	0
PRT	sp|P15408|FOSL2_HUMAN	Fos-related antigen 2 OS=Homo sapiens OX=9606 GN=FOSL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	223-UNIMOD:28	0.06	38.0	1	1	0
PRT	sp|Q9P227|RHG23_HUMAN	Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|P25445-7|TNR6_HUMAN	Isoform 7 of Tumor necrosis factor receptor superfamily member 6 OS=Homo sapiens OX=9606 GN=FAS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	73-UNIMOD:4,82-UNIMOD:4,85-UNIMOD:4	0.10	37.0	1	1	1
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	42-UNIMOD:4	0.05	37.0	2	1	0
PRT	sp|Q96Q15-2|SMG1_HUMAN	Isoform 2 of Serine/threonine-protein kinase SMG1 OS=Homo sapiens OX=9606 GN=SMG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	2	1	0
PRT	sp|Q9UHX1-4|PUF60_HUMAN	Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	427-UNIMOD:4	0.06	37.0	21	2	0
PRT	sp|P14868-2|SYDC_HUMAN	Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	262-UNIMOD:35	0.05	37.0	6	1	0
PRT	sp|Q9NWH9|SLTM_HUMAN	SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.04	37.0	4	2	1
PRT	sp|Q9UBE0-2|SAE1_HUMAN	Isoform 2 of SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.07	37.0	14	1	0
PRT	sp|P49768-7|PSN1_HUMAN	Isoform 7 of Presenilin-1 OS=Homo sapiens OX=9606 GN=PSEN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.09	37.0	3	2	0
PRT	sp|Q9UJX6-2|ANC2_HUMAN	Isoform 2 of Anaphase-promoting complex subunit 2 OS=Homo sapiens OX=9606 GN=ANAPC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	0
PRT	sp|Q15544-2|TAF11_HUMAN	Isoform 2 of Transcription initiation factor TFIID subunit 11 OS=Homo sapiens OX=9606 GN=TAF11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.25	37.0	1	1	1
PRT	sp|P17612-2|KAPCA_HUMAN	Isoform 2 of cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens OX=9606 GN=PRKACA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	2	1	0
PRT	sp|Q9UIF9-2|BAZ2A_HUMAN	Isoform 1 of Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|Q6V0I7|FAT4_HUMAN	Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.00	37.0	1	1	1
PRT	sp|Q15326-4|ZMY11_HUMAN	Isoform 4 of Zinc finger MYND domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ZMYND11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	2	2	2
PRT	sp|P80303-2|NUCB2_HUMAN	Isoform 2 of Nucleobindin-2 OS=Homo sapiens OX=9606 GN=NUCB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	287-UNIMOD:35,290-UNIMOD:35	0.07	37.0	8	3	0
PRT	sp|Q9UBC2-4|EP15R_HUMAN	Isoform 4 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	3	2	1
PRT	sp|Q9BW85|YJU2_HUMAN	Splicing factor YJU2 OS=Homo sapiens OX=9606 GN=YJU2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	3	2	1
PRT	sp|Q3T8J9|GON4L_HUMAN	GON-4-like protein OS=Homo sapiens OX=9606 GN=GON4L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	3	2	1
PRT	sp|Q8N4S0|CCD82_HUMAN	Coiled-coil domain-containing protein 82 OS=Homo sapiens OX=9606 GN=CCDC82 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	163-UNIMOD:28	0.03	37.0	3	1	0
PRT	sp|Q96HS1-2|PGAM5_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|Q9UKY7-3|CDV3_HUMAN	Isoform 3 of Protein CDV3 homolog OS=Homo sapiens OX=9606 GN=CDV3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	32-UNIMOD:35	0.19	37.0	3	2	1
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	3	2	1
PRT	sp|Q8NDV7-6|TNR6A_HUMAN	Isoform 6 of Trinucleotide repeat-containing gene 6A protein OS=Homo sapiens OX=9606 GN=TNRC6A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	2	2	2
PRT	sp|Q96FC9-4|DDX11_HUMAN	Isoform 4 of ATP-dependent DNA helicase DDX11 OS=Homo sapiens OX=9606 GN=DDX11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	2	1	0
PRT	sp|Q6UB98-2|ANR12_HUMAN	Isoform 2 of Ankyrin repeat domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ANKRD12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|Q8IWC1-2|MA7D3_HUMAN	Isoform 2 of MAP7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAP7D3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|Q99426-2|TBCB_HUMAN	Isoform 2 of Tubulin-folding cofactor B OS=Homo sapiens OX=9606 GN=TBCB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.09	37.0	1	1	1
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	138-UNIMOD:35	0.09	37.0	1	1	0
PRT	sp|Q7L4I2|RSRC2_HUMAN	Arginine/serine-rich coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=RSRC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1	0.03	37.0	1	1	1
PRT	sp|Q70E73|RAPH1_HUMAN	Ras-associated and pleckstrin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=RAPH1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	1-UNIMOD:1	0.02	37.0	1	1	1
PRT	sp|Q12841|FSTL1_HUMAN	Follistatin-related protein 1 OS=Homo sapiens OX=9606 GN=FSTL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	233-UNIMOD:385,233-UNIMOD:4,250-UNIMOD:4	0.07	37.0	2	1	0
PRT	sp|O75781|PALM_HUMAN	Paralemmin-1 OS=Homo sapiens OX=9606 GN=PALM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.05	37.0	1	1	0
PRT	sp|Q96HA1|P121A_HUMAN	Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens OX=9606 GN=POM121 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.01	37.0	1	1	0
PRT	sp|O75122-3|CLAP2_HUMAN	Isoform 3 of CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|Q75N03|HAKAI_HUMAN	E3 ubiquitin-protein ligase Hakai OS=Homo sapiens OX=9606 GN=CBLL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	73-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|P24821-6|TENA_HUMAN	Isoform 6 of Tenascin OS=Homo sapiens OX=9606 GN=TNC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	392-UNIMOD:4,394-UNIMOD:4,403-UNIMOD:4	0.01	36.0	2	1	0
PRT	sp|Q01130-2|SRSF2_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	75-UNIMOD:35	0.09	36.0	1	1	1
PRT	sp|O94925-2|GLSK_HUMAN	Isoform 2 of Glutaminase kidney isoform, mitochondrial OS=Homo sapiens OX=9606 GN=GLS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.09	36.0	2	1	0
PRT	sp|P17655|CAN2_HUMAN	Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	2	1	0
PRT	sp|Q96FV9|THOC1_HUMAN	THO complex subunit 1 OS=Homo sapiens OX=9606 GN=THOC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	604-UNIMOD:4	0.05	36.0	5	2	0
PRT	sp|O94822-2|LTN1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase listerin OS=Homo sapiens OX=9606 GN=LTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	3	2	0
PRT	sp|Q9ULV4|COR1C_HUMAN	Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	23-UNIMOD:4	0.07	36.0	5	4	3
PRT	sp|Q7Z4V5-2|HDGR2_HUMAN	Isoform 2 of Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	3	1	0
PRT	sp|Q9ULF5|S39AA_HUMAN	Zinc transporter ZIP10 OS=Homo sapiens OX=9606 GN=SLC39A10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	36.0	null	534-UNIMOD:28	0.04	36.0	4	2	1
PRT	sp|Q6ZU35|CRACD_HUMAN	Capping protein inhibiting regulator of actin dynamics OS=Homo sapiens OX=9606 GN=CRACD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	3	2	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	27-UNIMOD:35	0.06	36.0	12	2	1
PRT	sp|Q2YD98|UVSSA_HUMAN	UV-stimulated scaffold protein A OS=Homo sapiens OX=9606 GN=UVSSA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null		0.05	36.0	4	3	2
PRT	sp|O15231-2|ZN185_HUMAN	Isoform 2 of Zinc finger protein 185 OS=Homo sapiens OX=9606 GN=ZNF185	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	2	1	0
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	308-UNIMOD:35	0.09	36.0	13	3	1
PRT	sp|Q8N392-2|RHG18_HUMAN	Isoform 2 of Rho GTPase-activating protein 18 OS=Homo sapiens OX=9606 GN=ARHGAP18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q9NUY8-2|TBC23_HUMAN	Isoform 2 of TBC1 domain family member 23 OS=Homo sapiens OX=9606 GN=TBC1D23	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q92614-2|MY18A_HUMAN	Isoform 2 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	6	2	0
PRT	sp|Q9Y5B6-3|PAXB1_HUMAN	Isoform 3 of PAX3- and PAX7-binding protein 1 OS=Homo sapiens OX=9606 GN=PAXBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	2	1	0
PRT	sp|Q9BUE6|ISCA1_HUMAN	Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=ISCA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.12	36.0	3	2	1
PRT	sp|O43765|SGTA_HUMAN	Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q9ULG6-3|CCPG1_HUMAN	Isoform 3 of Cell cycle progression protein 1 OS=Homo sapiens OX=9606 GN=CCPG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	2	1	0
PRT	sp|P52306-6|GDS1_HUMAN	Isoform 6 of Rap1 GTPase-GDP dissociation stimulator 1 OS=Homo sapiens OX=9606 GN=RAP1GDS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q9BYW2|SETD2_HUMAN	Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	2	2	2
PRT	sp|Q4G0J3|LARP7_HUMAN	La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	3	2	1
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null		0.06	36.0	1	1	0
PRT	sp|Q9BXB5|OSB10_HUMAN	Oxysterol-binding protein-related protein 10 OS=Homo sapiens OX=9606 GN=OSBPL10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	2	1	0
PRT	sp|O75410|TACC1_HUMAN	Transforming acidic coiled-coil-containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null		0.02	36.0	1	1	0
PRT	sp|Q96N67|DOCK7_HUMAN	Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	156-UNIMOD:28	0.01	36.0	2	1	0
PRT	sp|Q4W5G0|TIGD2_HUMAN	Tigger transposable element-derived protein 2 OS=Homo sapiens OX=9606 GN=TIGD2 PE=3 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	441-UNIMOD:4	0.04	36.0	2	1	0
PRT	sp|P10909-6|CLUS_HUMAN	Isoform 6 of Clusterin OS=Homo sapiens OX=9606 GN=CLU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	14-UNIMOD:35	0.04	36.0	2	1	0
PRT	sp|P14868|SYDC_HUMAN	Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	362-UNIMOD:35	0.04	36.0	5	1	0
PRT	sp|Q6P6C2|ALKB5_HUMAN	RNA demethylase ALKBH5 OS=Homo sapiens OX=9606 GN=ALKBH5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	378-UNIMOD:4	0.05	36.0	1	1	1
PRT	sp|P00533-2|EGFR_HUMAN	Isoform 2 of Epidermal growth factor receptor OS=Homo sapiens OX=9606 GN=EGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	311-UNIMOD:4	0.04	35.0	1	1	1
PRT	sp|O60231|DHX16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens OX=9606 GN=DHX16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.03	35.0	4	2	1
PRT	sp|O95831-3|AIFM1_HUMAN	Isoform 3 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	4	2	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	3	3	3
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.05	35.0	34	2	1
PRT	sp|Q6NZY4-2|ZCHC8_HUMAN	Isoform 2 of Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	2	1	0
PRT	sp|Q9Y3B7-2|RM11_HUMAN	Isoform 2 of 39S ribosomal protein L11, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.08	35.0	1	1	0
PRT	sp|Q8WXG6-6|MADD_HUMAN	Isoform 6 of MAP kinase-activating death domain protein OS=Homo sapiens OX=9606 GN=MADD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	2	1	0
PRT	sp|A4D2B0|MBLC1_HUMAN	Metallo-beta-lactamase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MBLAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.11	35.0	2	1	0
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.04	35.0	7	5	3
PRT	sp|Q13610-2|PWP1_HUMAN	Isoform 2 of Periodic tryptophan protein 1 homolog OS=Homo sapiens OX=9606 GN=PWP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.18	35.0	1	1	1
PRT	sp|Q86TG7-2|PEG10_HUMAN	Isoform 2 of Retrotransposon-derived protein PEG10 OS=Homo sapiens OX=9606 GN=PEG10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.06	35.0	2	1	0
PRT	sp|Q9NVI1|FANCI_HUMAN	Fanconi anemia group I protein OS=Homo sapiens OX=9606 GN=FANCI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	2	1	0
PRT	sp|Q567U6|CCD93_HUMAN	Coiled-coil domain-containing protein 93 OS=Homo sapiens OX=9606 GN=CCDC93 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	2	1	0
PRT	sp|P28370-2|SMCA1_HUMAN	Isoform 2 of Probable global transcription activator SNF2L1 OS=Homo sapiens OX=9606 GN=SMARCA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	3	3	2
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	2-UNIMOD:1	0.07	35.0	3	3	3
PRT	sp|Q8TEU7|RPGF6_HUMAN	Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|Q9UHW9-6|S12A6_HUMAN	Isoform 6 of Solute carrier family 12 member 6 OS=Homo sapiens OX=9606 GN=SLC12A6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|O75676-2|KS6A4_HUMAN	Isoform 2 of Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens OX=9606 GN=RPS6KA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	10-UNIMOD:4	0.02	35.0	1	1	0
PRT	sp|Q9HAV7|GRPE1_HUMAN	GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.13	35.0	6	3	2
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	35.0	null	321-UNIMOD:28	0.03	35.0	5	1	0
PRT	sp|Q9HCY8|S10AE_HUMAN	Protein S100-A14 OS=Homo sapiens OX=9606 GN=S100A14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.15	35.0	2	1	0
PRT	sp|Q9H0U9|TSYL1_HUMAN	Testis-specific Y-encoded-like protein 1 OS=Homo sapiens OX=9606 GN=TSPYL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	2	1	0
PRT	sp|Q5VT52-5|RPRD2_HUMAN	Isoform 5 of Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q99536-3|VAT1_HUMAN	Isoform 3 of Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.07	35.0	2	2	1
PRT	sp|Q9UPN6|SCAF8_HUMAN	SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	2	1	0
PRT	sp|Q9BQ39|DDX50_HUMAN	ATP-dependent RNA helicase DDX50 OS=Homo sapiens OX=9606 GN=DDX50 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.06	35.0	7	4	2
PRT	sp|Q9NPC7-3|MYNN_HUMAN	Isoform 3 of Myoneurin OS=Homo sapiens OX=9606 GN=MYNN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	2	1	0
PRT	sp|O75410-7|TACC1_HUMAN	Isoform 7 of Transforming acidic coiled-coil-containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	3	1	0
PRT	sp|Q96ER3|SAAL1_HUMAN	Protein SAAL1 OS=Homo sapiens OX=9606 GN=SAAL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	74-UNIMOD:4,69-UNIMOD:35	0.05	35.0	3	1	0
PRT	sp|O75976-2|CBPD_HUMAN	Isoform 2 of Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	62-UNIMOD:4	0.02	35.0	2	2	2
PRT	sp|A6H8Y1-5|BDP1_HUMAN	Isoform 5 of Transcription factor TFIIIB component B'' homolog OS=Homo sapiens OX=9606 GN=BDP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q9NX74|DUS2L_HUMAN	tRNA-dihydrouridine(20) synthase [NAD(P)+]-like OS=Homo sapiens OX=9606 GN=DUS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	2	1	0
PRT	sp|Q9H2J4|PDCL3_HUMAN	Phosducin-like protein 3 OS=Homo sapiens OX=9606 GN=PDCL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	51-UNIMOD:35	0.10	35.0	1	1	1
PRT	sp|O00443|P3C2A_HUMAN	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	4	2	0
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.09	35.0	3	2	0
PRT	sp|Q92614|MY18A_HUMAN	Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.02	35.0	8	2	0
PRT	sp|O75717|WDHD1_HUMAN	WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=WDHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.03	35.0	5	2	0
PRT	sp|Q9H0E9|BRD8_HUMAN	Bromodomain-containing protein 8 OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.03	35.0	2	2	0
PRT	sp|Q9H5N1|RABE2_HUMAN	Rab GTPase-binding effector protein 2 OS=Homo sapiens OX=9606 GN=RABEP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	2-UNIMOD:1	0.03	35.0	1	1	1
PRT	sp|Q6UXH1|CREL2_HUMAN	Protein disulfide isomerase CRELD2 OS=Homo sapiens OX=9606 GN=CRELD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	284-UNIMOD:27,288-UNIMOD:4,294-UNIMOD:4	0.05	35.0	2	1	0
PRT	sp|Q9BYX2|TBD2A_HUMAN	TBC1 domain family member 2A OS=Homo sapiens OX=9606 GN=TBC1D2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	1-UNIMOD:1,37-UNIMOD:4	0.04	35.0	3	1	0
PRT	sp|P78563|RED1_HUMAN	Double-stranded RNA-specific editase 1 OS=Homo sapiens OX=9606 GN=ADARB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	35.0	2	1	0
PRT	sp|P49750|YLPM1_HUMAN	YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|P35659-2|DEK_HUMAN	Isoform 2 of Protein DEK OS=Homo sapiens OX=9606 GN=DEK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	188-UNIMOD:4	0.08	34.0	4	2	0
PRT	sp|O60503|ADCY9_HUMAN	Adenylate cyclase type 9 OS=Homo sapiens OX=9606 GN=ADCY9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1333-UNIMOD:4	0.01	34.0	2	1	0
PRT	sp|O60216|RAD21_HUMAN	Double-strand-break repair protein rad21 homolog OS=Homo sapiens OX=9606 GN=RAD21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.03	34.0	4	1	0
PRT	sp|P35226|BMI1_HUMAN	Polycomb complex protein BMI-1 OS=Homo sapiens OX=9606 GN=BMI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	1	1	1
PRT	sp|Q8TE04-3|PANK1_HUMAN	Isoform 3 of Pantothenate kinase 1 OS=Homo sapiens OX=9606 GN=PANK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|Q8WUY3-4|PRUN2_HUMAN	Isoform 4 of Protein prune homolog 2 OS=Homo sapiens OX=9606 GN=PRUNE2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	2	2	1
PRT	sp|Q9H2J7-2|S6A15_HUMAN	Isoform 2 of Sodium-dependent neutral amino acid transporter B(0)AT2 OS=Homo sapiens OX=9606 GN=SLC6A15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	1	1	1
PRT	sp|Q96SB8|SMC6_HUMAN	Structural maintenance of chromosomes protein 6 OS=Homo sapiens OX=9606 GN=SMC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	4	2	0
PRT	sp|Q13619-2|CUL4A_HUMAN	Isoform 2 of Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	8	2	0
PRT	sp|Q68EM7-4|RHG17_HUMAN	Isoform 4 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	190-UNIMOD:4	0.07	34.0	2	1	0
PRT	sp|Q9Y4E6-2|WDR7_HUMAN	Isoform 2 of WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=WDR7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	769-UNIMOD:35	0.01	34.0	3	1	0
PRT	sp|P09884|DPOLA_HUMAN	DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	3	2	1
PRT	sp|Q14789-4|GOGB1_HUMAN	Isoform 4 of Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	9	6	2
PRT	sp|Q9NYH9|UTP6_HUMAN	U3 small nucleolar RNA-associated protein 6 homolog OS=Homo sapiens OX=9606 GN=UTP6 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.03	34.0	3	1	0
PRT	sp|O14686|KMT2D_HUMAN	Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.00	34.0	3	2	1
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	2	1	0
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	190-UNIMOD:35	0.03	34.0	4	1	0
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	475-UNIMOD:27	0.02	34.0	10	3	0
PRT	sp|Q53EZ4-2|CEP55_HUMAN	Isoform 2 of Centrosomal protein of 55 kDa OS=Homo sapiens OX=9606 GN=CEP55	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	2	1	0
PRT	sp|Q92834-4|RPGR_HUMAN	Isoform 4 of X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens OX=9606 GN=RPGR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	2	1	0
PRT	sp|Q9H9A5-2|CNO10_HUMAN	Isoform 2 of CCR4-NOT transcription complex subunit 10 OS=Homo sapiens OX=9606 GN=CNOT10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	503-UNIMOD:4	0.03	34.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	3696-UNIMOD:4,3697-UNIMOD:4,1142-UNIMOD:35	0.01	34.0	3	3	2
PRT	sp|Q9NZ53-2|PDXL2_HUMAN	Isoform 2 of Podocalyxin-like protein 2 OS=Homo sapiens OX=9606 GN=PODXL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	3	3	3
PRT	sp|Q9BWU1-2|CDK19_HUMAN	Isoform 2 of Cyclin-dependent kinase 19 OS=Homo sapiens OX=9606 GN=CDK19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	2	1	0
PRT	sp|Q9NTI5|PDS5B_HUMAN	Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	975-UNIMOD:28	0.05	34.0	8	5	2
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	2	1	0
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q92543-2|SNX19_HUMAN	Isoform 2 of Sorting nexin-19 OS=Homo sapiens OX=9606 GN=SNX19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	2	1	0
PRT	sp|Q6P3S1|DEN1B_HUMAN	DENN domain-containing protein 1B OS=Homo sapiens OX=9606 GN=DENND1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P42696-2|RBM34_HUMAN	Isoform 2 of RNA-binding protein 34 OS=Homo sapiens OX=9606 GN=RBM34	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.10	34.0	2	1	0
PRT	sp|Q8N5P1|ZC3H8_HUMAN	Zinc finger CCCH domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZC3H8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.09	34.0	3	1	0
PRT	sp|Q5VZ89-5|DEN4C_HUMAN	Isoform 5 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	3	2	1
PRT	sp|Q96QE3-2|ATAD5_HUMAN	Isoform 2 of ATPase family AAA domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ATAD5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q13823|NOG2_HUMAN	Nucleolar GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=GNL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	2	1	0
PRT	sp|Q5UIP0-2|RIF1_HUMAN	Isoform 2 of Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	6	3	2
PRT	sp|O00429-4|DNM1L_HUMAN	Isoform 3 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	607-UNIMOD:4	0.05	34.0	4	3	1
PRT	sp|Q5T5P2-4|SKT_HUMAN	Isoform 4 of Sickle tail protein homolog OS=Homo sapiens OX=9606 GN=KIAA1217	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	3	2	1
PRT	sp|Q99675|CGRF1_HUMAN	Cell growth regulator with RING finger domain protein 1 OS=Homo sapiens OX=9606 GN=CGRRF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|Q2NKX8|ERC6L_HUMAN	DNA excision repair protein ERCC-6-like OS=Homo sapiens OX=9606 GN=ERCC6L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q15459|SF3A1_HUMAN	Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	325-UNIMOD:35	0.07	34.0	3	2	1
PRT	sp|P80303|NUCB2_HUMAN	Nucleobindin-2 OS=Homo sapiens OX=9606 GN=NUCB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.05	34.0	1	1	0
PRT	sp|P49768|PSN1_HUMAN	Presenilin-1 OS=Homo sapiens OX=9606 GN=PSEN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.04	34.0	1	1	0
PRT	sp|Q14BN4|SLMAP_HUMAN	Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	467-UNIMOD:35	0.03	34.0	2	1	0
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	33-UNIMOD:35	0.21	34.0	4	3	2
PRT	sp|O75475|PSIP1_HUMAN	PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	202-UNIMOD:28,204-UNIMOD:4	0.06	34.0	10	2	0
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	99-UNIMOD:35,110-UNIMOD:35,111-UNIMOD:35	0.11	34.0	5	3	2
PRT	sp|Q5JQC4|CT47A_HUMAN	Cancer/testis antigen 47A OS=Homo sapiens OX=9606 GN=CT47A1 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.11	34.0	1	1	1
PRT	sp|Q9NUA8|ZBT40_HUMAN	Zinc finger and BTB domain-containing protein 40 OS=Homo sapiens OX=9606 GN=ZBTB40 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P08397|HEM3_HUMAN	Porphobilinogen deaminase OS=Homo sapiens OX=9606 GN=HMBS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1	0.05	34.0	2	1	0
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1,13-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|Q7L7V1|DHX32_HUMAN	Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Homo sapiens OX=9606 GN=DHX32 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	1-UNIMOD:1,8-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|O43169|CYB5B_HUMAN	Cytochrome b5 type B OS=Homo sapiens OX=9606 GN=CYB5B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1	0.11	34.0	1	1	1
PRT	sp|Q7Z3E2|CC186_HUMAN	Coiled-coil domain-containing protein 186 OS=Homo sapiens OX=9606 GN=CCDC186 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1	0.02	34.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	34.0	1	1	1
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	13	3	1
PRT	sp|Q9Y4L1|HYOU1_HUMAN	Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.05	33.0	8	4	1
PRT	sp|P09493-2|TPM1_HUMAN	Isoform 2 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.10	33.0	3	2	1
PRT	sp|Q03111|ENL_HUMAN	Protein ENL OS=Homo sapiens OX=9606 GN=MLLT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|Q93008-1|USP9X_HUMAN	Isoform 2 of Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	864-UNIMOD:4,1956-UNIMOD:35,1908-UNIMOD:4	0.03	33.0	7	5	1
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	7	3	1
PRT	sp|P55199|ELL_HUMAN	RNA polymerase II elongation factor ELL OS=Homo sapiens OX=9606 GN=ELL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q53GS7-2|GLE1_HUMAN	Isoform 2 of Nucleoporin GLE1 OS=Homo sapiens OX=9606 GN=GLE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	2	2	2
PRT	sp|O95716|RAB3D_HUMAN	Ras-related protein Rab-3D OS=Homo sapiens OX=9606 GN=RAB3D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	137-UNIMOD:4	0.07	33.0	1	1	1
PRT	sp|P16383-3|GCFC2_HUMAN	Isoform 3 of GC-rich sequence DNA-binding factor 2 OS=Homo sapiens OX=9606 GN=GCFC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.13	33.0	2	2	2
PRT	sp|Q96CT7|CC124_HUMAN	Coiled-coil domain-containing protein 124 OS=Homo sapiens OX=9606 GN=CCDC124 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.12	33.0	3	2	1
PRT	sp|Q9BZ23-3|PANK2_HUMAN	Isoform 2 of Pantothenate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PANK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|O60524-2|NEMF_HUMAN	Isoform 2 of Nuclear export mediator factor NEMF OS=Homo sapiens OX=9606 GN=NEMF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	2	1	0
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	3	1	0
PRT	sp|Q9C0B7|TNG6_HUMAN	Transport and Golgi organization protein 6 homolog OS=Homo sapiens OX=9606 GN=TANGO6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	2	1	0
PRT	sp|Q00341-2|VIGLN_HUMAN	Isoform 2 of Vigilin OS=Homo sapiens OX=9606 GN=HDLBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	128-UNIMOD:35	0.03	33.0	2	2	2
PRT	sp|Q15643-2|TRIPB_HUMAN	Isoform 2 of Thyroid receptor-interacting protein 11 OS=Homo sapiens OX=9606 GN=TRIP11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	6	4	3
PRT	sp|Q8IXJ9-2|ASXL1_HUMAN	Isoform 2 of Polycomb group protein ASXL1 OS=Homo sapiens OX=9606 GN=ASXL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	2	1	0
PRT	sp|Q8NBJ4-2|GOLM1_HUMAN	Isoform 2 of Golgi membrane protein 1 OS=Homo sapiens OX=9606 GN=GOLM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	160-UNIMOD:4	0.08	33.0	3	2	1
PRT	sp|Q14980-4|NUMA1_HUMAN	Isoform 4 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	4	3	2
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.04	33.0	5	3	1
PRT	sp|P84085|ARF5_HUMAN	ADP-ribosylation factor 5 OS=Homo sapiens OX=9606 GN=ARF5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|Q9H930-2|SP14L_HUMAN	Isoform 2 of Nuclear body protein SP140-like protein OS=Homo sapiens OX=9606 GN=SP140L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	422-UNIMOD:4,423-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.05	33.0	9	5	2
PRT	sp|Q14677|EPN4_HUMAN	Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	2	1	0
PRT	sp|P31942-2|HNRH3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|P82675|RT05_HUMAN	28S ribosomal protein S5, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.06	33.0	7	3	0
PRT	sp|Q9H7D0|DOCK5_HUMAN	Dedicator of cytokinesis protein 5 OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q15361|TTF1_HUMAN	Transcription termination factor 1 OS=Homo sapiens OX=9606 GN=TTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	4	3	2
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1312-UNIMOD:35,3130-UNIMOD:4	0.03	33.0	24	14	6
PRT	sp|P63208|SKP1_HUMAN	S-phase kinase-associated protein 1 OS=Homo sapiens OX=9606 GN=SKP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.13	33.0	38	3	1
PRT	sp|Q13564-3|ULA1_HUMAN	Isoform 3 of NEDD8-activating enzyme E1 regulatory subunit OS=Homo sapiens OX=9606 GN=NAE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	2	1	0
PRT	sp|Q9H2K8|TAOK3_HUMAN	Serine/threonine-protein kinase TAO3 OS=Homo sapiens OX=9606 GN=TAOK3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|P61006-2|RAB8A_HUMAN	Isoform 2 of Ras-related protein Rab-8A OS=Homo sapiens OX=9606 GN=RAB8A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	17	1	0
PRT	sp|O00505|IMA4_HUMAN	Importin subunit alpha-4 OS=Homo sapiens OX=9606 GN=KPNA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	2	1	0
PRT	sp|Q13123|RED_HUMAN	Protein Red OS=Homo sapiens OX=9606 GN=IK PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	3	2	1
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	200-UNIMOD:4	0.02	33.0	3	1	0
PRT	sp|Q9C035-6|TRIM5_HUMAN	Isoform Iota of Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	2	1	0
PRT	sp|Q08379|GOGA2_HUMAN	Golgin subfamily A member 2 OS=Homo sapiens OX=9606 GN=GOLGA2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	189-UNIMOD:28,824-UNIMOD:27	0.03	33.0	8	3	0
PRT	sp|Q8TD26|CHD6_HUMAN	Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens OX=9606 GN=CHD6 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q56NI9|ESCO2_HUMAN	N-acetyltransferase ESCO2 OS=Homo sapiens OX=9606 GN=ESCO2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|Q9UNS2-2|CSN3_HUMAN	Isoform 2 of COP9 signalosome complex subunit 3 OS=Homo sapiens OX=9606 GN=COPS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	6	6	6
PRT	sp|Q9H6Z4-3|RANB3_HUMAN	Isoform 3 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	160-UNIMOD:4	0.03	33.0	2	1	0
PRT	sp|O14981|BTAF1_HUMAN	TATA-binding protein-associated factor 172 OS=Homo sapiens OX=9606 GN=BTAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q9Y6X8|ZHX2_HUMAN	Zinc fingers and homeoboxes protein 2 OS=Homo sapiens OX=9606 GN=ZHX2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	738-UNIMOD:4	0.03	33.0	4	2	1
PRT	sp|Q6PJE2-5|POZP3_HUMAN	Isoform 2 of POM121 and ZP3 fusion protein OS=Homo sapiens OX=9606 GN=POMZP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.15	33.0	2	1	0
PRT	sp|Q9UM47|NOTC3_HUMAN	Neurogenic locus notch homolog protein 3 OS=Homo sapiens OX=9606 GN=NOTCH3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	1747-UNIMOD:4,1739-UNIMOD:35	0.01	33.0	2	1	0
PRT	sp|Q7KZ85|SPT6H_HUMAN	Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	2	2	1
PRT	sp|Q9UHX1|PUF60_HUMAN	Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	487-UNIMOD:4,503-UNIMOD:28	0.05	33.0	12	2	0
PRT	sp|Q9NZM1|MYOF_HUMAN	Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.02	33.0	5	2	1
PRT	sp|Q9NXC5|MIO_HUMAN	GATOR complex protein MIOS OS=Homo sapiens OX=9606 GN=MIOS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	377-UNIMOD:4	0.02	33.0	1	1	0
PRT	sp|Q8NBN7|RDH13_HUMAN	Retinol dehydrogenase 13 OS=Homo sapiens OX=9606 GN=RDH13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	293-UNIMOD:28	0.05	33.0	1	1	1
PRT	sp|Q5EBL4|RIPL1_HUMAN	RILP-like protein 1 OS=Homo sapiens OX=9606 GN=RILPL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.07	33.0	2	1	0
PRT	sp|Q9H4A4|AMPB_HUMAN	Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.02	33.0	1	1	1
PRT	sp|P39748|FEN1_HUMAN	Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|Q9UKJ5|CHIC2_HUMAN	Cysteine-rich hydrophobic domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHIC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.10	33.0	1	1	1
PRT	sp|Q9NZU5|LMCD1_HUMAN	LIM and cysteine-rich domains protein 1 OS=Homo sapiens OX=9606 GN=LMCD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	52-UNIMOD:385,52-UNIMOD:4,58-UNIMOD:4	0.05	33.0	2	1	0
PRT	sp|Q04721|NOTC2_HUMAN	Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	2	2	2
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.06	32.0	6	1	0
PRT	sp|Q92673|SORL_HUMAN	Sortilin-related receptor OS=Homo sapiens OX=9606 GN=SORL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	1534-UNIMOD:4,1540-UNIMOD:4,736-UNIMOD:4	0.01	32.0	3	2	1
PRT	sp|P20810-3|ICAL_HUMAN	Isoform 3 of Calpastatin OS=Homo sapiens OX=9606 GN=CAST	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	210-UNIMOD:4	0.02	32.0	2	1	0
PRT	sp|P62633-8|CNBP_HUMAN	Isoform 8 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	60-UNIMOD:4,68-UNIMOD:4,71-UNIMOD:4	0.09	32.0	3	1	0
PRT	sp|Q8NCN4|RN169_HUMAN	E3 ubiquitin-protein ligase RNF169 OS=Homo sapiens OX=9606 GN=RNF169 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	132-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	1	0
PRT	sp|Q14699|RFTN1_HUMAN	Raftlin OS=Homo sapiens OX=9606 GN=RFTN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	3	1	0
PRT	sp|Q96JK2-2|DCAF5_HUMAN	Isoform 2 of DDB1- and CUL4-associated factor 5 OS=Homo sapiens OX=9606 GN=DCAF5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9UKS6|PACN3_HUMAN	Protein kinase C and casein kinase substrate in neurons protein 3 OS=Homo sapiens OX=9606 GN=PACSIN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.07	32.0	2	1	0
PRT	sp|Q14676-3|MDC1_HUMAN	Isoform 3 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	5	3	0
PRT	sp|Q9UJA5-3|TRM6_HUMAN	Isoform 3 of tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Homo sapiens OX=9606 GN=TRMT6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	2	2	1
PRT	sp|Q96KR1|ZFR_HUMAN	Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	2	2	2
PRT	sp|Q9UJZ1|STML2_HUMAN	Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	192-UNIMOD:35	0.08	32.0	5	2	1
PRT	sp|Q641Q2-2|WAC2A_HUMAN	Isoform 2 of WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q7L1V2|MON1B_HUMAN	Vacuolar fusion protein MON1 homolog B OS=Homo sapiens OX=9606 GN=MON1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	2	1	0
PRT	sp|Q9BZQ8|NIBA1_HUMAN	Protein Niban 1 OS=Homo sapiens OX=9606 GN=NIBAN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	763-UNIMOD:4	0.02	32.0	2	1	0
PRT	sp|Q9BW71|HIRP3_HUMAN	HIRA-interacting protein 3 OS=Homo sapiens OX=9606 GN=HIRIP3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	4	4	4
PRT	sp|Q13822|ENPP2_HUMAN	Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Homo sapiens OX=9606 GN=ENPP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	149-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|Q15375-4|EPHA7_HUMAN	Isoform 4 of Ephrin type-A receptor 7 OS=Homo sapiens OX=9606 GN=EPHA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	234-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|Q6VN20-2|RBP10_HUMAN	Isoform 2 of Ran-binding protein 10 OS=Homo sapiens OX=9606 GN=RANBP10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	1	0
PRT	sp|O60304-2|ZN500_HUMAN	Isoform 2 of Zinc finger protein 500 OS=Homo sapiens OX=9606 GN=ZNF500	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	1	0
PRT	sp|Q9Y4C8|RBM19_HUMAN	Probable RNA-binding protein 19 OS=Homo sapiens OX=9606 GN=RBM19 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	1	0
PRT	sp|Q5T1M5|FKB15_HUMAN	FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.02	32.0	5	2	0
PRT	sp|Q9Y613|FHOD1_HUMAN	FH1/FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHOD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.01	32.0	3	2	1
PRT	sp|Q5T200-2|ZC3HD_HUMAN	Isoform 2 of Zinc finger CCCH domain-containing protein 13 OS=Homo sapiens OX=9606 GN=ZC3H13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|O15213|WDR46_HUMAN	WD repeat-containing protein 46 OS=Homo sapiens OX=9606 GN=WDR46 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.02	32.0	13	1	0
PRT	sp|Q5SW79-2|CE170_HUMAN	Isoform 2 of Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	2	2
PRT	sp|O60306|AQR_HUMAN	RNA helicase aquarius OS=Homo sapiens OX=9606 GN=AQR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	483-UNIMOD:28	0.02	32.0	4	2	0
PRT	sp|Q12873|CHD3_HUMAN	Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens OX=9606 GN=CHD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	32.0	null	1309-UNIMOD:28	0.02	32.0	4	2	1
PRT	sp|P42330-2|AK1C3_HUMAN	Isoform 2 of Aldo-keto reductase family 1 member C3 OS=Homo sapiens OX=9606 GN=AKR1C3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	0
PRT	sp|Q9Y3D9|RT23_HUMAN	28S ribosomal protein S23, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS23 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|Q96BP3-2|PPWD1_HUMAN	Isoform 2 of Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=PPWD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q9NPI1|BRD7_HUMAN	Bromodomain-containing protein 7 OS=Homo sapiens OX=9606 GN=BRD7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	646-UNIMOD:4	0.04	32.0	3	2	1
PRT	sp|Q05209|PTN12_HUMAN	Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q96B36-2|AKTS1_HUMAN	Isoform 2 of Proline-rich AKT1 substrate 1 OS=Homo sapiens OX=9606 GN=AKT1S1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.13	32.0	1	1	1
PRT	sp|Q9BQ70|TCF25_HUMAN	Transcription factor 25 OS=Homo sapiens OX=9606 GN=TCF25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	2	2	2
PRT	sp|Q7Z6E9|RBBP6_HUMAN	E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q9NQT8|KI13B_HUMAN	Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	773-UNIMOD:4	0.02	32.0	2	2	2
PRT	sp|Q9UJX4-2|APC5_HUMAN	Isoform 2 of Anaphase-promoting complex subunit 5 OS=Homo sapiens OX=9606 GN=ANAPC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	487-UNIMOD:4,370-UNIMOD:35	0.05	32.0	4	3	2
PRT	sp|Q9Y3L3-2|3BP1_HUMAN	Isoform 2 of SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	33-UNIMOD:27	0.04	32.0	7	2	0
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	42-UNIMOD:35,27-UNIMOD:35	0.05	32.0	5	3	2
PRT	sp|Q8TAF3|WDR48_HUMAN	WD repeat-containing protein 48 OS=Homo sapiens OX=9606 GN=WDR48 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	628-UNIMOD:27	0.05	32.0	4	2	0
PRT	sp|P28370|SMCA1_HUMAN	Probable global transcription activator SNF2L1 OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	906-UNIMOD:4	0.02	32.0	2	2	1
PRT	sp|O14776|TCRG1_HUMAN	Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	32.0	null	609-UNIMOD:27,614-UNIMOD:35	0.02	32.0	4	1	0
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1	0.05	32.0	1	1	1
PRT	sp|Q08378|GOGA3_HUMAN	Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	1-UNIMOD:1	0.01	32.0	1	1	1
PRT	sp|Q04637|IF4G1_HUMAN	Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	1008-UNIMOD:27,1011-UNIMOD:35,934-UNIMOD:4,936-UNIMOD:4	0.02	32.0	3	2	1
PRT	sp|P61006|RAB8A_HUMAN	Ras-related protein Rab-8A OS=Homo sapiens OX=9606 GN=RAB8A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.06	32.0	1	1	0
PRT	sp|Q13164|MK07_HUMAN	Mitogen-activated protein kinase 7 OS=Homo sapiens OX=9606 GN=MAPK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1	0.03	32.0	1	1	1
PRT	sp|Q7LGA3|HS2ST_HUMAN	Heparan sulfate 2-O-sulfotransferase 1 OS=Homo sapiens OX=9606 GN=HS2ST1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	201-UNIMOD:4,209-UNIMOD:4	0.05	32.0	2	1	0
PRT	sp|Q9UEY8|ADDG_HUMAN	Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.02	32.0	1	1	0
PRT	sp|O75164|KDM4A_HUMAN	Lysine-specific demethylase 4A OS=Homo sapiens OX=9606 GN=KDM4A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	369-UNIMOD:4	0.03	32.0	3	1	0
PRT	sp|Q6I9Y2|THOC7_HUMAN	THO complex subunit 7 homolog OS=Homo sapiens OX=9606 GN=THOC7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	198-UNIMOD:35	0.09	32.0	1	1	1
PRT	sp|Q13029-5|PRDM2_HUMAN	Isoform 5 of PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	111-UNIMOD:4	0.01	31.0	1	1	0
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	241-UNIMOD:28	0.09	31.0	3	2	1
PRT	sp|P41227-2|NAA10_HUMAN	Isoform 2 of N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	7	1	0
PRT	sp|Q68DK2-3|ZFY26_HUMAN	Isoform 3 of Zinc finger FYVE domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ZFYVE26	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.13	31.0	2	1	0
PRT	sp|O14879|IFIT3_HUMAN	Interferon-induced protein with tetratricopeptide repeats 3 OS=Homo sapiens OX=9606 GN=IFIT3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|P43034|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	34-UNIMOD:27	0.03	31.0	15	2	0
PRT	sp|P49585|PCY1A_HUMAN	Choline-phosphate cytidylyltransferase A OS=Homo sapiens OX=9606 GN=PCYT1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.05	31.0	2	1	0
PRT	sp|Q5TA31|RN187_HUMAN	E3 ubiquitin-protein ligase RNF187 OS=Homo sapiens OX=9606 GN=RNF187 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	2	1	0
PRT	sp|Q9UJF2-2|NGAP_HUMAN	Isoform 2 of Ras GTPase-activating protein nGAP OS=Homo sapiens OX=9606 GN=RASAL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q4LE39-3|ARI4B_HUMAN	Isoform 3 of AT-rich interactive domain-containing protein 4B OS=Homo sapiens OX=9606 GN=ARID4B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q99996-5|AKAP9_HUMAN	Isoform 5 of A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	4	3	1
PRT	sp|Q96EN8|MOCOS_HUMAN	Molybdenum cofactor sulfurase OS=Homo sapiens OX=9606 GN=MOCOS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|O95573|ACSL3_HUMAN	Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens OX=9606 GN=ACSL3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	109-UNIMOD:27	0.02	31.0	5	1	0
PRT	sp|Q9NV35|NUD15_HUMAN	Nucleotide triphosphate diphosphatase NUDT15 OS=Homo sapiens OX=9606 GN=NUDT15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	1	1	1
PRT	sp|P36551|HEM6_HUMAN	Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial OS=Homo sapiens OX=9606 GN=CPOX PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	373-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|Q03013-2|GSTM4_HUMAN	Isoform 2 of Glutathione S-transferase Mu 4 OS=Homo sapiens OX=9606 GN=GSTM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	87-UNIMOD:4	0.06	31.0	2	1	0
PRT	sp|O75369-8|FLNB_HUMAN	Isoform 8 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	604-UNIMOD:4	0.01	31.0	2	2	2
PRT	sp|Q9Y2R9|RT07_HUMAN	28S ribosomal protein S7, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q07866-8|KLC1_HUMAN	Isoform S of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	4	3	2
PRT	sp|Q52LJ0-1|FA98B_HUMAN	Isoform 1 of Protein FAM98B OS=Homo sapiens OX=9606 GN=FAM98B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	197-UNIMOD:35	0.04	31.0	1	1	1
PRT	sp|P78316-2|NOP14_HUMAN	Isoform 2 of Nucleolar protein 14 OS=Homo sapiens OX=9606 GN=NOP14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	2	2
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|Q9UEE5|ST17A_HUMAN	Serine/threonine-protein kinase 17A OS=Homo sapiens OX=9606 GN=STK17A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q9Y678|COPG1_HUMAN	Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	516-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|Q15008-3|PSMD6_HUMAN	Isoform 3 of 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|Q6PL18|ATAD2_HUMAN	ATPase family AAA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ATAD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q12769|NU160_HUMAN	Nuclear pore complex protein Nup160 OS=Homo sapiens OX=9606 GN=NUP160 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	1166-UNIMOD:4,678-UNIMOD:27,679-UNIMOD:35,687-UNIMOD:35	0.02	31.0	12	2	0
PRT	sp|Q9NXH8|TOR4A_HUMAN	Torsin-4A OS=Homo sapiens OX=9606 GN=TOR4A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	2	1	0
PRT	sp|Q9Y2F5|ICE1_HUMAN	Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	2	1	0
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	9	1	0
PRT	sp|A0JLT2|MED19_HUMAN	Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|P78362|SRPK2_HUMAN	SRSF protein kinase 2 OS=Homo sapiens OX=9606 GN=SRPK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	2	2	2
PRT	sp|Q562F6|SGO2_HUMAN	Shugoshin 2 OS=Homo sapiens OX=9606 GN=SGO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|P56181-2|NDUV3_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|Q9NRL2|BAZ1A_HUMAN	Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens OX=9606 GN=BAZ1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	1038-UNIMOD:35	0.01	31.0	3	1	0
PRT	sp|Q5T3I0|GPTC4_HUMAN	G patch domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GPATCH4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	383-UNIMOD:28	0.07	31.0	4	3	2
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.06	31.0	1	1	0
PRT	sp|Q5T5P2|SKT_HUMAN	Sickle tail protein homolog OS=Homo sapiens OX=9606 GN=KIAA1217 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q5VSL9|STRP1_HUMAN	Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q6ZVM7|TM1L2_HUMAN	TOM1-like protein 2 OS=Homo sapiens OX=9606 GN=TOM1L2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.03	31.0	1	1	0
PRT	sp|Q9C035|TRIM5_HUMAN	Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	153-UNIMOD:28	0.03	31.0	1	1	0
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	131-UNIMOD:4	0.04	31.0	3	1	0
PRT	sp|O75676|KS6A4_HUMAN	Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens OX=9606 GN=RPS6KA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	1-UNIMOD:1,10-UNIMOD:4	0.02	31.0	2	1	0
PRT	sp|P62195|PRS8_HUMAN	26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1,9-UNIMOD:35	0.04	31.0	2	1	0
PRT	sp|Q9P1Y6|PHRF1_HUMAN	PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	186-UNIMOD:4,189-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|O43583|DENR_HUMAN	Density-regulated protein OS=Homo sapiens OX=9606 GN=DENR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1,13-UNIMOD:4	0.07	31.0	4	1	0
PRT	sp|Q9NW13|RBM28_HUMAN	RNA-binding protein 28 OS=Homo sapiens OX=9606 GN=RBM28 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q9H019-3|MFR1L_HUMAN	Isoform 3 of Mitochondrial fission regulator 1-like OS=Homo sapiens OX=9606 GN=MTFR1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	210-UNIMOD:4,218-UNIMOD:4	0.06	30.0	1	1	1
PRT	sp|O95785-2|WIZ_HUMAN	Isoform 2 of Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|Q06265-3|EXOS9_HUMAN	Isoform 3 of Exosome complex component RRP45 OS=Homo sapiens OX=9606 GN=EXOSC9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|O94979-7|SC31A_HUMAN	Isoform 7 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	3	1	0
PRT	sp|Q9P107-2|GMIP_HUMAN	Isoform 2 of GEM-interacting protein OS=Homo sapiens OX=9606 GN=GMIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	931-UNIMOD:4,932-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|P62633-7|CNBP_HUMAN	Isoform 7 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	50-UNIMOD:4,57-UNIMOD:4,60-UNIMOD:4	0.09	30.0	2	1	0
PRT	sp|Q96F63|CCD97_HUMAN	Coiled-coil domain-containing protein 97 OS=Homo sapiens OX=9606 GN=CCDC97 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.11	30.0	3	3	3
PRT	sp|P07686|HEXB_HUMAN	Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	2	1	0
PRT	sp|Q96PC5|MIA2_HUMAN	Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	739-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|Q9NSQ0|RRP7B_HUMAN	Putative ribosomal RNA-processing protein 7 homolog B OS=Homo sapiens OX=9606 GN=RRP7BP PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.14	30.0	1	1	1
PRT	sp|Q5F1R6|DJC21_HUMAN	DnaJ homolog subfamily C member 21 OS=Homo sapiens OX=9606 GN=DNAJC21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	2	2	2
PRT	sp|C9J7I0|UMAD1_HUMAN	UBAP1-MVB12-associated (UMA)-domain containing protein 1 OS=Homo sapiens OX=9606 GN=UMAD1 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.12	30.0	1	1	1
PRT	sp|Q96A33-2|CCD47_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 47 OS=Homo sapiens OX=9606 GN=CCDC47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|Q8WVK2|SNR27_HUMAN	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP27 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	87-UNIMOD:28	0.08	30.0	4	2	0
PRT	sp|O95104-2|SCAF4_HUMAN	Isoform 2 of SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	2	2	1
PRT	sp|P50990-3|TCPQ_HUMAN	Isoform 3 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	312-UNIMOD:35,203-UNIMOD:35	0.08	30.0	3	3	2
PRT	sp|O14617-3|AP3D1_HUMAN	Isoform 3 of AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P54920|SNAA_HUMAN	Alpha-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	4	2	0
PRT	sp|Q92930|RAB8B_HUMAN	Ras-related protein Rab-8B OS=Homo sapiens OX=9606 GN=RAB8B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	2	1	0
PRT	sp|O15145|ARPC3_HUMAN	Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens OX=9606 GN=ARPC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.07	30.0	2	1	0
PRT	sp|Q96PY6-4|NEK1_HUMAN	Isoform 4 of Serine/threonine-protein kinase Nek1 OS=Homo sapiens OX=9606 GN=NEK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	3	2	0
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	34-UNIMOD:28,2031-UNIMOD:27	0.02	30.0	8	4	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.09	30.0	2	1	0
PRT	sp|Q5TKA1-3|LIN9_HUMAN	Isoform 3 of Protein lin-9 homolog OS=Homo sapiens OX=9606 GN=LIN9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	400-UNIMOD:4	0.02	30.0	2	2	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	4	2	0
PRT	sp|Q5VUA4|ZN318_HUMAN	Zinc finger protein 318 OS=Homo sapiens OX=9606 GN=ZNF318 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1770-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|O14639-4|ABLM1_HUMAN	Isoform 4 of Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|O60488-2|ACSL4_HUMAN	Isoform Short of Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens OX=9606 GN=ACSL4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q96QT4|TRPM7_HUMAN	Transient receptor potential cation channel subfamily M member 7 OS=Homo sapiens OX=9606 GN=TRPM7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	5	3	1
PRT	sp|O75167-5|PHAR2_HUMAN	Isoform 5 of Phosphatase and actin regulator 2 OS=Homo sapiens OX=9606 GN=PHACTR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	2	1	0
PRT	sp|Q15772-1|SPEG_HUMAN	Isoform 1 of Striated muscle preferentially expressed protein kinase OS=Homo sapiens OX=9606 GN=SPEG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.00	30.0	1	1	1
PRT	sp|P15923|TFE2_HUMAN	Transcription factor E2-alpha OS=Homo sapiens OX=9606 GN=TCF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	2	2
PRT	sp|Q9P0V9|SEP10_HUMAN	Septin-10 OS=Homo sapiens OX=9606 GN=SEPTIN10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	22-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null		0.02	30.0	7	1	0
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	8	3	0
PRT	sp|Q99996|AKAP9_HUMAN	A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	1619-UNIMOD:28	0.00	30.0	1	1	0
PRT	sp|P18858|DNLI1_HUMAN	DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	209-UNIMOD:28,162-UNIMOD:27	0.03	30.0	3	2	0
PRT	sp|O95831|AIFM1_HUMAN	Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|Q8N3F8|MILK1_HUMAN	MICAL-like protein 1 OS=Homo sapiens OX=9606 GN=MICALL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	239-UNIMOD:28	0.03	30.0	2	2	2
PRT	sp|Q9NS87|KIF15_HUMAN	Kinesin-like protein KIF15 OS=Homo sapiens OX=9606 GN=KIF15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|O95104|SCAF4_HUMAN	SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.01	30.0	1	1	0
PRT	sp|P11177|ODPB_HUMAN	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.05	30.0	1	1	0
PRT	sp|Q9UBC2|EP15R_HUMAN	Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	443-UNIMOD:28	0.02	30.0	3	1	0
PRT	sp|Q8N1W2|ZN710_HUMAN	Zinc finger protein 710 OS=Homo sapiens OX=9606 GN=ZNF710 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	91-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|P24821|TENA_HUMAN	Tenascin OS=Homo sapiens OX=9606 GN=TNC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	392-UNIMOD:385,392-UNIMOD:4,394-UNIMOD:4,403-UNIMOD:4	0.01	30.0	1	1	0
PRT	sp|Q9Y4E8|UBP15_HUMAN	Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1	0.01	30.0	2	1	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null		0.06	30.0	15	1	0
PRT	sp|Q9Y5J9|TIM8B_HUMAN	Mitochondrial import inner membrane translocase subunit Tim8 B OS=Homo sapiens OX=9606 GN=TIMM8B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1	0.17	30.0	4	1	0
PRT	sp|Q9UBU9|NXF1_HUMAN	Nuclear RNA export factor 1 OS=Homo sapiens OX=9606 GN=NXF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	61-UNIMOD:35	0.04	30.0	1	1	0
PRT	sp|Q16666|IF16_HUMAN	Gamma-interferon-inducible protein 16 OS=Homo sapiens OX=9606 GN=IFI16 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	2	1	0
PRT	sp|P41227|NAA10_HUMAN	N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.07	30.0	3	1	0
PRT	sp|P30876|RPB2_HUMAN	DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P10644|KAP0_HUMAN	cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	1-UNIMOD:1	0.04	30.0	5	1	0
PRT	sp|Q13564|ULA1_HUMAN	NEDD8-activating enzyme E1 regulatory subunit OS=Homo sapiens OX=9606 GN=NAE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.03	30.0	5	1	0
PRT	sp|Q14974|IMB1_HUMAN	Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	333-UNIMOD:28,345-UNIMOD:4	0.02	30.0	3	1	0
PRT	sp|Q8N5S9|KKCC1_HUMAN	Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=CAMKK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	424-UNIMOD:4	0.05	30.0	3	1	0
PRT	sp|P47755|CAZA2_HUMAN	F-actin-capping protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=CAPZA2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1	0.05	30.0	4	1	0
PRT	sp|Q13029|PRDM2_HUMAN	PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	312-UNIMOD:385,312-UNIMOD:4	0.01	30.0	2	1	0
PRT	sp|Q96ST3|SIN3A_HUMAN	Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	2	1	0
PRT	sp|Q96Q45|TM237_HUMAN	Transmembrane protein 237 OS=Homo sapiens OX=9606 GN=TMEM237 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q8N0X7|SPART_HUMAN	Spartin OS=Homo sapiens OX=9606 GN=SPART PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	1-UNIMOD:1	0.02	30.0	3	1	0
PRT	sp|Q8IVM0-2|CCD50_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 50 OS=Homo sapiens OX=9606 GN=CCDC50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	2	2	2
PRT	sp|Q68DH5|LMBD2_HUMAN	G-protein coupled receptor-associated protein LMBRD2 OS=Homo sapiens OX=9606 GN=LMBRD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	3	2	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	154-UNIMOD:4	0.12	29.0	8	3	1
PRT	sp|P29375-2|KDM5A_HUMAN	Isoform 2 of Lysine-specific demethylase 5A OS=Homo sapiens OX=9606 GN=KDM5A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	0
PRT	sp|O94874-3|UFL1_HUMAN	Isoform 3 of E3 UFM1-protein ligase 1 OS=Homo sapiens OX=9606 GN=UFL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|P28702|RXRB_HUMAN	Retinoic acid receptor RXR-beta OS=Homo sapiens OX=9606 GN=RXRB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	3	2	1
PRT	sp|Q9Y4D7-2|PLXD1_HUMAN	Isoform 2 of Plexin-D1 OS=Homo sapiens OX=9606 GN=PLXND1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	3	2	1
PRT	sp|A8MVW0|F1712_HUMAN	Protein FAM171A2 OS=Homo sapiens OX=9606 GN=FAM171A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q86VP6|CAND1_HUMAN	Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q06190-3|P2R3A_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha OS=Homo sapiens OX=9606 GN=PPP2R3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q92544|TM9S4_HUMAN	Transmembrane 9 superfamily member 4 OS=Homo sapiens OX=9606 GN=TM9SF4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	322-UNIMOD:35	0.02	29.0	3	1	0
PRT	sp|Q8N954-2|GPT11_HUMAN	Isoform 2 of G patch domain-containing protein 11 OS=Homo sapiens OX=9606 GN=GPATCH11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	147-UNIMOD:4	0.11	29.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	180-UNIMOD:35	0.05	29.0	24	5	1
PRT	sp|Q15696|U2AFM_HUMAN	U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2 OS=Homo sapiens OX=9606 GN=ZRSR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	2	2	2
PRT	sp|O95425-2|SVIL_HUMAN	Isoform 2 of Supervillin OS=Homo sapiens OX=9606 GN=SVIL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	2	2	2
PRT	sp|Q8IY37|DHX37_HUMAN	Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens OX=9606 GN=DHX37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	6	4	3
PRT	sp|Q93062-4|RBPMS_HUMAN	Isoform D of RNA-binding protein with multiple splicing OS=Homo sapiens OX=9606 GN=RBPMS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.11	29.0	2	1	0
PRT	sp|Q86W56-3|PARG_HUMAN	Isoform 3 of Poly(ADP-ribose) glycohydrolase OS=Homo sapiens OX=9606 GN=PARG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9P2Y4|ZN219_HUMAN	Zinc finger protein 219 OS=Homo sapiens OX=9606 GN=ZNF219 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P55957|BID_HUMAN	BH3-interacting domain death agonist OS=Homo sapiens OX=9606 GN=BID PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.07	29.0	3	1	0
PRT	sp|Q7Z2X4-3|PCLI1_HUMAN	Isoform 3 of PTB-containing, cubilin and LRP1-interacting protein OS=Homo sapiens OX=9606 GN=PID1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.12	29.0	1	1	1
PRT	sp|Q5VZL5-2|ZMYM4_HUMAN	Isoform 2 of Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	2	2	2
PRT	sp|Q5VZE5-2|NAA35_HUMAN	Isoform 2 of N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA35	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|O75575-4|RPC9_HUMAN	Isoform 4 of DNA-directed RNA polymerase III subunit RPC9 OS=Homo sapiens OX=9606 GN=CRCP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.23	29.0	1	1	1
PRT	sp|O95391|SLU7_HUMAN	Pre-mRNA-splicing factor SLU7 OS=Homo sapiens OX=9606 GN=SLU7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	2	2	2
PRT	sp|Q9Y2K1-2|ZBTB1_HUMAN	Isoform 2 of Zinc finger and BTB domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZBTB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P55081|MFAP1_HUMAN	Microfibrillar-associated protein 1 OS=Homo sapiens OX=9606 GN=MFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	2	1	0
PRT	sp|Q93073-2|SBP2L_HUMAN	Isoform 2 of Selenocysteine insertion sequence-binding protein 2-like OS=Homo sapiens OX=9606 GN=SECISBP2L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q14669|TRIPC_HUMAN	E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	2	2	2
PRT	sp|P79522-2|PRR3_HUMAN	Isoform 2 of Proline-rich protein 3 OS=Homo sapiens OX=9606 GN=PRR3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	122-UNIMOD:4	0.10	29.0	1	1	1
PRT	sp|P54252-5|ATX3_HUMAN	Isoform 5 of Ataxin-3 OS=Homo sapiens OX=9606 GN=ATXN3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	2	2	2
PRT	sp|Q9NR50-3|EI2BG_HUMAN	Isoform 3 of Translation initiation factor eIF-2B subunit gamma OS=Homo sapiens OX=9606 GN=EIF2B3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|P36776-3|LONM_HUMAN	Isoform 3 of Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	4	2	1
PRT	sp|O14967-2|CLGN_HUMAN	Isoform 2 of Calmegin OS=Homo sapiens OX=9606 GN=CLGN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	2	2	2
PRT	sp|P50851-2|LRBA_HUMAN	Isoform 2 of Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	3	1	0
PRT	sp|Q96N64-3|PWP2A_HUMAN	Isoform 3 of PWWP domain-containing protein 2A OS=Homo sapiens OX=9606 GN=PWWP2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q9H4A3-2|WNK1_HUMAN	Isoform 2 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.04	29.0	7	3	2
PRT	sp|Q8N5C7-2|DTWD1_HUMAN	Isoform 2 of DTW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DTWD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	100-UNIMOD:4	0.07	29.0	4	2	0
PRT	sp|O60437|PEPL_HUMAN	Periplakin OS=Homo sapiens OX=9606 GN=PPL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	2	2	2
PRT	sp|Q9P209|CEP72_HUMAN	Centrosomal protein of 72 kDa OS=Homo sapiens OX=9606 GN=CEP72 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	2	1	0
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1	0.05	29.0	3	2	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.02	29.0	33	1	0
PRT	sp|O95819-4|M4K4_HUMAN	Isoform 4 of Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	3	1	0
PRT	sp|P36871-3|PGM1_HUMAN	Isoform 3 of Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	2	1	0
PRT	sp|Q9NTK5-2|OLA1_HUMAN	Isoform 2 of Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	2	1	0
PRT	sp|Q96P70|IPO9_HUMAN	Importin-9 OS=Homo sapiens OX=9606 GN=IPO9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9NRF8|PYRG2_HUMAN	CTP synthase 2 OS=Homo sapiens OX=9606 GN=CTPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P78527|PRKDC_HUMAN	DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	2979-UNIMOD:28	0.01	29.0	4	2	0
PRT	sp|Q9GZR1|SENP6_HUMAN	Sentrin-specific protease 6 OS=Homo sapiens OX=9606 GN=SENP6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	0
PRT	sp|P49747|COMP_HUMAN	Cartilage oligomeric matrix protein OS=Homo sapiens OX=9606 GN=COMP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	448-UNIMOD:4,468-UNIMOD:4	0.06	29.0	2	2	2
PRT	sp|O00541|PESC_HUMAN	Pescadillo homolog OS=Homo sapiens OX=9606 GN=PES1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	522-UNIMOD:28	0.02	29.0	1	1	1
PRT	sp|Q6NW29|RWDD4_HUMAN	RWD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RWDD4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1,9-UNIMOD:35	0.08	29.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null		0.03	29.0	3	1	0
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	100-UNIMOD:4	0.26	29.0	1	1	1
PRT	sp|Q96ME7|ZN512_HUMAN	Zinc finger protein 512 OS=Homo sapiens OX=9606 GN=ZNF512 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	107-UNIMOD:28	0.02	29.0	1	1	1
PRT	sp|Q09472|EP300_HUMAN	Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	982-UNIMOD:35	0.01	29.0	2	1	0
PRT	sp|Q15543|TAF13_HUMAN	Transcription initiation factor TFIID subunit 13 OS=Homo sapiens OX=9606 GN=TAF13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1	0.22	29.0	1	1	1
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	2	1	0
PRT	sp|Q5M775-4|CYTSB_HUMAN	Isoform 4 of Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	2	1	0
PRT	sp|P51531-2|SMCA2_HUMAN	Isoform Short of Probable global transcription activator SNF2L2 OS=Homo sapiens OX=9606 GN=SMARCA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q6P1R4|DUS1L_HUMAN	tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q96GA3|LTV1_HUMAN	Protein LTV1 homolog OS=Homo sapiens OX=9606 GN=LTV1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q8IYI6|EXOC8_HUMAN	Exocyst complex component 8 OS=Homo sapiens OX=9606 GN=EXOC8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	2	1	0
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	949-UNIMOD:4	0.02	28.0	2	2	2
PRT	sp|Q8NHX9|TPC2_HUMAN	Two pore calcium channel protein 2 OS=Homo sapiens OX=9606 GN=TPCN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|O43314-2|VIP2_HUMAN	Isoform 2 of Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Homo sapiens OX=9606 GN=PPIP5K2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	2	1	0
PRT	sp|O94927-2|HAUS5_HUMAN	Isoform 2 of HAUS augmin-like complex subunit 5 OS=Homo sapiens OX=9606 GN=HAUS5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q8ND24|RN214_HUMAN	RING finger protein 214 OS=Homo sapiens OX=9606 GN=RNF214 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9ULV3-5|CIZ1_HUMAN	Isoform 5 of Cip1-interacting zinc finger protein OS=Homo sapiens OX=9606 GN=CIZ1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	3	2	1
PRT	sp|Q05682-6|CALD1_HUMAN	Isoform 6 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	393-UNIMOD:35	0.10	28.0	8	6	3
PRT	sp|Q9ULW0|TPX2_HUMAN	Targeting protein for Xklp2 OS=Homo sapiens OX=9606 GN=TPX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	6	2	0
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	688-UNIMOD:35	0.03	28.0	7	4	1
PRT	sp|P40818|UBP8_HUMAN	Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	2	2	2
PRT	sp|P42680|TEC_HUMAN	Tyrosine-protein kinase Tec OS=Homo sapiens OX=9606 GN=TEC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	406-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|Q8NBT2|SPC24_HUMAN	Kinetochore protein Spc24 OS=Homo sapiens OX=9606 GN=SPC24 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.06	28.0	2	1	0
PRT	sp|Q8N5N7-2|RM50_HUMAN	Isoform 2 of 39S ribosomal protein L50, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.10	28.0	5	2	1
PRT	sp|Q8TEQ6|GEMI5_HUMAN	Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	766-UNIMOD:35	0.02	28.0	9	2	0
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.00	28.0	2	2	2
PRT	sp|Q9H0G5|NSRP1_HUMAN	Nuclear speckle splicing regulatory protein 1 OS=Homo sapiens OX=9606 GN=NSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	2	1	0
PRT	sp|Q9NXH9-2|TRM1_HUMAN	Isoform 2 of tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens OX=9606 GN=TRMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	2	2	2
PRT	sp|P53804-3|TTC3_HUMAN	Isoform TPRDIII of E3 ubiquitin-protein ligase TTC3 OS=Homo sapiens OX=9606 GN=TTC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q15758-3|AAAT_HUMAN	Isoform 3 of Neutral amino acid transporter B(0) OS=Homo sapiens OX=9606 GN=SLC1A5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	2	1	0
PRT	sp|Q9NX55-3|HYPK_HUMAN	Isoform 3 of Huntingtin-interacting protein K OS=Homo sapiens OX=9606 GN=HYPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.14	28.0	3	2	1
PRT	sp|Q9HB71|CYBP_HUMAN	Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	2	1	0
PRT	sp|Q8WUM4-2|PDC6I_HUMAN	Isoform 2 of Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	6	2	0
PRT	sp|P46531|NOTC1_HUMAN	Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|O94880|PHF14_HUMAN	PHD finger protein 14 OS=Homo sapiens OX=9606 GN=PHF14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|O43159|RRP8_HUMAN	Ribosomal RNA-processing protein 8 OS=Homo sapiens OX=9606 GN=RRP8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P49746-2|TSP3_HUMAN	Isoform 2 of Thrombospondin-3 OS=Homo sapiens OX=9606 GN=THBS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	363-UNIMOD:4,383-UNIMOD:4	0.04	28.0	2	1	0
PRT	sp|Q9H1K0|RBNS5_HUMAN	Rabenosyn-5 OS=Homo sapiens OX=9606 GN=RBSN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	491-UNIMOD:28	0.02	28.0	2	1	0
PRT	sp|O94923|GLCE_HUMAN	D-glucuronyl C5-epimerase OS=Homo sapiens OX=9606 GN=GLCE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	71-UNIMOD:28	0.02	28.0	2	1	0
PRT	sp|Q5SXM2|SNPC4_HUMAN	snRNA-activating protein complex subunit 4 OS=Homo sapiens OX=9606 GN=SNAPC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	2	1	0
PRT	sp|Q92620|PRP16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.04	28.0	3	3	3
PRT	sp|Q9Y6X9-2|MORC2_HUMAN	Isoform 2 of ATPase MORC2 OS=Homo sapiens OX=9606 GN=MORC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	2	1	0
PRT	sp|Q676U5-3|A16L1_HUMAN	Isoform 3 of Autophagy-related protein 16-1 OS=Homo sapiens OX=9606 GN=ATG16L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|O15397-2|IPO8_HUMAN	Isoform 2 of Importin-8 OS=Homo sapiens OX=9606 GN=IPO8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	2	1	0
PRT	sp|P63092-3|GNAS2_HUMAN	Isoform 3 of Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Homo sapiens OX=9606 GN=GNAS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	2	1	0
PRT	sp|Q93008|USP9X_HUMAN	Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	1908-UNIMOD:4	0.01	28.0	2	2	0
PRT	sp|Q92834|RPGR_HUMAN	X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens OX=9606 GN=RPGR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q13541|4EBP1_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,7-UNIMOD:4,116-UNIMOD:35	0.23	28.0	2	2	2
PRT	sp|Q9UBE0|SAE1_HUMAN	SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.05	28.0	4	1	0
PRT	sp|Q5RI15|COX20_HUMAN	Cytochrome c oxidase assembly protein COX20, mitochondrial OS=Homo sapiens OX=9606 GN=COX20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1	0.12	28.0	2	2	2
PRT	sp|Q68DK2|ZFY26_HUMAN	Zinc finger FYVE domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ZFYVE26 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	1	1	0
PRT	sp|P36871|PGM1_HUMAN	Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	3	1	0
PRT	sp|Q9UJX6|ANC2_HUMAN	Anaphase-promoting complex subunit 2 OS=Homo sapiens OX=9606 GN=ANAPC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	0
PRT	sp|P02765|FETUA_HUMAN	Alpha-2-HS-glycoprotein OS=Homo sapiens OX=9606 GN=AHSG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	28.0	null	132-UNIMOD:385,132-UNIMOD:4	0.04	28.0	2	1	0
PRT	sp|P29375|KDM5A_HUMAN	Lysine-specific demethylase 5A OS=Homo sapiens OX=9606 GN=KDM5A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	1	1	0
PRT	sp|Q86SQ7|SDCG8_HUMAN	Serologically defined colon cancer antigen 8 OS=Homo sapiens OX=9606 GN=SDCCAG8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	649-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|Q9Y530|OARD1_HUMAN	ADP-ribose glycohydrolase OARD1 OS=Homo sapiens OX=9606 GN=OARD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1	0.09	28.0	1	1	1
PRT	sp|P56211|ARP19_HUMAN	cAMP-regulated phosphoprotein 19 OS=Homo sapiens OX=9606 GN=ARPP19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1	0.13	28.0	2	1	0
PRT	sp|Q8N4C6|NIN_HUMAN	Ninein OS=Homo sapiens OX=9606 GN=NIN PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	1-UNIMOD:1	0.01	28.0	1	1	1
PRT	sp|P49796|RGS3_HUMAN	Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9P2I0|CPSF2_HUMAN	Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens OX=9606 GN=CPSF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|Q9NVV4|PAPD1_HUMAN	Poly(A) RNA polymerase, mitochondrial OS=Homo sapiens OX=9606 GN=MTPAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9Y6N7-6|ROBO1_HUMAN	Isoform 6 of Roundabout homolog 1 OS=Homo sapiens OX=9606 GN=ROBO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	2	1	0
PRT	sp|Q9H501|ESF1_HUMAN	ESF1 homolog OS=Homo sapiens OX=9606 GN=ESF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	3	1	0
PRT	sp|Q9UGP5-2|DPOLL_HUMAN	Isoform 2 of DNA polymerase lambda OS=Homo sapiens OX=9606 GN=POLL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	2	1	0
PRT	sp|Q86X53|ERIC1_HUMAN	Glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ERICH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	3	2	1
PRT	sp|Q9BQS8|FYCO1_HUMAN	FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FYCO1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	719-UNIMOD:4	0.01	27.0	1	1	1
PRT	sp|O60341|KDM1A_HUMAN	Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	493-UNIMOD:27	0.03	27.0	3	2	1
PRT	sp|Q86V48-2|LUZP1_HUMAN	Isoform 2 of Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	3	2	1
PRT	sp|Q8N8S7-3|ENAH_HUMAN	Isoform 3 of Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P62699|YPEL5_HUMAN	Protein yippee-like 5 OS=Homo sapiens OX=9606 GN=YPEL5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	1	1	1
PRT	sp|Q01433-3|AMPD2_HUMAN	Isoform Ex1A-3 of AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	2	1	0
PRT	sp|Q9UNH5|CC14A_HUMAN	Dual specificity protein phosphatase CDC14A OS=Homo sapiens OX=9606 GN=CDC14A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q86UW6-2|N4BP2_HUMAN	Isoform 2 of NEDD4-binding protein 2 OS=Homo sapiens OX=9606 GN=N4BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q9UL51|HCN2_HUMAN	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Homo sapiens OX=9606 GN=HCN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9UNS1-2|TIM_HUMAN	Isoform 2 of Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	0
PRT	sp|Q8WUA2|PPIL4_HUMAN	Peptidyl-prolyl cis-trans isomerase-like 4 OS=Homo sapiens OX=9606 GN=PPIL4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|O00472-2|ELL2_HUMAN	Isoform 2 of RNA polymerase II elongation factor ELL2 OS=Homo sapiens OX=9606 GN=ELL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	2	2	2
PRT	sp|Q92896|GSLG1_HUMAN	Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	118-UNIMOD:4	0.01	27.0	1	1	1
PRT	sp|Q9UMR2-3|DD19B_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX19B OS=Homo sapiens OX=9606 GN=DDX19B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	9	2	1
PRT	sp|Q7Z3J2-2|VP35L_HUMAN	Isoform 2 of VPS35 endosomal protein sorting factor-like OS=Homo sapiens OX=9606 GN=VPS35L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	304-UNIMOD:4	0.03	27.0	3	2	1
PRT	sp|Q5JTD0-3|TJAP1_HUMAN	Isoform 3 of Tight junction-associated protein 1 OS=Homo sapiens OX=9606 GN=TJAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.30	27.0	1	1	1
PRT	sp|Q6KC79-3|NIPBL_HUMAN	Isoform 3 of Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	2	2	2
PRT	sp|P57740-3|NU107_HUMAN	Isoform 3 of Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	182-UNIMOD:35	0.02	27.0	2	1	0
PRT	sp|Q8N442|GUF1_HUMAN	Translation factor GUF1, mitochondrial OS=Homo sapiens OX=9606 GN=GUF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	2	1	0
PRT	sp|P32856-3|STX2_HUMAN	Isoform 2 of Syntaxin-2 OS=Homo sapiens OX=9606 GN=STX2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	0
PRT	sp|Q7L0Y3|TM10C_HUMAN	tRNA methyltransferase 10 homolog C OS=Homo sapiens OX=9606 GN=TRMT10C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	3	3	3
PRT	sp|P09525-2|ANXA4_HUMAN	Isoform 2 of Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	2	1	0
PRT	sp|Q2NL82|TSR1_HUMAN	Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens OX=9606 GN=TSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q7Z7A4-3|PXK_HUMAN	Isoform 3 of PX domain-containing protein kinase-like protein OS=Homo sapiens OX=9606 GN=PXK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	2	1	0
PRT	sp|O15169-2|AXIN1_HUMAN	Isoform 2 of Axin-1 OS=Homo sapiens OX=9606 GN=AXIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q96IZ5-3|RBM41_HUMAN	Isoform 3 of RNA-binding protein 41 OS=Homo sapiens OX=9606 GN=RBM41	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	2	1	0
PRT	sp|Q13472-3|TOP3A_HUMAN	Isoform 3 of DNA topoisomerase 3-alpha OS=Homo sapiens OX=9606 GN=TOP3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	95-UNIMOD:4	0.01	27.0	1	1	1
PRT	sp|Q9H583|HEAT1_HUMAN	HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	3	1	0
PRT	sp|Q13505-3|MTX1_HUMAN	Isoform 3 of Metaxin-1 OS=Homo sapiens OX=9606 GN=MTX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	2	1	0
PRT	sp|Q8N8A2-4|ANR44_HUMAN	Isoform 4 of Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q92575|UBXN4_HUMAN	UBX domain-containing protein 4 OS=Homo sapiens OX=9606 GN=UBXN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q13576-3|IQGA2_HUMAN	Isoform 3 of Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens OX=9606 GN=IQGAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	2	2	1
PRT	sp|P32019-3|I5P2_HUMAN	Isoform 3 of Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Homo sapiens OX=9606 GN=INPP5B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q8WYA6-4|CTBL1_HUMAN	Isoform 4 of Beta-catenin-like protein 1 OS=Homo sapiens OX=9606 GN=CTNNBL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	1823-UNIMOD:28,2576-UNIMOD:28,2719-UNIMOD:28,2109-UNIMOD:28,1564-UNIMOD:28,1825-UNIMOD:27,2100-UNIMOD:27,1955-UNIMOD:28	0.02	27.0	14	9	2
PRT	sp|Q14789|GOGB1_HUMAN	Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	1663-UNIMOD:28,1964-UNIMOD:385,1964-UNIMOD:4	0.02	27.0	7	4	1
PRT	sp|Q13409|DC1I2_HUMAN	Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	170-UNIMOD:27,256-UNIMOD:27	0.08	27.0	3	3	0
PRT	sp|Q9NZ53|PDXL2_HUMAN	Podocalyxin-like protein 2 OS=Homo sapiens OX=9606 GN=PODXL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	181-UNIMOD:28	0.06	27.0	4	2	1
PRT	sp|Q15276|RABE1_HUMAN	Rab GTPase-binding effector protein 1 OS=Homo sapiens OX=9606 GN=RABEP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	0
PRT	sp|Q14152|EIF3A_HUMAN	Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	592-UNIMOD:27	0.03	27.0	4	3	1
PRT	sp|O00429|DNM1L_HUMAN	Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	644-UNIMOD:4	0.04	27.0	3	2	0
PRT	sp|Q9UIG0|BAZ1B_HUMAN	Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q96T23|RSF1_HUMAN	Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	2	2	2
PRT	sp|P20810|ICAL_HUMAN	Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	328-UNIMOD:4,328-UNIMOD:385	0.02	27.0	3	1	0
PRT	sp|Q8N5N7|RM50_HUMAN	39S ribosomal protein L50, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL50 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	33-UNIMOD:27	0.09	27.0	2	1	0
PRT	sp|P14324-2|FPPS_HUMAN	Isoform 2 of Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	27.0	6	2	1
PRT	sp|Q9P253|VPS18_HUMAN	Vacuolar protein sorting-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=VPS18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	740-UNIMOD:28,741-UNIMOD:4	0.02	27.0	3	1	0
PRT	sp|O95819|M4K4_HUMAN	Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	56-UNIMOD:35	0.01	27.0	1	1	0
PRT	sp|Q99547|MPH6_HUMAN	M-phase phosphoprotein 6 OS=Homo sapiens OX=9606 GN=MPHOSPH6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.11	27.0	1	1	1
PRT	sp|Q9NPG3|UBN1_HUMAN	Ubinuclein-1 OS=Homo sapiens OX=9606 GN=UBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	38-UNIMOD:4	0.02	27.0	1	1	0
PRT	sp|Q96T21|SEBP2_HUMAN	Selenocysteine insertion sequence-binding protein 2 OS=Homo sapiens OX=9606 GN=SECISBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1	0.02	27.0	1	1	1
PRT	sp|Q06787|FMR1_HUMAN	Synaptic functional regulator FMR1 OS=Homo sapiens OX=9606 GN=FMR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	3	1	0
PRT	sp|Q9BRL6|SRSF8_HUMAN	Serine/arginine-rich splicing factor 8 OS=Homo sapiens OX=9606 GN=SRSF8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	75-UNIMOD:35	0.06	27.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.11	27.0	1	1	0
PRT	sp|P07942|LAMB1_HUMAN	Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	2	2	2
PRT	sp|Q7L5Y9|MAEA_HUMAN	E3 ubiquitin-protein transferase MAEA OS=Homo sapiens OX=9606 GN=MAEA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q6NYC1-2|JMJD6_HUMAN	Isoform 2 of Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Homo sapiens OX=9606 GN=JMJD6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	101-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q16773-2|KAT1_HUMAN	Isoform 2 of Kynurenine--oxoglutarate transaminase 1 OS=Homo sapiens OX=9606 GN=KYAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q06787-11|FMR1_HUMAN	Isoform 11 of Synaptic functional regulator FMR1 OS=Homo sapiens OX=9606 GN=FMR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	4	1	0
PRT	sp|Q96RY5|CRML_HUMAN	Protein cramped-like OS=Homo sapiens OX=9606 GN=CRAMP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	2	1	0
PRT	sp|Q6T4R5-2|NHS_HUMAN	Isoform 2 of Nance-Horan syndrome protein OS=Homo sapiens OX=9606 GN=NHS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	2	1	0
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	3	2	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	38	2	1
PRT	sp|Q96EY1|DNJA3_HUMAN	DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens OX=9606 GN=DNAJA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	462-UNIMOD:27	0.03	26.0	2	1	0
PRT	sp|Q9NPG3-2|UBN1_HUMAN	Isoform 2 of Ubinuclein-1 OS=Homo sapiens OX=9606 GN=UBN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	38-UNIMOD:4	0.02	26.0	1	1	0
PRT	sp|Q9C0A6-2|SETD5_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase SETD5 OS=Homo sapiens OX=9606 GN=SETD5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	2	1	0
PRT	sp|P11717|MPRI_HUMAN	Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.00	26.0	1	1	1
PRT	sp|Q8IVB5|LIX1L_HUMAN	LIX1-like protein OS=Homo sapiens OX=9606 GN=LIX1L PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	2	1	0
PRT	sp|O15182|CETN3_HUMAN	Centrin-3 OS=Homo sapiens OX=9606 GN=CETN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	134-UNIMOD:35	0.08	26.0	2	1	0
PRT	sp|Q9UNX4|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=WDR3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	2	1	0
PRT	sp|P51948-2|MAT1_HUMAN	Isoform 2 of CDK-activating kinase assembly factor MAT1 OS=Homo sapiens OX=9606 GN=MNAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	2	2	2
PRT	sp|Q14444-2|CAPR1_HUMAN	Isoform 2 of Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	2	1	0
PRT	sp|Q96DF8|ESS2_HUMAN	Splicing factor ESS-2 homolog OS=Homo sapiens OX=9606 GN=ESS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	2	1	0
PRT	sp|Q5HYK3|COQ5_HUMAN	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	2	2	2
PRT	sp|O95149|SPN1_HUMAN	Snurportin-1 OS=Homo sapiens OX=9606 GN=SNUPN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	3	2	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	439-UNIMOD:27,451-UNIMOD:27	0.04	26.0	6	3	1
PRT	sp|Q15154-4|PCM1_HUMAN	Isoform 4 of Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	2	2	2
PRT	sp|Q9UNF0-2|PACN2_HUMAN	Isoform 2 of Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	424-UNIMOD:4,415-UNIMOD:35	0.03	26.0	2	1	0
PRT	sp|Q13310-2|PABP4_HUMAN	Isoform 2 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	7	4	2
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	112-UNIMOD:4	0.04	26.0	5	2	0
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	720-UNIMOD:35	0.04	26.0	3	2	1
PRT	sp|Q14667-3|K0100_HUMAN	Isoform 3 of Protein KIAA0100 OS=Homo sapiens OX=9606 GN=KIAA0100	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q15061|WDR43_HUMAN	WD repeat-containing protein 43 OS=Homo sapiens OX=9606 GN=WDR43 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P26006|ITA3_HUMAN	Integrin alpha-3 OS=Homo sapiens OX=9606 GN=ITGA3 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q6IA86-4|ELP2_HUMAN	Isoform 4 of Elongator complex protein 2 OS=Homo sapiens OX=9606 GN=ELP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q5T1V6-2|DDX59_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX59 OS=Homo sapiens OX=9606 GN=DDX59	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	127-UNIMOD:4,131-UNIMOD:4	0.02	26.0	1	1	0
PRT	sp|Q03468|ERCC6_HUMAN	DNA excision repair protein ERCC-6 OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9HAW4-2|CLSPN_HUMAN	Isoform 2 of Claspin OS=Homo sapiens OX=9606 GN=CLSPN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	85-UNIMOD:4,92-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q13185|CBX3_HUMAN	Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	3	1	0
PRT	sp|P05067-7|A4_HUMAN	Isoform L-APP733 of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	291-UNIMOD:4,300-UNIMOD:4	0.04	26.0	3	2	1
PRT	sp|Q9UI12-2|VATH_HUMAN	Isoform 2 of V-type proton ATPase subunit H OS=Homo sapiens OX=9606 GN=ATP6V1H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|O75947|ATP5H_HUMAN	ATP synthase subunit d, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	4	1	0
PRT	sp|P09493|TPM1_HUMAN	Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	190-UNIMOD:4	0.07	26.0	2	2	1
PRT	sp|Q32MZ4|LRRF1_HUMAN	Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	644-UNIMOD:4,243-UNIMOD:28	0.03	26.0	2	2	0
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	205-UNIMOD:35	0.04	26.0	4	3	2
PRT	sp|Q01105-2|SET_HUMAN	Isoform 2 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	12-UNIMOD:27	0.06	26.0	1	1	1
PRT	sp|O94822|LTN1_HUMAN	E3 ubiquitin-protein ligase listerin OS=Homo sapiens OX=9606 GN=LTN1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	0
PRT	sp|Q9NUU7|DD19A_HUMAN	ATP-dependent RNA helicase DDX19A OS=Homo sapiens OX=9606 GN=DDX19A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	0
PRT	sp|O43309|ZSC12_HUMAN	Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	197-UNIMOD:28	0.02	26.0	1	1	1
PRT	sp|P05067|A4_HUMAN	Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	0
PRT	sp|P36776|LONM_HUMAN	Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	219-UNIMOD:28	0.02	26.0	2	1	0
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	29-UNIMOD:4	0.06	26.0	3	1	0
PRT	sp|Q8TCN5|ZN507_HUMAN	Zinc finger protein 507 OS=Homo sapiens OX=9606 GN=ZNF507 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	0
PRT	sp|Q9Y3B7|RM11_HUMAN	39S ribosomal protein L11, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	180-UNIMOD:27	0.07	26.0	2	1	0
PRT	sp|Q15029|U5S1_HUMAN	116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	36-UNIMOD:35,55-UNIMOD:35	0.03	26.0	3	1	0
PRT	sp|Q7Z4V5|HDGR2_HUMAN	Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	2	1	0
PRT	sp|O15460|P4HA2_HUMAN	Prolyl 4-hydroxylase subunit alpha-2 OS=Homo sapiens OX=9606 GN=P4HA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	195-UNIMOD:28	0.02	26.0	1	1	1
PRT	sp|O00592|PODXL_HUMAN	Podocalyxin OS=Homo sapiens OX=9606 GN=PODXL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	344-UNIMOD:385,344-UNIMOD:4	0.02	26.0	3	1	0
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P42330|AK1C3_HUMAN	Aldo-keto reductase family 1 member C3 OS=Homo sapiens OX=9606 GN=AKR1C3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	1	1	0
PRT	sp|Q8IWZ3-5|ANKH1_HUMAN	Isoform 5 of Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	4	2	1
PRT	sp|Q9NNW7-4|TRXR2_HUMAN	Isoform 4 of Thioredoxin reductase 2, mitochondrial OS=Homo sapiens OX=9606 GN=TXNRD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P13994|CC130_HUMAN	Coiled-coil domain-containing protein 130 OS=Homo sapiens OX=9606 GN=CCDC130 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q8NBL1|PGLT1_HUMAN	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	2	1	0
PRT	sp|Q8NAP3|ZBT38_HUMAN	Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P51659-3|DHB4_HUMAN	Isoform 3 of Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens OX=9606 GN=HSD17B4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|Q13616|CUL1_HUMAN	Cullin-1 OS=Homo sapiens OX=9606 GN=CUL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	355-UNIMOD:4,111-UNIMOD:35	0.05	25.0	3	3	3
PRT	sp|Q13243-2|SRSF5_HUMAN	Isoform SRP40-2 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.12	25.0	4	1	0
PRT	sp|A6NHR9-2|SMHD1_HUMAN	Isoform 2 of Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SMCHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	458-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|O43852-15|CALU_HUMAN	Isoform 15 of Calumenin OS=Homo sapiens OX=9606 GN=CALU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	46-UNIMOD:35	0.09	25.0	2	1	0
PRT	sp|Q6UN15|FIP1_HUMAN	Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q9BZL4-2|PP12C_HUMAN	Isoform 2 of Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens OX=9606 GN=PPP1R12C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	2	1	0
PRT	sp|Q9NZI8-2|IF2B1_HUMAN	Isoform 2 of Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|O00425-2|IF2B3_HUMAN	Isoform 2 of Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens OX=9606 GN=IGF2BP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	2	1	0
PRT	sp|Q2KHM9|MOONR_HUMAN	Protein moonraker OS=Homo sapiens OX=9606 GN=KIAA0753 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q2TAY7-2|SMU1_HUMAN	Isoform 2 of WD40 repeat-containing protein SMU1 OS=Homo sapiens OX=9606 GN=SMU1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	117-UNIMOD:35	0.04	25.0	1	1	1
PRT	sp|Q9H467|CUED2_HUMAN	CUE domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CUEDC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	2	1	0
PRT	sp|O75934|SPF27_HUMAN	Pre-mRNA-splicing factor SPF27 OS=Homo sapiens OX=9606 GN=BCAS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	30-UNIMOD:27	0.06	25.0	3	1	0
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	815-UNIMOD:35	0.02	25.0	3	2	1
PRT	sp|Q9BQ61|TRIR_HUMAN	Telomerase RNA component interacting RNase OS=Homo sapiens OX=9606 GN=TRIR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	136-UNIMOD:28	0.15	25.0	3	3	3
PRT	sp|Q12846-2|STX4_HUMAN	Isoform 2 of Syntaxin-4 OS=Homo sapiens OX=9606 GN=STX4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q5TAX3-2|TUT4_HUMAN	Isoform 2 of Terminal uridylyltransferase 4 OS=Homo sapiens OX=9606 GN=TUT4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|Q7RTP6|MICA3_HUMAN	[F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	3	2	1
PRT	sp|P52739-2|ZN131_HUMAN	Isoform 2 of Zinc finger protein 131 OS=Homo sapiens OX=9606 GN=ZNF131	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9NQS7-2|INCE_HUMAN	Isoform 2 of Inner centromere protein OS=Homo sapiens OX=9606 GN=INCENP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	2	1	0
PRT	sp|Q16891-2|MIC60_HUMAN	Isoform 2 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	3	2	1
PRT	sp|Q96L73-2|NSD1_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	0
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	3	1	0
PRT	sp|O60613-2|SEP15_HUMAN	Isoform 2 of Selenoprotein F OS=Homo sapiens OX=9606 GN=SELENOF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	73-UNIMOD:4,74-UNIMOD:4	0.10	25.0	1	1	1
PRT	sp|P32004-3|L1CAM_HUMAN	Isoform 3 of Neural cell adhesion molecule L1 OS=Homo sapiens OX=9606 GN=L1CAM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	3	2	1
PRT	sp|Q16720-8|AT2B3_HUMAN	Isoform ZG of Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens OX=9606 GN=ATP2B3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	2	1	0
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	2	2	2
PRT	sp|Q9H7L9|SDS3_HUMAN	Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	2	1	0
PRT	sp|P51946|CCNH_HUMAN	Cyclin-H OS=Homo sapiens OX=9606 GN=CCNH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	2	2	2
PRT	sp|Q92545|TM131_HUMAN	Transmembrane protein 131 OS=Homo sapiens OX=9606 GN=TMEM131 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q00765|REEP5_HUMAN	Receptor expression-enhancing protein 5 OS=Homo sapiens OX=9606 GN=REEP5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	152-UNIMOD:35	0.06	25.0	1	1	1
PRT	sp|Q8NEY1-6|NAV1_HUMAN	Isoform 6 of Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9BZJ0-2|CRNL1_HUMAN	Isoform 2 of Crooked neck-like protein 1 OS=Homo sapiens OX=9606 GN=CRNKL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9H900|ZWILC_HUMAN	Protein zwilch homolog OS=Homo sapiens OX=9606 GN=ZWILCH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	2	2	2
PRT	sp|P32456|GBP2_HUMAN	Guanylate-binding protein 2 OS=Homo sapiens OX=9606 GN=GBP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|P41970|ELK3_HUMAN	ETS domain-containing protein Elk-3 OS=Homo sapiens OX=9606 GN=ELK3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P35555|FBN1_HUMAN	Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	570-UNIMOD:4,576-UNIMOD:4	0.00	25.0	1	1	1
PRT	sp|Q04446|GLGB_HUMAN	1,4-alpha-glucan-branching enzyme OS=Homo sapiens OX=9606 GN=GBE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|A6NED2|RCCD1_HUMAN	RCC1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RCCD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q12830-4|BPTF_HUMAN	Isoform 4 of Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens OX=9606 GN=BPTF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	2	2	2
PRT	sp|Q9UJU6-5|DBNL_HUMAN	Isoform 5 of Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	24-UNIMOD:4,26-UNIMOD:35	0.08	25.0	6	2	0
PRT	sp|Q8NDI1-3|EHBP1_HUMAN	Isoform 3 of EH domain-binding protein 1 OS=Homo sapiens OX=9606 GN=EHBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	0
PRT	sp|Q8N3C0-3|ASCC3_HUMAN	Isoform 2 of Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens OX=9606 GN=ASCC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.12	25.0	3	1	0
PRT	sp|Q15911|ZFHX3_HUMAN	Zinc finger homeobox protein 3 OS=Homo sapiens OX=9606 GN=ZFHX3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	451-UNIMOD:4	0.00	25.0	1	1	1
PRT	sp|Q96A65|EXOC4_HUMAN	Exocyst complex component 4 OS=Homo sapiens OX=9606 GN=EXOC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	2	1	0
PRT	sp|P55010|IF5_HUMAN	Eukaryotic translation initiation factor 5 OS=Homo sapiens OX=9606 GN=EIF5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	2	2	2
PRT	sp|P50416-2|CPT1A_HUMAN	Isoform 2 of Carnitine O-palmitoyltransferase 1, liver isoform OS=Homo sapiens OX=9606 GN=CPT1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9H2V7-5|SPNS1_HUMAN	Isoform 5 of Protein spinster homolog 1 OS=Homo sapiens OX=9606 GN=SPNS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	2	1	0
PRT	sp|Q9H0B6|KLC2_HUMAN	Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	4	1	0
PRT	sp|Q14542-3|S29A2_HUMAN	Isoform 3 of Equilibrative nucleoside transporter 2 OS=Homo sapiens OX=9606 GN=SLC29A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q5T7N3|KANK4_HUMAN	KN motif and ankyrin repeat domain-containing protein 4 OS=Homo sapiens OX=9606 GN=KANK4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q6GMV2|SMYD5_HUMAN	SET and MYND domain-containing protein 5 OS=Homo sapiens OX=9606 GN=SMYD5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q8TCN5-2|ZN507_HUMAN	Isoform 2 of Zinc finger protein 507 OS=Homo sapiens OX=9606 GN=ZNF507	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	0
PRT	sp|Q96N46|TTC14_HUMAN	Tetratricopeptide repeat protein 14 OS=Homo sapiens OX=9606 GN=TTC14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9Y320-2|TMX2_HUMAN	Isoform 2 of Thioredoxin-related transmembrane protein 2 OS=Homo sapiens OX=9606 GN=TMX2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	3	2	1
PRT	sp|Q9NWY4|HPF1_HUMAN	Histone PARylation factor 1 OS=Homo sapiens OX=9606 GN=HPF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q7L590-2|MCM10_HUMAN	Isoform 2 of Protein MCM10 homolog OS=Homo sapiens OX=9606 GN=MCM10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P23634-7|AT2B4_HUMAN	Isoform ZB of Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens OX=9606 GN=ATP2B4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1072-UNIMOD:35	0.03	25.0	2	2	2
PRT	sp|O75648-5|MTU1_HUMAN	Isoform 5 of Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Homo sapiens OX=9606 GN=TRMU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	2	1	0
PRT	sp|P86791|CCZ1_HUMAN	Vacuolar fusion protein CCZ1 homolog OS=Homo sapiens OX=9606 GN=CCZ1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9Y5P4-2|CERT_HUMAN	Isoform 2 of Ceramide transfer protein OS=Homo sapiens OX=9606 GN=CERT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|Q02952|AKA12_HUMAN	A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	25.0	null	234-UNIMOD:28	0.02	25.0	2	2	1
PRT	sp|Q8N157|AHI1_HUMAN	Jouberin OS=Homo sapiens OX=9606 GN=AHI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	0
PRT	sp|P35659|DEK_HUMAN	Protein DEK OS=Homo sapiens OX=9606 GN=DEK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.07	25.0	2	2	1
PRT	sp|Q8N573|OXR1_HUMAN	Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	0
PRT	sp|Q96PY6|NEK1_HUMAN	Serine/threonine-protein kinase Nek1 OS=Homo sapiens OX=9606 GN=NEK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	1074-UNIMOD:28	0.01	25.0	1	1	0
PRT	sp|P30566|PUR8_HUMAN	Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	416-UNIMOD:28	0.02	25.0	2	1	0
PRT	sp|Q02880|TOP2B_HUMAN	DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	2	2	1
PRT	sp|Q13576|IQGA2_HUMAN	Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens OX=9606 GN=IQGAP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	2	2	1
PRT	sp|Q9H3R5|CENPH_HUMAN	Centromere protein H OS=Homo sapiens OX=9606 GN=CENPH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,7-UNIMOD:35	0.13	25.0	2	2	2
PRT	sp|Q92973|TNPO1_HUMAN	Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|P40424|PBX1_HUMAN	Pre-B-cell leukemia transcription factor 1 OS=Homo sapiens OX=9606 GN=PBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	106-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|P60981|DEST_HUMAN	Destrin OS=Homo sapiens OX=9606 GN=DSTN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	135-UNIMOD:4	0.08	25.0	1	1	1
PRT	sp|Q71F23|CENPU_HUMAN	Centromere protein U OS=Homo sapiens OX=9606 GN=CENPU PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	0
PRT	sp|Q9H4Z3|CAPAM_HUMAN	mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase OS=Homo sapiens OX=9606 GN=PCIF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P51788|CLCN2_HUMAN	Chloride channel protein 2 OS=Homo sapiens OX=9606 GN=CLCN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1	0.01	25.0	1	1	1
PRT	sp|Q6NT46|GAG2A_HUMAN	G antigen 2A OS=Homo sapiens OX=9606 GN=GAGE2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	50-UNIMOD:28,85-UNIMOD:4,87-UNIMOD:4,96-UNIMOD:35	0.49	25.0	2	1	0
PRT	sp|Q9BV40|VAMP8_HUMAN	Vesicle-associated membrane protein 8 OS=Homo sapiens OX=9606 GN=VAMP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	1-UNIMOD:1	0.15	25.0	2	1	0
PRT	sp|Q5T1V6|DDX59_HUMAN	Probable ATP-dependent RNA helicase DDX59 OS=Homo sapiens OX=9606 GN=DDX59 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	127-UNIMOD:4,131-UNIMOD:4	0.02	25.0	1	1	0
PRT	sp|Q6NSZ9|ZSC25_HUMAN	Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens OX=9606 GN=ZSCAN25 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	144-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	116-UNIMOD:385,116-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q5TCZ1|SPD2A_HUMAN	SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	0
PRT	sp|Q6PII3|CC174_HUMAN	Coiled-coil domain-containing protein 174 OS=Homo sapiens OX=9606 GN=CCDC174 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	216-UNIMOD:28	0.03	25.0	1	1	1
PRT	sp|Q9NS91|RAD18_HUMAN	E3 ubiquitin-protein ligase RAD18 OS=Homo sapiens OX=9606 GN=RAD18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P36542-2|ATPG_HUMAN	Isoform Heart of ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q6UX71-2|PXDC2_HUMAN	Isoform 2 of Plexin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PLXDC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9UPQ0-9|LIMC1_HUMAN	Isoform 9 of LIM and calponin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMCH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	167-UNIMOD:4	0.01	24.0	2	1	0
PRT	sp|P35556|FBN2_HUMAN	Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	2298-UNIMOD:4,2305-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|P61586|RHOA_HUMAN	Transforming protein RhoA OS=Homo sapiens OX=9606 GN=RHOA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	3	1	0
PRT	sp|P08134|RHOC_HUMAN	Rho-related GTP-binding protein RhoC OS=Homo sapiens OX=9606 GN=RHOC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	2	1	0
PRT	sp|Q02218-2|ODO1_HUMAN	Isoform 2 of 2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=OGDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q96TA2-3|YMEL1_HUMAN	Isoform 3 of ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens OX=9606 GN=YME1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P35249-2|RFC4_HUMAN	Isoform 2 of Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	2	2	2
PRT	sp|O95232|LC7L3_HUMAN	Luc7-like protein 3 OS=Homo sapiens OX=9606 GN=LUC7L3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	58-UNIMOD:4	0.04	24.0	2	2	2
PRT	sp|Q8TDP1|RNH2C_HUMAN	Ribonuclease H2 subunit C OS=Homo sapiens OX=9606 GN=RNASEH2C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.12	24.0	1	1	1
PRT	sp|O15164-2|TIF1A_HUMAN	Isoform Short of Transcription intermediary factor 1-alpha OS=Homo sapiens OX=9606 GN=TRIM24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q13464|ROCK1_HUMAN	Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	1212-UNIMOD:35	0.02	24.0	3	2	1
PRT	sp|P68366-2|TBA4A_HUMAN	Isoform 2 of Tubulin alpha-4A chain OS=Homo sapiens OX=9606 GN=TUBA4A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	2	1	0
PRT	sp|Q15003-2|CND2_HUMAN	Isoform 2 of Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	3	1	0
PRT	sp|Q92613|JADE3_HUMAN	Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q96ER9-2|MITOK_HUMAN	Isoform 2 of Mitochondrial potassium channel OS=Homo sapiens OX=9606 GN=CCDC51	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q14241|ELOA1_HUMAN	Elongin-A OS=Homo sapiens OX=9606 GN=ELOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	3	1	0
PRT	sp|A4D1P6-3|WDR91_HUMAN	Isoform 3 of WD repeat-containing protein 91 OS=Homo sapiens OX=9606 GN=WDR91	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q7Z5J4-3|RAI1_HUMAN	Isoform 3 of Retinoic acid-induced protein 1 OS=Homo sapiens OX=9606 GN=RAI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	693-UNIMOD:4,697-UNIMOD:35	0.01	24.0	3	1	0
PRT	sp|Q92696|PGTA_HUMAN	Geranylgeranyl transferase type-2 subunit alpha OS=Homo sapiens OX=9606 GN=RABGGTA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	116-UNIMOD:35	0.07	24.0	2	1	0
PRT	sp|Q6FI81-3|CPIN1_HUMAN	Isoform 3 of Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|A6NJ78-3|MET15_HUMAN	Isoform 3 of Probable methyltransferase-like protein 15 OS=Homo sapiens OX=9606 GN=METTL15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.14	24.0	1	1	1
PRT	sp|Q5R372-7|RBG1L_HUMAN	Isoform 7 of Rab GTPase-activating protein 1-like OS=Homo sapiens OX=9606 GN=RABGAP1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.09	24.0	2	2	2
PRT	sp|P24386|RAE1_HUMAN	Rab proteins geranylgeranyltransferase component A 1 OS=Homo sapiens OX=9606 GN=CHM PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9H1Y0-2|ATG5_HUMAN	Isoform Short of Autophagy protein 5 OS=Homo sapiens OX=9606 GN=ATG5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	145-UNIMOD:4	0.08	24.0	1	1	0
PRT	sp|P06400|RB_HUMAN	Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9BZF1-3|OSBL8_HUMAN	Isoform 3 of Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	2	1	0
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.15	24.0	1	1	1
PRT	sp|Q9NWW5|CLN6_HUMAN	Ceroid-lipofuscinosis neuronal protein 6 OS=Homo sapiens OX=9606 GN=CLN6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P48507|GSH0_HUMAN	Glutamate--cysteine ligase regulatory subunit OS=Homo sapiens OX=9606 GN=GCLM PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	2	1	0
PRT	sp|Q96NL6|SCLT1_HUMAN	Sodium channel and clathrin linker 1 OS=Homo sapiens OX=9606 GN=SCLT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	476-UNIMOD:28	0.03	24.0	3	2	1
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	2	2	2
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P61011-2|SRP54_HUMAN	Isoform 2 of Signal recognition particle 54 kDa protein OS=Homo sapiens OX=9606 GN=SRP54	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|O14530-2|TXND9_HUMAN	Isoform 2 of Thioredoxin domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TXNDC9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	39-UNIMOD:35	0.06	24.0	2	1	0
PRT	sp|P40937-2|RFC5_HUMAN	Isoform 2 of Replication factor C subunit 5 OS=Homo sapiens OX=9606 GN=RFC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q96AG4|LRC59_HUMAN	Leucine-rich repeat-containing protein 59 OS=Homo sapiens OX=9606 GN=LRRC59 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	2	1	0
PRT	sp|O60244|MED14_HUMAN	Mediator of RNA polymerase II transcription subunit 14 OS=Homo sapiens OX=9606 GN=MED14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	621-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|Q9BXW9|FACD2_HUMAN	Fanconi anemia group D2 protein OS=Homo sapiens OX=9606 GN=FANCD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	2	1	0
PRT	sp|P15924|DESP_HUMAN	Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.00	24.0	1	1	1
PRT	sp|Q8N2Z9|CENPS_HUMAN	Centromere protein S OS=Homo sapiens OX=9606 GN=CENPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.12	24.0	1	1	1
PRT	sp|Q96SW2-2|CRBN_HUMAN	Isoform 2 of Protein cereblon OS=Homo sapiens OX=9606 GN=CRBN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	325-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|P18858-2|DNLI1_HUMAN	Isoform 2 of DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	3	2	0
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	181-UNIMOD:35	0.06	24.0	5	2	1
PRT	sp|Q6EMB2|TTLL5_HUMAN	Tubulin polyglutamylase TTLL5 OS=Homo sapiens OX=9606 GN=TTLL5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|A6NDB9|PALM3_HUMAN	Paralemmin-3 OS=Homo sapiens OX=9606 GN=PALM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q8TEP8-1|CE192_HUMAN	Isoform 1 of Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q13951|PEBB_HUMAN	Core-binding factor subunit beta OS=Homo sapiens OX=9606 GN=CBFB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	2	1	0
PRT	sp|P08559-3|ODPA_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9BZI7-2|REN3B_HUMAN	Isoform 2 of Regulator of nonsense transcripts 3B OS=Homo sapiens OX=9606 GN=UPF3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	905-UNIMOD:35	0.02	24.0	3	1	0
PRT	sp|P04264|K2C1_HUMAN	Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	3	1	0
PRT	sp|O75822|EIF3J_HUMAN	Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	61-UNIMOD:27	0.04	24.0	1	1	0
PRT	sp|Q86V48|LUZP1_HUMAN	Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	2	2	1
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	843-UNIMOD:28	0.01	24.0	2	2	0
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	46-UNIMOD:35,49-UNIMOD:35	0.06	24.0	9	2	0
PRT	sp|Q13619|CUL4A_HUMAN	Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|Q9UNF1|MAGD2_HUMAN	Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	1	1	0
PRT	sp|Q96JM7|LMBL3_HUMAN	Lethal(3)malignant brain tumor-like protein 3 OS=Homo sapiens OX=9606 GN=L3MBTL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q14934|NFAC4_HUMAN	Nuclear factor of activated T-cells, cytoplasmic 4 OS=Homo sapiens OX=9606 GN=NFATC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,6-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|Q8TCS8|PNPT1_HUMAN	Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q8N6D2|RN182_HUMAN	E3 ubiquitin-protein ligase RNF182 OS=Homo sapiens OX=9606 GN=RNF182 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,20-UNIMOD:4	0.09	24.0	1	1	1
PRT	sp|Q8N3C0|ASCC3_HUMAN	Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens OX=9606 GN=ASCC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	19-UNIMOD:28	0.01	24.0	1	1	0
PRT	sp|Q6PJG6|BRAT1_HUMAN	BRCA1-associated ATM activator 1 OS=Homo sapiens OX=9606 GN=BRAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	21-UNIMOD:28,28-UNIMOD:4	0.01	24.0	1	1	0
PRT	sp|P35232|PHB_HUMAN	Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	187-UNIMOD:28,149-UNIMOD:28	0.08	24.0	3	2	1
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q01813|PFKAP_HUMAN	ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	24.0	2	1	0
PRT	sp|O43516|WIPF1_HUMAN	WAS/WASL-interacting protein family member 1 OS=Homo sapiens OX=9606 GN=WIPF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	446-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|P02533|K1C14_HUMAN	Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	389-UNIMOD:385,389-UNIMOD:4,391-UNIMOD:35	0.03	24.0	4	1	0
PRT	sp|Q9BV86|NTM1A_HUMAN	N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=NTMT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	24.0	3	1	0
PRT	sp|O95273|CCDB1_HUMAN	Cyclin-D1-binding protein 1 OS=Homo sapiens OX=9606 GN=CCNDBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	58-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	3	1	0
PRT	sp|Q16512|PKN1_HUMAN	Serine/threonine-protein kinase N1 OS=Homo sapiens OX=9606 GN=PKN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.01	24.0	2	1	0
PRT	sp|P98082|DAB2_HUMAN	Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.03	24.0	2	1	0
PRT	sp|O60563|CCNT1_HUMAN	Cyclin-T1 OS=Homo sapiens OX=9606 GN=CCNT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	2	1	0
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	209-UNIMOD:4	0.02	23.0	3	2	1
PRT	sp|O60293-2|ZC3H1_HUMAN	Isoform 2 of Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	1587-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|Q8WW12-2|PCNP_HUMAN	Isoform 2 of PEST proteolytic signal-containing nuclear protein OS=Homo sapiens OX=9606 GN=PCNP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.13	23.0	1	1	1
PRT	sp|P50895|BCAM_HUMAN	Basal cell adhesion molecule OS=Homo sapiens OX=9606 GN=BCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q96C34-2|RUND1_HUMAN	Isoform 2 of RUN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RUNDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	35-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q13618-3|CUL3_HUMAN	Isoform 3 of Cullin-3 OS=Homo sapiens OX=9606 GN=CUL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9NZ63|TLS1_HUMAN	Telomere length and silencing protein 1 homolog OS=Homo sapiens OX=9606 GN=C9orf78 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9Y282-2|ERGI3_HUMAN	Isoform 2 of Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Homo sapiens OX=9606 GN=ERGIC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	142-UNIMOD:4,145-UNIMOD:4,182-UNIMOD:4	0.10	23.0	2	2	1
PRT	sp|Q9UBF2-2|COPG2_HUMAN	Isoform 2 of Coatomer subunit gamma-2 OS=Homo sapiens OX=9606 GN=COPG2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	516-UNIMOD:4	0.02	23.0	1	1	0
PRT	sp|P52888|THOP1_HUMAN	Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q96IU2|ZBED3_HUMAN	Zinc finger BED domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBED3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	227-UNIMOD:4	0.06	23.0	1	1	1
PRT	sp|Q5SWX8-3|ODR4_HUMAN	Isoform 3 of Protein odr-4 homolog OS=Homo sapiens OX=9606 GN=ODR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	231-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|Q6XUX3-3|DUSTY_HUMAN	Isoform 3 of Dual serine/threonine and tyrosine protein kinase OS=Homo sapiens OX=9606 GN=DSTYK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q13217|DNJC3_HUMAN	DnaJ homolog subfamily C member 3 OS=Homo sapiens OX=9606 GN=DNAJC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	2	1	0
PRT	sp|Q9NYV6-4|RRN3_HUMAN	Isoform 4 of RNA polymerase I-specific transcription initiation factor RRN3 OS=Homo sapiens OX=9606 GN=RRN3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|O94830|DDHD2_HUMAN	Phospholipase DDHD2 OS=Homo sapiens OX=9606 GN=DDHD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q09028-3|RBBP4_HUMAN	Isoform 3 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	3	1	0
PRT	sp|Q8IWB1|IPRI_HUMAN	Inositol 1,4,5-trisphosphate receptor-interacting protein OS=Homo sapiens OX=9606 GN=ITPRIP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	2	1	0
PRT	sp|Q13439-3|GOGA4_HUMAN	Isoform 3 of Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.00	23.0	1	1	1
PRT	sp|Q9HCS7|SYF1_HUMAN	Pre-mRNA-splicing factor SYF1 OS=Homo sapiens OX=9606 GN=XAB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	2	2	2
PRT	sp|Q9H1X3-2|DJC25_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 25 OS=Homo sapiens OX=9606 GN=DNAJC25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q7Z2K6|ERMP1_HUMAN	Endoplasmic reticulum metallopeptidase 1 OS=Homo sapiens OX=9606 GN=ERMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	2	1	0
PRT	sp|Q8NEJ9-2|NGDN_HUMAN	Isoform 2 of Neuroguidin OS=Homo sapiens OX=9606 GN=NGDN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q5VT25-3|MRCKA_HUMAN	Isoform 3 of Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens OX=9606 GN=CDC42BPA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	2	1	0
PRT	sp|Q96FW1|OTUB1_HUMAN	Ubiquitin thioesterase OTUB1 OS=Homo sapiens OX=9606 GN=OTUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	2	1	0
PRT	sp|P33981-2|TTK_HUMAN	Isoform 2 of Dual specificity protein kinase TTK OS=Homo sapiens OX=9606 GN=TTK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9H6R0|DHX33_HUMAN	ATP-dependent RNA helicase DHX33 OS=Homo sapiens OX=9606 GN=DHX33 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.00	23.0	2	2	2
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	2	2	1
PRT	sp|Q9UQR0|SCML2_HUMAN	Sex comb on midleg-like protein 2 OS=Homo sapiens OX=9606 GN=SCML2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q8TDB6|DTX3L_HUMAN	E3 ubiquitin-protein ligase DTX3L OS=Homo sapiens OX=9606 GN=DTX3L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q86YT6|MIB1_HUMAN	E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens OX=9606 GN=MIB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	85-UNIMOD:4,88-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|Q6P9B6|MEAK7_HUMAN	MTOR-associated protein MEAK7 OS=Homo sapiens OX=9606 GN=MEAK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P20338|RAB4A_HUMAN	Ras-related protein Rab-4A OS=Homo sapiens OX=9606 GN=RAB4A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P28715|ERCC5_HUMAN	DNA repair protein complementing XP-G cells OS=Homo sapiens OX=9606 GN=ERCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P53539-7|FOSB_HUMAN	Isoform 7 of Protein fosB OS=Homo sapiens OX=9606 GN=FOSB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q9NRX1|PNO1_HUMAN	RNA-binding protein PNO1 OS=Homo sapiens OX=9606 GN=PNO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q49A88|CCD14_HUMAN	Coiled-coil domain-containing protein 14 OS=Homo sapiens OX=9606 GN=CCDC14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P20339-2|RAB5A_HUMAN	Isoform 2 of Ras-related protein Rab-5A OS=Homo sapiens OX=9606 GN=RAB5A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|P40222|TXLNA_HUMAN	Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	4	2	0
PRT	sp|P00367-2|DHE3_HUMAN	Isoform 2 of Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	2	1	0
PRT	sp|Q9NQ55-2|SSF1_HUMAN	Isoform 2 of Suppressor of SWI4 1 homolog OS=Homo sapiens OX=9606 GN=PPAN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q86VN1-2|VPS36_HUMAN	Isoform 2 of Vacuolar protein-sorting-associated protein 36 OS=Homo sapiens OX=9606 GN=VPS36	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	0
PRT	sp|Q8NE86-3|MCU_HUMAN	Isoform 3 of Calcium uniporter protein, mitochondrial OS=Homo sapiens OX=9606 GN=MCU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|O75554-2|WBP4_HUMAN	Isoform 2 of WW domain-binding protein 4 OS=Homo sapiens OX=9606 GN=WBP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q6PJG6-2|BRAT1_HUMAN	Isoform 2 of BRCA1-associated ATM activator 1 OS=Homo sapiens OX=9606 GN=BRAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	28-UNIMOD:4	0.04	23.0	1	1	0
PRT	sp|Q5BKZ1-3|ZN326_HUMAN	Isoform 3 of DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	2	2	2
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	303-UNIMOD:28	0.04	23.0	3	2	1
PRT	sp|O76024|WFS1_HUMAN	Wolframin OS=Homo sapiens OX=9606 GN=WFS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q8TDN6|BRX1_HUMAN	Ribosome biogenesis protein BRX1 homolog OS=Homo sapiens OX=9606 GN=BRIX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	3	1	0
PRT	sp|O96028-4|NSD2_HUMAN	Isoform 4 of Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens OX=9606 GN=NSD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	461-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q969Q5|RAB24_HUMAN	Ras-related protein Rab-24 OS=Homo sapiens OX=9606 GN=RAB24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	2	1	0
PRT	sp|Q9BS34|ZN670_HUMAN	Zinc finger protein 670 OS=Homo sapiens OX=9606 GN=ZNF670 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9BRQ6|MIC25_HUMAN	MICOS complex subunit MIC25 OS=Homo sapiens OX=9606 GN=CHCHD6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	211-UNIMOD:35	0.02	23.0	8	1	0
PRT	sp|Q14197|ICT1_HUMAN	Peptidyl-tRNA hydrolase ICT1, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	2	1	0
PRT	sp|P29084|T2EB_HUMAN	Transcription initiation factor IIE subunit beta OS=Homo sapiens OX=9606 GN=GTF2E2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	2	1	0
PRT	sp|Q9BRT8-2|CBWD1_HUMAN	Isoform 2 of COBW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CBWD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9UKZ1|CNO11_HUMAN	CCR4-NOT transcription complex subunit 11 OS=Homo sapiens OX=9606 GN=CNOT11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P14923|PLAK_HUMAN	Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	193-UNIMOD:35,49-UNIMOD:4	0.03	23.0	2	2	2
PRT	sp|Q8WZ74|CTTB2_HUMAN	Cortactin-binding protein 2 OS=Homo sapiens OX=9606 GN=CTTNBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|O75771-7|RA51D_HUMAN	Isoform 7 of DNA repair protein RAD51 homolog 4 OS=Homo sapiens OX=9606 GN=RAD51D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|Q76M96|CCD80_HUMAN	Coiled-coil domain-containing protein 80 OS=Homo sapiens OX=9606 GN=CCDC80 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	2	1	0
PRT	sp|Q9Y2K7-3|KDM2A_HUMAN	Isoform 3 of Lysine-specific demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	3	1	0
PRT	sp|Q05682-2|CALD1_HUMAN	Isoform 2 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	294-UNIMOD:27	0.02	23.0	1	1	0
PRT	sp|Q9UJA5|TRM6_HUMAN	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Homo sapiens OX=9606 GN=TRMT6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	2	1	0
PRT	sp|Q9NZT2|OGFR_HUMAN	Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	0
PRT	sp|Q8IUD2|RB6I2_HUMAN	ELKS/Rab6-interacting/CAST family member 1 OS=Homo sapiens OX=9606 GN=ERC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	2	1	0
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.05	23.0	2	2	2
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	389-UNIMOD:28	0.02	23.0	1	1	1
PRT	sp|P32856|STX2_HUMAN	Syntaxin-2 OS=Homo sapiens OX=9606 GN=STX2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	1	1	0
PRT	sp|Q9Y696|CLIC4_HUMAN	Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	234-UNIMOD:4	0.10	23.0	3	2	1
PRT	sp|Q96HH9|GRM2B_HUMAN	GRAM domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GRAMD2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.03	23.0	1	1	1
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q6ZRS2|SRCAP_HUMAN	Helicase SRCAP OS=Homo sapiens OX=9606 GN=SRCAP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	2334-UNIMOD:28	0.00	23.0	1	1	1
PRT	sp|O75157|T22D2_HUMAN	TSC22 domain family protein 2 OS=Homo sapiens OX=9606 GN=TSC22D2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	63-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q9H0Y0|ATG10_HUMAN	Ubiquitin-like-conjugating enzyme ATG10 OS=Homo sapiens OX=9606 GN=ATG10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	23.0	2	1	0
PRT	sp|P14209|CD99_HUMAN	CD99 antigen OS=Homo sapiens OX=9606 GN=CD99 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|Q13243|SRSF5_HUMAN	Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	1	1	0
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	5-UNIMOD:27	0.03	23.0	4	1	0
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	3	1	0
PRT	sp|Q8TET4|GANC_HUMAN	Neutral alpha-glucosidase C OS=Homo sapiens OX=9606 GN=GANC PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9Y2H6|FND3A_HUMAN	Fibronectin type-III domain-containing protein 3A OS=Homo sapiens OX=9606 GN=FNDC3A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q8WXW3|PIBF1_HUMAN	Progesterone-induced-blocking factor 1 OS=Homo sapiens OX=9606 GN=PIBF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	221-UNIMOD:28	0.02	23.0	1	1	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	91-UNIMOD:4	0.06	23.0	1	1	1
PRT	sp|P82673|RT35_HUMAN	28S ribosomal protein S35, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P16070|CD44_HUMAN	CD44 antigen OS=Homo sapiens OX=9606 GN=CD44 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	2	1	0
PRT	sp|Q9UNS1|TIM_HUMAN	Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	0
PRT	sp|Q96KB5|TOPK_HUMAN	Lymphokine-activated killer T-cell-originated protein kinase OS=Homo sapiens OX=9606 GN=PBK PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q8NB16|MLKL_HUMAN	Mixed lineage kinase domain-like protein OS=Homo sapiens OX=9606 GN=MLKL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q96RR1-3|PEO1_HUMAN	Isoform 3 of Twinkle protein, mitochondrial OS=Homo sapiens OX=9606 GN=TWNK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q96SB3|NEB2_HUMAN	Neurabin-2 OS=Homo sapiens OX=9606 GN=PPP1R9B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q15075|EEA1_HUMAN	Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	2	2	2
PRT	sp|O14730-2|RIOK3_HUMAN	Isoform 2 of Serine/threonine-protein kinase RIO3 OS=Homo sapiens OX=9606 GN=RIOK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P60983|GMFB_HUMAN	Glia maturation factor beta OS=Homo sapiens OX=9606 GN=GMFB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	2	1	0
PRT	sp|P21926|CD9_HUMAN	CD9 antigen OS=Homo sapiens OX=9606 GN=CD9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q8IWE4|DCNL3_HUMAN	DCN1-like protein 3 OS=Homo sapiens OX=9606 GN=DCUN1D3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|O15226|NKRF_HUMAN	NF-kappa-B-repressing factor OS=Homo sapiens OX=9606 GN=NKRF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	3	1	0
PRT	sp|Q15785|TOM34_HUMAN	Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	67-UNIMOD:4,70-UNIMOD:4	0.06	22.0	3	2	1
PRT	sp|O75844|FACE1_HUMAN	CAAX prenyl protease 1 homolog OS=Homo sapiens OX=9606 GN=ZMPSTE24 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	300-UNIMOD:35	0.03	22.0	4	1	0
PRT	sp|Q9UPU7-2|TBD2B_HUMAN	Isoform 2 of TBC1 domain family member 2B OS=Homo sapiens OX=9606 GN=TBC1D2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q8TE68-4|ES8L1_HUMAN	Isoform 4 of Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	0
PRT	sp|Q96T23-3|RSF1_HUMAN	Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	2	2	2
PRT	sp|Q8TCT9-5|HM13_HUMAN	Isoform 5 of Minor histocompatibility antigen H13 OS=Homo sapiens OX=9606 GN=HM13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P24588|AKAP5_HUMAN	A-kinase anchor protein 5 OS=Homo sapiens OX=9606 GN=AKAP5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P68363-2|TBA1B_HUMAN	Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	0
PRT	sp|O75127|PTCD1_HUMAN	Pentatricopeptide repeat-containing protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	695-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q8TDM6-2|DLG5_HUMAN	Isoform 2 of Disks large homolog 5 OS=Homo sapiens OX=9606 GN=DLG5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	0
PRT	sp|Q96BY6-3|DOC10_HUMAN	Isoform 3 of Dedicator of cytokinesis protein 10 OS=Homo sapiens OX=9606 GN=DOCK10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O60749-2|SNX2_HUMAN	Isoform 2 of Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P35241-4|RADI_HUMAN	Isoform 4 of Radixin OS=Homo sapiens OX=9606 GN=RDX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q14203-5|DCTN1_HUMAN	Isoform 5 of Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9Y3D7|TIM16_HUMAN	Mitochondrial import inner membrane translocase subunit TIM16 OS=Homo sapiens OX=9606 GN=PAM16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	103-UNIMOD:27	0.07	22.0	2	1	0
PRT	sp|O00716-2|E2F3_HUMAN	Isoform 2 of Transcription factor E2F3 OS=Homo sapiens OX=9606 GN=E2F3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q96DE5|APC16_HUMAN	Anaphase-promoting complex subunit 16 OS=Homo sapiens OX=9606 GN=ANAPC16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.12	22.0	1	1	1
PRT	sp|Q14432|PDE3A_HUMAN	cGMP-inhibited 3',5'-cyclic phosphodiesterase A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	2	2	2
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	496-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	784-UNIMOD:35	0.02	22.0	3	2	1
PRT	sp|Q96EA4-2|SPDLY_HUMAN	Isoform 2 of Protein Spindly OS=Homo sapiens OX=9606 GN=SPDL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q93079|H2B1H_HUMAN	Histone H2B type 1-H OS=Homo sapiens OX=9606 GN=HIST1H2BH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	4	1	0
PRT	sp|Q8WVM7-2|STAG1_HUMAN	Isoform 2 of Cohesin subunit SA-1 OS=Homo sapiens OX=9606 GN=STAG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9BQE5|APOL2_HUMAN	Apolipoprotein L2 OS=Homo sapiens OX=9606 GN=APOL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	2	2	2
PRT	sp|P31749-2|AKT1_HUMAN	Isoform 2 of RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q99816-2|TS101_HUMAN	Isoform 2 of Tumor susceptibility gene 101 protein OS=Homo sapiens OX=9606 GN=TSG101	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q9Y6X4|F169A_HUMAN	Soluble lamin-associated protein of 75 kDa OS=Homo sapiens OX=9606 GN=FAM169A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P07738|PMGE_HUMAN	Bisphosphoglycerate mutase OS=Homo sapiens OX=9606 GN=BPGM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	2	1	0
PRT	sp|P04424-3|ARLY_HUMAN	Isoform 3 of Argininosuccinate lyase OS=Homo sapiens OX=9606 GN=ASL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	227-UNIMOD:35,233-UNIMOD:35	0.02	22.0	3	1	0
PRT	sp|Q9UPW5-2|CBPC1_HUMAN	Isoform 2 of Cytosolic carboxypeptidase 1 OS=Homo sapiens OX=9606 GN=AGTPBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9GZR7-2|DDX24_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9H9A7|RMI1_HUMAN	RecQ-mediated genome instability protein 1 OS=Homo sapiens OX=9606 GN=RMI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q6P4F7-3|RHGBA_HUMAN	Isoform 3 of Rho GTPase-activating protein 11A OS=Homo sapiens OX=9606 GN=ARHGAP11A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q7Z333-3|SETX_HUMAN	Isoform 3 of Probable helicase senataxin OS=Homo sapiens OX=9606 GN=SETX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.00	22.0	1	1	1
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	8-UNIMOD:27,1-UNIMOD:1	0.10	22.0	5	4	3
PRT	sp|Q9HCK8-2|CHD8_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens OX=9606 GN=CHD8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	2	2	2
PRT	sp|Q07352|TISB_HUMAN	mRNA decay activator protein ZFP36L1 OS=Homo sapiens OX=9606 GN=ZFP36L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P11117|PPAL_HUMAN	Lysosomal acid phosphatase OS=Homo sapiens OX=9606 GN=ACP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q9BWC9|CC106_HUMAN	Coiled-coil domain-containing protein 106 OS=Homo sapiens OX=9606 GN=CCDC106 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q9NWB6-3|ARGL1_HUMAN	Isoform 3 of Arginine and glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ARGLU1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|P54578-2|UBP14_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	453-UNIMOD:35	0.05	22.0	10	2	0
PRT	sp|Q96FS4|SIPA1_HUMAN	Signal-induced proliferation-associated protein 1 OS=Homo sapiens OX=9606 GN=SIPA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	2	2	2
PRT	sp|Q69YQ0-2|CYTSA_HUMAN	Isoform 2 of Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	347-UNIMOD:35,57-UNIMOD:35	0.06	22.0	14	2	1
PRT	sp|Q9Y2A7|NCKP1_HUMAN	Nck-associated protein 1 OS=Homo sapiens OX=9606 GN=NCKAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	2	1	0
PRT	sp|O75886-2|STAM2_HUMAN	Isoform 2 of Signal transducing adapter molecule 2 OS=Homo sapiens OX=9606 GN=STAM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	661-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|Q14004-2|CDK13_HUMAN	Isoform 2 of Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9BZF9-2|UACA_HUMAN	Isoform 2 of Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P49454|CENPF_HUMAN	Centromere protein F OS=Homo sapiens OX=9606 GN=CENPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.00	22.0	1	1	1
PRT	sp|P61020-2|RAB5B_HUMAN	Isoform 2 of Ras-related protein Rab-5B OS=Homo sapiens OX=9606 GN=RAB5B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.08	22.0	2	1	0
PRT	sp|Q5SRE7-2|PHYD1_HUMAN	Isoform 2 of Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHYHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q99598|TSNAX_HUMAN	Translin-associated protein X OS=Homo sapiens OX=9606 GN=TSNAX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	282-UNIMOD:35	0.04	22.0	3	1	0
PRT	sp|O95347-2|SMC2_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	2	2	2
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	5	3	1
PRT	sp|P18440|ARY1_HUMAN	Arylamine N-acetyltransferase 1 OS=Homo sapiens OX=9606 GN=NAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P09622-2|DLDH_HUMAN	Isoform 2 of Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q9NRY5|F1142_HUMAN	Protein FAM114A2 OS=Homo sapiens OX=9606 GN=FAM114A2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|O14802|RPC1_HUMAN	DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens OX=9606 GN=POLR3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9BPX5|ARP5L_HUMAN	Actin-related protein 2/3 complex subunit 5-like protein OS=Homo sapiens OX=9606 GN=ARPC5L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|Q5T9S5-2|CCD18_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 18 OS=Homo sapiens OX=9606 GN=CCDC18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P53778-2|MK12_HUMAN	Isoform 2 of Mitogen-activated protein kinase 12 OS=Homo sapiens OX=9606 GN=MAPK12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P07951|TPM2_HUMAN	Tropomyosin beta chain OS=Homo sapiens OX=9606 GN=TPM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	190-UNIMOD:4,38-UNIMOD:28	0.08	22.0	4	2	0
PRT	sp|Q5VZK9|CARL1_HUMAN	F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	1-UNIMOD:1	0.01	22.0	1	1	1
PRT	sp|Q12830|BPTF_HUMAN	Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens OX=9606 GN=BPTF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	1308-UNIMOD:28	0.00	22.0	1	1	1
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	2	1	0
PRT	sp|O60271|JIP4_HUMAN	C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	0
PRT	sp|Q9H6Z4|RANB3_HUMAN	Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	228-UNIMOD:4	0.03	22.0	1	1	0
PRT	sp|Q9H2V7|SPNS1_HUMAN	Protein spinster homolog 1 OS=Homo sapiens OX=9606 GN=SPNS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1-UNIMOD:35	0.09	22.0	1	1	1
PRT	sp|P36956|SRBP1_HUMAN	Sterol regulatory element-binding protein 1 OS=Homo sapiens OX=9606 GN=SREBF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	0
PRT	sp|O94906|PRP6_HUMAN	Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	2	2	1
PRT	sp|P42345|MTOR_HUMAN	Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	2	2	2
PRT	sp|Q8WX92-2|NELFB_HUMAN	Isoform 2 of Negative elongation factor B OS=Homo sapiens OX=9606 GN=NELFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.02	22.0	1	1	1
PRT	sp|Q6PML9|ZNT9_HUMAN	Zinc transporter 9 OS=Homo sapiens OX=9606 GN=SLC30A9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null		0.04	22.0	4	2	0
PRT	sp|P62633|CNBP_HUMAN	Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	67-UNIMOD:4,74-UNIMOD:4,77-UNIMOD:4	0.08	22.0	1	1	0
PRT	sp|Q07065|CKAP4_HUMAN	Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O15397|IPO8_HUMAN	Importin-8 OS=Homo sapiens OX=9606 GN=IPO8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	0
PRT	sp|Q9UH65|SWP70_HUMAN	Switch-associated protein 70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	22.0	null	330-UNIMOD:28	0.02	22.0	5	1	0
PRT	sp|O60313|OPA1_HUMAN	Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	912-UNIMOD:27	0.01	22.0	1	1	0
PRT	sp|P09525|ANXA4_HUMAN	Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	173-UNIMOD:28	0.04	22.0	1	1	0
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	675-UNIMOD:27	0.02	22.0	1	1	0
PRT	sp|Q6P4A7|SFXN4_HUMAN	Sideroflexin-4 OS=Homo sapiens OX=9606 GN=SFXN4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.04	22.0	1	1	1
PRT	sp|Q9H609|ZN576_HUMAN	Zinc finger protein 576 OS=Homo sapiens OX=9606 GN=ZNF576 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	1-UNIMOD:1	0.07	22.0	1	1	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	186-UNIMOD:27	0.02	22.0	1	1	1
PRT	sp|P49815|TSC2_HUMAN	Tuberin OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P05114|HMGN1_HUMAN	Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	62-UNIMOD:28	0.11	22.0	1	1	1
PRT	sp|O94761|RECQ4_HUMAN	ATP-dependent DNA helicase Q4 OS=Homo sapiens OX=9606 GN=RECQL4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O43684|BUB3_HUMAN	Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	315-UNIMOD:28	0.03	22.0	1	1	1
PRT	sp|Q9UN66|PCDB8_HUMAN	Protocadherin beta-8 OS=Homo sapiens OX=9606 GN=PCDHB8 PE=2 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9NP61|ARFG3_HUMAN	ADP-ribosylation factor GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=ARFGAP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	255-UNIMOD:35	0.02	22.0	1	1	0
PRT	sp|Q8IVF2|AHNK2_HUMAN	Protein AHNAK2 OS=Homo sapiens OX=9606 GN=AHNAK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.00	22.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q92805|GOGA1_HUMAN	Golgin subfamily A member 1 OS=Homo sapiens OX=9606 GN=GOLGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	2	2	2
PRT	sp|O94906-2|PRP6_HUMAN	Isoform 2 of Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	0
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	2	2	2
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	125-UNIMOD:35	0.01	21.0	1	1	1
PRT	sp|Q13098-5|CSN1_HUMAN	Isoform 4 of COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|O94916-2|NFAT5_HUMAN	Isoform A of Nuclear factor of activated T-cells 5 OS=Homo sapiens OX=9606 GN=NFAT5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	0
PRT	sp|P16298-2|PP2BB_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP3CB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|Q92581|SL9A6_HUMAN	Sodium/hydrogen exchanger 6 OS=Homo sapiens OX=9606 GN=SLC9A6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9UQN3-2|CHM2B_HUMAN	Isoform 2 of Charged multivesicular body protein 2b OS=Homo sapiens OX=9606 GN=CHMP2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|P55058-3|PLTP_HUMAN	Isoform 3 of Phospholipid transfer protein OS=Homo sapiens OX=9606 GN=PLTP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q12905|ILF2_HUMAN	Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P20336|RAB3A_HUMAN	Ras-related protein Rab-3A OS=Homo sapiens OX=9606 GN=RAB3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	137-UNIMOD:4	0.06	21.0	1	1	1
PRT	sp|O15144|ARPC2_HUMAN	Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens OX=9606 GN=ARPC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null		0.07	21.0	5	3	1
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q1ED39|KNOP1_HUMAN	Lysine-rich nucleolar protein 1 OS=Homo sapiens OX=9606 GN=KNOP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q8IYB7-4|DI3L2_HUMAN	Isoform 4 of DIS3-like exonuclease 2 OS=Homo sapiens OX=9606 GN=DIS3L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	216-UNIMOD:4	0.05	21.0	1	1	1
PRT	sp|P60903|S10AA_HUMAN	Protein S100-A10 OS=Homo sapiens OX=9606 GN=S100A10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	62-UNIMOD:4	0.10	21.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	147-UNIMOD:4	0.05	21.0	1	1	1
PRT	sp|Q86W92-3|LIPB1_HUMAN	Isoform 3 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q16877-2|F264_HUMAN	Isoform 2 of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens OX=9606 GN=PFKFB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9UBL3|ASH2L_HUMAN	Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Homo sapiens OX=9606 GN=ASH2L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q15042-4|RB3GP_HUMAN	Isoform 3 of Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	4	2	0
PRT	sp|Q9HD26-3|GOPC_HUMAN	Isoform 3 of Golgi-associated PDZ and coiled-coil motif-containing protein OS=Homo sapiens OX=9606 GN=GOPC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.07	21.0	2	2	2
PRT	sp|Q15477|SKIV2_HUMAN	Helicase SKI2W OS=Homo sapiens OX=9606 GN=SKIV2L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9UKI8-3|TLK1_HUMAN	Isoform 3 of Serine/threonine-protein kinase tousled-like 1 OS=Homo sapiens OX=9606 GN=TLK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	3	1	0
PRT	sp|Q9UM54-5|MYO6_HUMAN	Isoform 5 of Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O75781-2|PALM_HUMAN	Isoform 2 of Paralemmin-1 OS=Homo sapiens OX=9606 GN=PALM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	0
PRT	sp|Q10570|CPSF1_HUMAN	Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens OX=9606 GN=CPSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	1056-UNIMOD:27	0.01	21.0	3	1	0
PRT	sp|Q13126-4|MTAP_HUMAN	Isoform 4 of S-methyl-5'-thioadenosine phosphorylase OS=Homo sapiens OX=9606 GN=MTAP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q8IWA0|WDR75_HUMAN	WD repeat-containing protein 75 OS=Homo sapiens OX=9606 GN=WDR75 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9BQL6-4|FERM1_HUMAN	Isoform 4 of Fermitin family homolog 1 OS=Homo sapiens OX=9606 GN=FERMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q96GY3|LIN37_HUMAN	Protein lin-37 homolog OS=Homo sapiens OX=9606 GN=LIN37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null		0.06	21.0	2	1	0
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	6-UNIMOD:35,5-UNIMOD:27	0.03	21.0	14	1	0
PRT	sp|Q8WX93-4|PALLD_HUMAN	Isoform 4 of Palladin OS=Homo sapiens OX=9606 GN=PALLD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q13459-2|MYO9B_HUMAN	Isoform Short of Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	2	2	2
PRT	sp|P30519-2|HMOX2_HUMAN	Isoform 2 of Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	2	1	0
PRT	sp|P56524-2|HDAC4_HUMAN	Isoform 2 of Histone deacetylase 4 OS=Homo sapiens OX=9606 GN=HDAC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	2	2	2
PRT	sp|Q96S52-2|PIGS_HUMAN	Isoform 2 of GPI transamidase component PIG-S OS=Homo sapiens OX=9606 GN=PIGS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9BSH4|TACO1_HUMAN	Translational activator of cytochrome c oxidase 1 OS=Homo sapiens OX=9606 GN=TACO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	2	1	0
PRT	sp|P00568|KAD1_HUMAN	Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	98-UNIMOD:27	0.06	21.0	2	1	0
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q7L1Q6-2|BZW1_HUMAN	Isoform 2 of Basic leucine zipper and W2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BZW1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q99832-2|TCPH_HUMAN	Isoform 2 of T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	178-UNIMOD:35	0.04	21.0	1	1	1
PRT	sp|O75486|SUPT3_HUMAN	Transcription initiation protein SPT3 homolog OS=Homo sapiens OX=9606 GN=SUPT3H PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null		0.01	21.0	3	2	1
PRT	sp|O95633-2|FSTL3_HUMAN	Isoform 2 of Follistatin-related protein 3 OS=Homo sapiens OX=9606 GN=FSTL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	217-UNIMOD:4	0.11	21.0	2	1	0
PRT	sp|Q9H2F5|EPC1_HUMAN	Enhancer of polycomb homolog 1 OS=Homo sapiens OX=9606 GN=EPC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O15212|PFD6_HUMAN	Prefoldin subunit 6 OS=Homo sapiens OX=9606 GN=PFDN6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|Q9Y4G6|TLN2_HUMAN	Talin-2 OS=Homo sapiens OX=9606 GN=TLN2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	1125-UNIMOD:27	0.01	21.0	2	2	2
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	3	2	1
PRT	sp|P30154-5|2AAB_HUMAN	Isoform 5 of Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens OX=9606 GN=PPP2R1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q8IYW5|RN168_HUMAN	E3 ubiquitin-protein ligase RNF168 OS=Homo sapiens OX=9606 GN=RNF168 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q86VI3|IQGA3_HUMAN	Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens OX=9606 GN=IQGAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q99715-2|COCA1_HUMAN	Isoform 2 of Collagen alpha-1(XII) chain OS=Homo sapiens OX=9606 GN=COL12A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.00	21.0	1	1	1
PRT	sp|Q58A45-2|PAN3_HUMAN	Isoform 2 of PAN2-PAN3 deadenylation complex subunit PAN3 OS=Homo sapiens OX=9606 GN=PAN3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P00519|ABL1_HUMAN	Tyrosine-protein kinase ABL1 OS=Homo sapiens OX=9606 GN=ABL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O94913|PCF11_HUMAN	Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	1518-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|Q15404|RSU1_HUMAN	Ras suppressor protein 1 OS=Homo sapiens OX=9606 GN=RSU1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q99933-3|BAG1_HUMAN	Isoform 3 of BAG family molecular chaperone regulator 1 OS=Homo sapiens OX=9606 GN=BAG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.08	21.0	2	2	2
PRT	sp|P13674-3|P4HA1_HUMAN	Isoform 3 of Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens OX=9606 GN=P4HA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|P53814-5|SMTN_HUMAN	Isoform B2 of Smoothelin OS=Homo sapiens OX=9606 GN=SMTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P37840-2|SYUA_HUMAN	Isoform 2-4 of Alpha-synuclein OS=Homo sapiens OX=9606 GN=SNCA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.09	21.0	1	1	1
PRT	sp|Q8NEF9|SRFB1_HUMAN	Serum response factor-binding protein 1 OS=Homo sapiens OX=9606 GN=SRFBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	2	2	2
PRT	sp|Q6Y7W6-4|GGYF2_HUMAN	Isoform 3 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q6ZS30-1|NBEL1_HUMAN	Isoform 1 of Neurobeachin-like protein 1 OS=Homo sapiens OX=9606 GN=NBEAL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.00	21.0	1	1	1
PRT	sp|Q8IY33-3|MILK2_HUMAN	Isoform 3 of MICAL-like protein 2 OS=Homo sapiens OX=9606 GN=MICALL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q03518|TAP1_HUMAN	Antigen peptide transporter 1 OS=Homo sapiens OX=9606 GN=TAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q69YN2-3|C19L1_HUMAN	Isoform 3 of CWF19-like protein 1 OS=Homo sapiens OX=9606 GN=CWF19L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P54646|AAPK2_HUMAN	5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens OX=9606 GN=PRKAA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q8IUH3-2|RBM45_HUMAN	Isoform 2 of RNA-binding protein 45 OS=Homo sapiens OX=9606 GN=RBM45	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|O95139-2|NDUB6_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 OS=Homo sapiens OX=9606 GN=NDUFB6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.08	21.0	2	1	0
PRT	sp|P33991|MCM4_HUMAN	DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q8NHS0|DNJB8_HUMAN	DnaJ homolog subfamily B member 8 OS=Homo sapiens OX=9606 GN=DNAJB8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	3	1	0
PRT	sp|Q9H2P0|ADNP_HUMAN	Activity-dependent neuroprotector homeobox protein OS=Homo sapiens OX=9606 GN=ADNP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P35251|RFC1_HUMAN	Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	218-UNIMOD:28	0.01	21.0	1	1	0
PRT	sp|Q9UKV3|ACINU_HUMAN	Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	695-UNIMOD:27	0.02	21.0	2	2	1
PRT	sp|P08195|4F2_HUMAN	4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|Q8WUY3|PRUN2_HUMAN	Protein prune homolog 2 OS=Homo sapiens OX=9606 GN=PRUNE2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	0
PRT	sp|Q8IX12|CCAR1_HUMAN	Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	0
PRT	sp|Q5TKA1|LIN9_HUMAN	Protein lin-9 homolog OS=Homo sapiens OX=9606 GN=LIN9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	435-UNIMOD:385,435-UNIMOD:4	0.02	21.0	1	1	0
PRT	sp|Q8NBJ4|GOLM1_HUMAN	Golgi membrane protein 1 OS=Homo sapiens OX=9606 GN=GOLM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.03	21.0	1	1	1
PRT	sp|Q01433|AMPD2_HUMAN	AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	524-UNIMOD:27	0.01	21.0	2	1	0
PRT	sp|Q16891|MIC60_HUMAN	MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	196-UNIMOD:27	0.01	21.0	1	1	0
PRT	sp|P33993|MCM7_HUMAN	DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	0
PRT	sp|Q9BSF0|SMAKA_HUMAN	Small membrane A-kinase anchor protein OS=Homo sapiens OX=9606 GN=C2orf88 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	21-UNIMOD:28	0.15	21.0	1	1	1
PRT	sp|Q8WUW1|BRK1_HUMAN	Protein BRICK1 OS=Homo sapiens OX=9606 GN=BRK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.13	21.0	1	1	1
PRT	sp|Q15286|RAB35_HUMAN	Ras-related protein Rab-35 OS=Homo sapiens OX=9606 GN=RAB35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	179-UNIMOD:28	0.06	21.0	1	1	1
PRT	sp|O00425|IF2B3_HUMAN	Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens OX=9606 GN=IGF2BP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	0
PRT	sp|Q15942|ZYX_HUMAN	Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	444-UNIMOD:385,444-UNIMOD:4,447-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|O15446|RPA34_HUMAN	DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=CD3EAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	1-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|O60239|3BP5_HUMAN	SH3 domain-binding protein 5 OS=Homo sapiens OX=9606 GN=SH3BP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	31-UNIMOD:35	0.08	21.0	1	1	1
PRT	sp|P49643|PRI2_HUMAN	DNA primase large subunit OS=Homo sapiens OX=9606 GN=PRIM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null		0.02	21.0	1	1	0
PRT	sp|Q92581-3|SL9A6_HUMAN	Isoform 3 of Sodium/hydrogen exchanger 6 OS=Homo sapiens OX=9606 GN=SLC9A6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	1-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|O94916|NFAT5_HUMAN	Nuclear factor of activated T-cells 5 OS=Homo sapiens OX=9606 GN=NFAT5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	0
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	1-UNIMOD:1	0.02	21.0	2	1	0
PRT	sp|P35908|K22E_HUMAN	Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens OX=9606 GN=KRT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q8N668|COMD1_HUMAN	COMM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=COMMD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.05	21.0	1	1	1
PRT	sp|Q9NVN3|RIC8B_HUMAN	Synembryn-B OS=Homo sapiens OX=9606 GN=RIC8B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|O43493|TGON2_HUMAN	Trans-Golgi network integral membrane protein 2 OS=Homo sapiens OX=9606 GN=TGOLN2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9UK23|NAGPA_HUMAN	N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|Q8IWI9|MGAP_HUMAN	MAX gene-associated protein OS=Homo sapiens OX=9606 GN=MGA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1295-UNIMOD:4	0.00	21.0	1	1	1
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	0
PRT	sp|Q92843-2|B2CL2_HUMAN	Isoform 3 of Bcl-2-like protein 2 OS=Homo sapiens OX=9606 GN=BCL2L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q27J81-2|INF2_HUMAN	Isoform 2 of Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9NR28-2|DBLOH_HUMAN	Isoform 2 of Diablo homolog, mitochondrial OS=Homo sapiens OX=9606 GN=DIABLO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.07	20.0	2	1	0
PRT	sp|O15061|SYNEM_HUMAN	Synemin OS=Homo sapiens OX=9606 GN=SYNM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null	275-UNIMOD:4	0.01	20.0	2	2	2
PRT	sp|Q8IY95-2|TM192_HUMAN	Isoform 2 of Transmembrane protein 192 OS=Homo sapiens OX=9606 GN=TMEM192	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q149N8-4|SHPRH_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens OX=9606 GN=SHPRH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q15714-4|T22D1_HUMAN	Isoform 4 of TSC22 domain family protein 1 OS=Homo sapiens OX=9606 GN=TSC22D1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q99848|EBP2_HUMAN	Probable rRNA-processing protein EBP2 OS=Homo sapiens OX=9606 GN=EBNA1BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	4	1	0
PRT	sp|O95433-2|AHSA1_HUMAN	Isoform 2 of Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens OX=9606 GN=AHSA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	56-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|P63010|AP2B1_HUMAN	AP-2 complex subunit beta OS=Homo sapiens OX=9606 GN=AP2B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q15650|TRIP4_HUMAN	Activating signal cointegrator 1 OS=Homo sapiens OX=9606 GN=TRIP4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|P52789|HXK2_HUMAN	Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q14573|ITPR3_HUMAN	Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens OX=9606 GN=ITPR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.00	20.0	1	1	1
PRT	sp|P23258|TBG1_HUMAN	Tubulin gamma-1 chain OS=Homo sapiens OX=9606 GN=TUBG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9Y5T5-5|UBP16_HUMAN	Isoform 5 of Ubiquitin carboxyl-terminal hydrolase 16 OS=Homo sapiens OX=9606 GN=USP16	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q659C4-4|LAR1B_HUMAN	Isoform 4 of La-related protein 1B OS=Homo sapiens OX=9606 GN=LARP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q15833-2|STXB2_HUMAN	Isoform 2 of Syntaxin-binding protein 2 OS=Homo sapiens OX=9606 GN=STXBP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	0
PRT	sp|Q09028-2|RBBP4_HUMAN	Isoform 2 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	1-UNIMOD:1	0.04	20.0	2	2	2
PRT	sp|Q96GQ7|DDX27_HUMAN	Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens OX=9606 GN=DDX27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q8IWB7|WDFY1_HUMAN	WD repeat and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=WDFY1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P78330|SERB_HUMAN	Phosphoserine phosphatase OS=Homo sapiens OX=9606 GN=PSPH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	2	2	2
PRT	sp|Q99707-2|METH_HUMAN	Isoform 2 of Methionine synthase OS=Homo sapiens OX=9606 GN=MTR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|O14545-2|TRAD1_HUMAN	Isoform 2 of TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TRAFD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	109-UNIMOD:4	0.06	20.0	1	1	1
PRT	sp|O75592-2|MYCB2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens OX=9606 GN=MYCBP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	4353-UNIMOD:4	0.00	20.0	2	1	0
PRT	sp|Q9H2G2-2|SLK_HUMAN	Isoform 2 of STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	608-UNIMOD:35	0.01	20.0	1	1	0
PRT	sp|Q02224|CENPE_HUMAN	Centromere-associated protein E OS=Homo sapiens OX=9606 GN=CENPE PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	2	2	2
PRT	sp|Q07864|DPOE1_HUMAN	DNA polymerase epsilon catalytic subunit A OS=Homo sapiens OX=9606 GN=POLE PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q8N357|S35F6_HUMAN	Solute carrier family 35 member F6 OS=Homo sapiens OX=9606 GN=SLC35F6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q9Y6W3|CAN7_HUMAN	Calpain-7 OS=Homo sapiens OX=9606 GN=CAPN7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q8WXX5|DNJC9_HUMAN	DnaJ homolog subfamily C member 9 OS=Homo sapiens OX=9606 GN=DNAJC9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P49821-2|NDUV1_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	370-UNIMOD:4,373-UNIMOD:4,376-UNIMOD:4	0.03	20.0	2	1	0
PRT	sp|O75718|CRTAP_HUMAN	Cartilage-associated protein OS=Homo sapiens OX=9606 GN=CRTAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	6	2	1
PRT	sp|P50748|KNTC1_HUMAN	Kinetochore-associated protein 1 OS=Homo sapiens OX=9606 GN=KNTC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	980-UNIMOD:4	0.00	20.0	1	1	1
PRT	sp|Q9Y6M5|ZNT1_HUMAN	Zinc transporter 1 OS=Homo sapiens OX=9606 GN=SLC30A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q7Z3T8|ZFY16_HUMAN	Zinc finger FYVE domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZFYVE16 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q86UU0-3|BCL9L_HUMAN	Isoform 3 of B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9H1A4|APC1_HUMAN	Anaphase-promoting complex subunit 1 OS=Homo sapiens OX=9606 GN=ANAPC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q8WXA9|SREK1_HUMAN	Splicing regulatory glutamine/lysine-rich protein 1 OS=Homo sapiens OX=9606 GN=SREK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9BR76|COR1B_HUMAN	Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	25-UNIMOD:4,475-UNIMOD:4	0.04	20.0	2	2	2
PRT	sp|Q96HR8-2|NAF1_HUMAN	Isoform 2 of H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Homo sapiens OX=9606 GN=NAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q14966-2|ZN638_HUMAN	Isoform 2 of Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	652-UNIMOD:4	0.01	20.0	1	1	0
PRT	sp|Q9NQS1|AVEN_HUMAN	Cell death regulator Aven OS=Homo sapiens OX=9606 GN=AVEN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|O14949|QCR8_HUMAN	Cytochrome b-c1 complex subunit 8 OS=Homo sapiens OX=9606 GN=UQCRQ PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.12	20.0	1	1	1
PRT	sp|Q9UQB8-3|BAIP2_HUMAN	Isoform 3 of Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9P0L0|VAPA_HUMAN	Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q8TBA6-2|GOGA5_HUMAN	Isoform 2 of Golgin subfamily A member 5 OS=Homo sapiens OX=9606 GN=GOLGA5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q8IWJ2|GCC2_HUMAN	GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	1029-UNIMOD:28,48-UNIMOD:4	0.01	20.0	4	2	1
PRT	sp|Q9UBB9-2|TFP11_HUMAN	Isoform 2 of Tuftelin-interacting protein 11 OS=Homo sapiens OX=9606 GN=TFIP11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q6PJG2|MDEAS_HUMAN	Mitotic deacetylase-associated SANT domain protein OS=Homo sapiens OX=9606 GN=MIDEAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q08AE8-4|SPIR1_HUMAN	Isoform 4 of Protein spire homolog 1 OS=Homo sapiens OX=9606 GN=SPIRE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q8NFD5|ARI1B_HUMAN	AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.00	20.0	1	1	1
PRT	sp|Q15283-2|RASA2_HUMAN	Isoform 2 of Ras GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=RASA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q13418-3|ILK_HUMAN	Isoform 3 of Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	105-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q9NW64|RBM22_HUMAN	Pre-mRNA-splicing factor RBM22 OS=Homo sapiens OX=9606 GN=RBM22 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	20.0	null	71-UNIMOD:4,74-UNIMOD:4,278-UNIMOD:28	0.05	20.0	3	2	1
PRT	sp|P62857|RS28_HUMAN	40S ribosomal protein S28 OS=Homo sapiens OX=9606 GN=RPS28 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	27-UNIMOD:4	0.17	20.0	1	1	1
PRT	sp|O95197-7|RTN3_HUMAN	Isoform 7 of Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9Y618-5|NCOR2_HUMAN	Isoform 4 of Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.00	20.0	1	1	1
PRT	sp|P61024|CKS1_HUMAN	Cyclin-dependent kinases regulatory subunit 1 OS=Homo sapiens OX=9606 GN=CKS1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null		0.13	20.0	3	1	0
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	2	2	1
PRT	sp|Q13310|PABP4_HUMAN	Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	178-UNIMOD:27	0.04	20.0	6	2	0
PRT	sp|P54652|HSP72_HUMAN	Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q9HAU0|PKHA5_HUMAN	Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	0
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	191-UNIMOD:28	0.03	20.0	2	1	0
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	3	2	1
PRT	sp|Q9BYJ9|YTHD1_HUMAN	YTH domain-containing family protein 1 OS=Homo sapiens OX=9606 GN=YTHDF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q5SSJ5|HP1B3_HUMAN	Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	1	1	0
PRT	sp|O95239|KIF4A_HUMAN	Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	947-UNIMOD:28	0.01	20.0	1	1	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	20.0	null	169-UNIMOD:27	0.01	20.0	2	1	0
PRT	sp|P49959|MRE11_HUMAN	Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	0
PRT	sp|Q8N567|ZCHC9_HUMAN	Zinc finger CCHC domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZCCHC9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	160-UNIMOD:385,160-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|Q9BXK5|B2L13_HUMAN	Bcl-2-like protein 13 OS=Homo sapiens OX=9606 GN=BCL2L13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P13674|P4HA1_HUMAN	Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens OX=9606 GN=P4HA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	328-UNIMOD:28	0.02	20.0	1	1	0
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	1-UNIMOD:1	0.02	20.0	1	1	1
PRT	sp|Q92547|TOPB1_HUMAN	DNA topoisomerase 2-binding protein 1 OS=Homo sapiens OX=9606 GN=TOPBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1039-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q86VN1|VPS36_HUMAN	Vacuolar protein-sorting-associated protein 36 OS=Homo sapiens OX=9606 GN=VPS36 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	206-UNIMOD:28	0.03	20.0	1	1	0
PRT	sp|Q9H788|SH24A_HUMAN	SH2 domain-containing protein 4A OS=Homo sapiens OX=9606 GN=SH2D4A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	207-UNIMOD:28	0.03	20.0	1	1	1
PRT	sp|Q12824|SNF5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Homo sapiens OX=9606 GN=SMARCB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q07812|BAX_HUMAN	Apoptosis regulator BAX OS=Homo sapiens OX=9606 GN=BAX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	1-UNIMOD:1	0.05	20.0	1	1	1
PRT	sp|Q14966|ZN638_HUMAN	Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	652-UNIMOD:4	0.01	20.0	1	1	0
PRT	sp|Q6PGN9|PSRC1_HUMAN	Proline/serine-rich coiled-coil protein 1 OS=Homo sapiens OX=9606 GN=PSRC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	1-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|Q9H1Z4-2|WDR13_HUMAN	Isoform 2 of WD repeat-containing protein 13 OS=Homo sapiens OX=9606 GN=WDR13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	1-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|P00492|HPRT_HUMAN	Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	106-UNIMOD:4	0.06	20.0	1	1	1
PRT	sp|Q9HBL7|PLRKT_HUMAN	Plasminogen receptor (KT) OS=Homo sapiens OX=9606 GN=PLGRKT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	1	1	1
PRT	sp|Q92917|GPKOW_HUMAN	G-patch domain and KOW motifs-containing protein OS=Homo sapiens OX=9606 GN=GPKOW PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P45880|VDAC2_HUMAN	Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1,8-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q9H2Y7|ZN106_HUMAN	Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q96RL1|UIMC1_HUMAN	BRCA1-A complex subunit RAP80 OS=Homo sapiens OX=9606 GN=UIMC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	0
PRT	sp|P11137|MTAP2_HUMAN	Microtubule-associated protein 2 OS=Homo sapiens OX=9606 GN=MAP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	2	1	0
PRT	sp|Q9Y4E8-4|UBP15_HUMAN	Isoform 4 of Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P48163-2|MAOX_HUMAN	Isoform 2 of NADP-dependent malic enzyme OS=Homo sapiens OX=9606 GN=ME1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null	340-UNIMOD:4,345-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|P36543-3|VATE1_HUMAN	Isoform 3 of V-type proton ATPase subunit E 1 OS=Homo sapiens OX=9606 GN=ATP6V1E1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	2	1	0
PRT	sp|O43432-4|IF4G3_HUMAN	Isoform 4 of Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	3	2	1
PRT	sp|P20073-2|ANXA7_HUMAN	Isoform 2 of Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	2	2	2
PRT	sp|Q9H0D6-2|XRN2_HUMAN	Isoform 2 of 5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null	200-UNIMOD:4	0.02	19.0	2	2	2
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null	71-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|P43304|GPDM_HUMAN	Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=GPD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	589-UNIMOD:28	0.04	19.0	4	3	2
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q15788-2|NCOA1_HUMAN	Isoform 2 of Nuclear receptor coactivator 1 OS=Homo sapiens OX=9606 GN=NCOA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9UMZ2-6|SYNRG_HUMAN	Isoform 5 of Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	2	1	0
PRT	sp|O43156|TTI1_HUMAN	TELO2-interacting protein 1 homolog OS=Homo sapiens OX=9606 GN=TTI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q8WUP2-3|FBLI1_HUMAN	Isoform 3 of Filamin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=FBLIM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q9H3K2|GHITM_HUMAN	Growth hormone-inducible transmembrane protein OS=Homo sapiens OX=9606 GN=GHITM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null	71-UNIMOD:35	0.03	19.0	1	1	1
PRT	sp|Q9C0J8|WDR33_HUMAN	pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	2	1	0
PRT	sp|Q96LT9-2|RNPC3_HUMAN	Isoform 2 of RNA-binding region-containing protein 3 OS=Homo sapiens OX=9606 GN=RNPC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null	387-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|O15084|ANR28_HUMAN	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9UPY3-3|DICER_HUMAN	Isoform 3 of Endoribonuclease Dicer OS=Homo sapiens OX=9606 GN=DICER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P45974-2|UBP5_HUMAN	Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	3	2	1
PRT	sp|Q6NW34-2|NEPRO_HUMAN	Isoform 2 of Nucleolus and neural progenitor protein OS=Homo sapiens OX=9606 GN=NEPRO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q96EK7-2|F120B_HUMAN	Isoform 2 of Constitutive coactivator of peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=FAM120B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null	344-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|O75582-2|KS6A5_HUMAN	Isoform 2 of Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens OX=9606 GN=RPS6KA5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9UL01|DSE_HUMAN	Dermatan-sulfate epimerase OS=Homo sapiens OX=9606 GN=DSE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|O43896|KIF1C_HUMAN	Kinesin-like protein KIF1C OS=Homo sapiens OX=9606 GN=KIF1C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|O43242|PSMD3_HUMAN	26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q8NDT2-2|RB15B_HUMAN	Isoform 2 of Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q5TCZ1-2|SPD2A_HUMAN	Isoform 2 of SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	0
PRT	sp|Q9UKJ3-2|GPTC8_HUMAN	Isoform 2 of G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q96LK0|CEP19_HUMAN	Centrosomal protein of 19 kDa OS=Homo sapiens OX=9606 GN=CEP19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|Q15054-3|DPOD3_HUMAN	Isoform 3 of DNA polymerase delta subunit 3 OS=Homo sapiens OX=9606 GN=POLD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q8IUF8-2|RIOX2_HUMAN	Isoform 2 of Ribosomal oxygenase 2 OS=Homo sapiens OX=9606 GN=RIOX2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q9P2R3|ANFY1_HUMAN	Rabankyrin-5 OS=Homo sapiens OX=9606 GN=ANKFY1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	2	2	2
PRT	sp|Q92570|NR4A3_HUMAN	Nuclear receptor subfamily 4 group A member 3 OS=Homo sapiens OX=9606 GN=NR4A3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	2	1	0
PRT	sp|P48449-2|ERG7_HUMAN	Isoform 2 of Lanosterol synthase OS=Homo sapiens OX=9606 GN=LSS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9HCE3|ZN532_HUMAN	Zinc finger protein 532 OS=Homo sapiens OX=9606 GN=ZNF532 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9H8W4|PKHF2_HUMAN	Pleckstrin homology domain-containing family F member 2 OS=Homo sapiens OX=9606 GN=PLEKHF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q9Y6J0-2|CABIN_HUMAN	Isoform 2 of Calcineurin-binding protein cabin-1 OS=Homo sapiens OX=9606 GN=CABIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q8TDY2-2|RBCC1_HUMAN	Isoform 2 of RB1-inducible coiled-coil protein 1 OS=Homo sapiens OX=9606 GN=RB1CC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	2	2	2
PRT	sp|Q9GZT3-2|SLIRP_HUMAN	Isoform 2 of SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.09	19.0	1	1	0
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null	31-UNIMOD:35	0.01	19.0	2	1	0
PRT	sp|O94992|HEXI1_HUMAN	Protein HEXIM1 OS=Homo sapiens OX=9606 GN=HEXIM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P23246-2|SFPQ_HUMAN	Isoform Short of Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	2	1	0
PRT	sp|Q8WXH0-2|SYNE2_HUMAN	Isoform 2 of Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.00	19.0	1	1	1
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O43166-3|SI1L1_HUMAN	Isoform 3 of Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q7Z6B0-2|CCD91_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 91 OS=Homo sapiens OX=9606 GN=CCDC91	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O00418|EF2K_HUMAN	Eukaryotic elongation factor 2 kinase OS=Homo sapiens OX=9606 GN=EEF2K PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	2	1	0
PRT	sp|O15031|PLXB2_HUMAN	Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.00	19.0	1	1	1
PRT	sp|P62316|SMD2_HUMAN	Small nuclear ribonucleoprotein Sm D2 OS=Homo sapiens OX=9606 GN=SNRPD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null	11-UNIMOD:35	0.09	19.0	1	1	1
PRT	sp|Q13131|AAPK1_HUMAN	5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens OX=9606 GN=PRKAA1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P51610-2|HCFC1_HUMAN	Isoform 2 of Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	0
PRT	sp|Q08499-5|PDE4D_HUMAN	Isoform 2 of cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Homo sapiens OX=9606 GN=PDE4D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	3	3	3
PRT	sp|P61289|PSME3_HUMAN	Proteasome activator complex subunit 3 OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9Y3B4|SF3B6_HUMAN	Splicing factor 3B subunit 6 OS=Homo sapiens OX=9606 GN=SF3B6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|O15498-2|YKT6_HUMAN	Isoform 2 of Synaptobrevin homolog YKT6 OS=Homo sapiens OX=9606 GN=YKT6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P67936-2|TPM4_HUMAN	Isoform 2 of Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	190-UNIMOD:385,190-UNIMOD:4	0.04	19.0	7	1	0
PRT	sp|P09493-3|TPM1_HUMAN	Isoform 3 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	218-UNIMOD:27	0.04	19.0	1	1	1
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	170-UNIMOD:27	0.04	19.0	2	1	0
PRT	sp|Q92974|ARHG2_HUMAN	Rho guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=ARHGEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	967-UNIMOD:35,928-UNIMOD:28	0.04	19.0	3	3	1
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	1292-UNIMOD:27,1313-UNIMOD:28	0.01	19.0	2	2	1
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	19.0	null	178-UNIMOD:27	0.03	19.0	4	2	0
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	0
PRT	sp|Q9Y282|ERGI3_HUMAN	Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Homo sapiens OX=9606 GN=ERGIC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	182-UNIMOD:4	0.03	19.0	1	1	0
PRT	sp|Q9BRP8|PYM1_HUMAN	Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.09	19.0	1	1	0
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	571-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|Q8TDM6|DLG5_HUMAN	Disks large homolog 5 OS=Homo sapiens OX=9606 GN=DLG5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	0
PRT	sp|Q15020|SART3_HUMAN	Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	587-UNIMOD:27	0.01	19.0	1	1	1
PRT	sp|Q01085|TIAR_HUMAN	Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	1-UNIMOD:1	0.03	19.0	1	1	1
PRT	sp|P51659|DHB4_HUMAN	Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens OX=9606 GN=HSD17B4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	0
PRT	sp|Q9H1Y0|ATG5_HUMAN	Autophagy protein 5 OS=Homo sapiens OX=9606 GN=ATG5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	221-UNIMOD:27,223-UNIMOD:4	0.05	19.0	1	1	0
PRT	sp|P20339|RAB5A_HUMAN	Ras-related protein Rab-5A OS=Homo sapiens OX=9606 GN=RAB5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|O43818|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens OX=9606 GN=RRP9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.02	19.0	1	1	1
PRT	sp|O60337|MARH6_HUMAN	E3 ubiquitin-protein ligase MARCHF6 OS=Homo sapiens OX=9606 GN=MARCHF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|Q9P2D3|HTR5B_HUMAN	HEAT repeat-containing protein 5B OS=Homo sapiens OX=9606 GN=HEATR5B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q5JTJ3|COA6_HUMAN	Cytochrome c oxidase assembly factor 6 homolog OS=Homo sapiens OX=9606 GN=COA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	68-UNIMOD:4,79-UNIMOD:4	0.11	19.0	1	1	1
PRT	sp|Q96G28|CFA36_HUMAN	Cilia- and flagella-associated protein 36 OS=Homo sapiens OX=9606 GN=CFAP36 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	37-UNIMOD:385,37-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|Q86WB0|NIPA_HUMAN	Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	406-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|Q14254|FLOT2_HUMAN	Flotillin-2 OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P51159|RB27A_HUMAN	Ras-related protein Rab-27A OS=Homo sapiens OX=9606 GN=RAB27A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	19.0	null	145-UNIMOD:27	0.05	19.0	3	1	0
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	1-UNIMOD:1	0.03	19.0	1	1	1
PRT	sp|P55769|NH2L1_HUMAN	NHP2-like protein 1 OS=Homo sapiens OX=9606 GN=SNU13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.07	19.0	1	1	1
PRT	sp|Q9Y2R4|DDX52_HUMAN	Probable ATP-dependent RNA helicase DDX52 OS=Homo sapiens OX=9606 GN=DDX52 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O95926|SYF2_HUMAN	Pre-mRNA-splicing factor SYF2 OS=Homo sapiens OX=9606 GN=SYF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q9H939|PPIP2_HUMAN	Proline-serine-threonine phosphatase-interacting protein 2 OS=Homo sapiens OX=9606 GN=PSTPIP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	213-UNIMOD:4,221-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|P27105|STOM_HUMAN	Erythrocyte band 7 integral membrane protein OS=Homo sapiens OX=9606 GN=STOM PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	207-UNIMOD:35	0.04	19.0	1	1	1
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	2	1	0
PRT	sp|Q8WUM4|PDC6I_HUMAN	Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	0
PRT	sp|P61088|UBE2N_HUMAN	Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens OX=9606 GN=UBE2N PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|A6PVI3|NCB2L_HUMAN	Nuclear cap-binding protein subunit 2-like OS=Homo sapiens OX=9606 GN=NCBP2L PE=3 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|Q99470|SDF2_HUMAN	Stromal cell-derived factor 2 OS=Homo sapiens OX=9606 GN=SDF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|Q9H6E5|STPAP_HUMAN	Speckle targeted PIP5K1A-regulated poly(A) polymerase OS=Homo sapiens OX=9606 GN=TUT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P07741-2|APT_HUMAN	Isoform 2 of Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.07	18.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q15370-2|ELOB_HUMAN	Isoform 2 of Elongin-B OS=Homo sapiens OX=9606 GN=ELOB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|Q6ZU80-1|CE128_HUMAN	Isoform 1 of Centrosomal protein of 128 kDa OS=Homo sapiens OX=9606 GN=CEP128	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q2KHR3-2|QSER1_HUMAN	Isoform 2 of Glutamine and serine-rich protein 1 OS=Homo sapiens OX=9606 GN=QSER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P10109|ADX_HUMAN	Adrenodoxin, mitochondrial OS=Homo sapiens OX=9606 GN=FDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.05	18.0	1	1	1
PRT	sp|P61764|STXB1_HUMAN	Syntaxin-binding protein 1 OS=Homo sapiens OX=9606 GN=STXBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q6NXT6-2|TAPT1_HUMAN	Isoform 2 of Transmembrane anterior posterior transformation protein 1 homolog OS=Homo sapiens OX=9606 GN=TAPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|O43379|WDR62_HUMAN	WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q9H444|CHM4B_HUMAN	Charged multivesicular body protein 4b OS=Homo sapiens OX=9606 GN=CHMP4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|Q99584|S10AD_HUMAN	Protein S100-A13 OS=Homo sapiens OX=9606 GN=S100A13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.09	18.0	2	1	0
PRT	sp|Q7Z4Q2-3|HEAT3_HUMAN	Isoform 3 of HEAT repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=HEATR3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q7L8L6|FAKD5_HUMAN	FAST kinase domain-containing protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	389-UNIMOD:35	0.02	18.0	1	1	0
PRT	sp|P16615-4|AT2A2_HUMAN	Isoform 4 of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	970-UNIMOD:4	0.01	18.0	1	1	1
PRT	sp|Q9BZ29-3|DOCK9_HUMAN	Isoform 3 of Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q99550-2|MPP9_HUMAN	Isoform 2 of M-phase phosphoprotein 9 OS=Homo sapiens OX=9606 GN=MPHOSPH9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q8WUD1-2|RAB2B_HUMAN	Isoform 2 of Ras-related protein Rab-2B OS=Homo sapiens OX=9606 GN=RAB2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|Q15020-4|SART3_HUMAN	Isoform 4 of Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	785-UNIMOD:4	0.01	18.0	1	1	1
PRT	sp|Q92576-2|PHF3_HUMAN	Isoform 2 of PHD finger protein 3 OS=Homo sapiens OX=9606 GN=PHF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	363-UNIMOD:4	0.01	18.0	1	1	1
PRT	sp|P49643-2|PRI2_HUMAN	Isoform 2 of DNA primase large subunit OS=Homo sapiens OX=9606 GN=PRIM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.07	18.0	1	1	0
PRT	sp|P10074|TZAP_HUMAN	Telomere zinc finger-associated protein OS=Homo sapiens OX=9606 GN=ZBTB48 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q8TER5-4|ARH40_HUMAN	Isoform 4 of Rho guanine nucleotide exchange factor 40 OS=Homo sapiens OX=9606 GN=ARHGEF40	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	462-UNIMOD:4	0.01	18.0	1	1	1
PRT	sp|Q96MW5|COG8_HUMAN	Conserved oligomeric Golgi complex subunit 8 OS=Homo sapiens OX=9606 GN=COG8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q9UDT6-2|CLIP2_HUMAN	Isoform 2 of CAP-Gly domain-containing linker protein 2 OS=Homo sapiens OX=9606 GN=CLIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q9BVV6-2|TALD3_HUMAN	Isoform 2 of Protein TALPID3 OS=Homo sapiens OX=9606 GN=KIAA0586	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P51149|RAB7A_HUMAN	Ras-related protein Rab-7a OS=Homo sapiens OX=9606 GN=RAB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|Q13200-2|PSMD2_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	2	2	1
PRT	sp|P58546|MTPN_HUMAN	Myotrophin OS=Homo sapiens OX=9606 GN=MTPN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.08	18.0	1	1	1
PRT	sp|O95428-4|PPN_HUMAN	Isoform 4 of Papilin OS=Homo sapiens OX=9606 GN=PAPLN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P08581|MET_HUMAN	Hepatocyte growth factor receptor OS=Homo sapiens OX=9606 GN=MET PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P17568|NDUB7_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Homo sapiens OX=9606 GN=NDUFB7 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.08	18.0	1	1	1
PRT	sp|Q9NZL4-2|HPBP1_HUMAN	Isoform 2 of Hsp70-binding protein 1 OS=Homo sapiens OX=9606 GN=HSPBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|Q70J99-2|UN13D_HUMAN	Isoform 2 of Protein unc-13 homolog D OS=Homo sapiens OX=9606 GN=UNC13D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	3	1	0
PRT	sp|Q53S33|BOLA3_HUMAN	BolA-like protein 3 OS=Homo sapiens OX=9606 GN=BOLA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.07	18.0	1	1	1
PRT	sp|O60333-3|KIF1B_HUMAN	Isoform 3 of Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P30414|NKTR_HUMAN	NK-tumor recognition protein OS=Homo sapiens OX=9606 GN=NKTR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q9NSV4-2|DIAP3_HUMAN	Isoform 2 of Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q9NP61-2|ARFG3_HUMAN	Isoform 2 of ADP-ribosylation factor GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=ARFGAP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	211-UNIMOD:35	0.02	18.0	1	1	0
PRT	sp|P61204-2|ARF3_HUMAN	Isoform 2 of ADP-ribosylation factor 3 OS=Homo sapiens OX=9606 GN=ARF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	73-UNIMOD:35	0.06	18.0	1	1	1
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	202-UNIMOD:35	0.04	18.0	3	3	2
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P17301|ITA2_HUMAN	Integrin alpha-2 OS=Homo sapiens OX=9606 GN=ITGA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P54750-8|PDE1A_HUMAN	Isoform 8 of Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Homo sapiens OX=9606 GN=PDE1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q8NEZ4-3|KMT2C_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase 2C OS=Homo sapiens OX=9606 GN=KMT2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.00	18.0	1	1	1
PRT	sp|Q9UPQ9|TNR6B_HUMAN	Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q14690|RRP5_HUMAN	Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.09	18.0	19	1	0
PRT	sp|P42694|HELZ_HUMAN	Probable helicase with zinc finger domain OS=Homo sapiens OX=9606 GN=HELZ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q14155-1|ARHG7_HUMAN	Isoform 1 of Rho guanine nucleotide exchange factor 7 OS=Homo sapiens OX=9606 GN=ARHGEF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P18621|RL17_HUMAN	60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|P09629|HXB7_HUMAN	Homeobox protein Hox-B7 OS=Homo sapiens OX=9606 GN=HOXB7 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|P06753-2|TPM3_HUMAN	Isoform 2 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.00	18.0	3	1	0
PRT	sp|P54760-2|EPHB4_HUMAN	Isoform 2 of Ephrin type-B receptor 4 OS=Homo sapiens OX=9606 GN=EPHB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P82979|SARNP_HUMAN	SAP domain-containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|Q86WR0-2|CCD25_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 25 OS=Homo sapiens OX=9606 GN=CCDC25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.13	18.0	1	1	1
PRT	sp|Q96G03-2|PGM2_HUMAN	Isoform 2 of Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q7Z333|SETX_HUMAN	Probable helicase senataxin OS=Homo sapiens OX=9606 GN=SETX PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	18.0	null	2622-UNIMOD:385,2622-UNIMOD:4,2630-UNIMOD:4	0.00	18.0	2	1	0
PRT	sp|P18206|VINC_HUMAN	Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	904-UNIMOD:28	0.01	18.0	1	1	1
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	3720-UNIMOD:4,3721-UNIMOD:4	0.00	18.0	1	1	0
PRT	sp|P12956|XRCC6_HUMAN	X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	0
PRT	sp|Q13148|TADBP_HUMAN	TAR DNA-binding protein 43 OS=Homo sapiens OX=9606 GN=TARDBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	198-UNIMOD:385,198-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	644-UNIMOD:28	0.01	18.0	1	1	1
PRT	sp|O75592|MYCB2_HUMAN	E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens OX=9606 GN=MYCBP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	4356-UNIMOD:4	0.00	18.0	1	1	0
PRT	sp|P37840|SYUA_HUMAN	Alpha-synuclein OS=Homo sapiens OX=9606 GN=SNCA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	13-UNIMOD:27	0.07	18.0	2	1	0
PRT	sp|O94925|GLSK_HUMAN	Glutaminase kidney isoform, mitochondrial OS=Homo sapiens OX=9606 GN=GLS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	0
PRT	sp|Q9P219|DAPLE_HUMAN	Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q13084|RM28_HUMAN	39S ribosomal protein L28, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL28 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	172-UNIMOD:28	0.05	18.0	1	1	1
PRT	sp|Q8TE68|ES8L1_HUMAN	Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	0
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	214-UNIMOD:35	0.03	18.0	1	1	0
PRT	sp|P09497|CLCB_HUMAN	Clathrin light chain B OS=Homo sapiens OX=9606 GN=CLTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	185-UNIMOD:27	0.05	18.0	1	1	1
PRT	sp|Q9NR28|DBLOH_HUMAN	Diablo homolog, mitochondrial OS=Homo sapiens OX=9606 GN=DIABLO PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.05	18.0	1	1	0
PRT	sp|Q9Y2D5-4|AKAP2_HUMAN	Isoform 3 of A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.01	18.0	1	1	1
PRT	sp|Q9Y3B9|RRP15_HUMAN	RRP15-like protein OS=Homo sapiens OX=9606 GN=RRP15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.03	18.0	1	1	1
PRT	sp|Q2M389|WASC4_HUMAN	WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	959-UNIMOD:27	0.01	18.0	1	1	1
PRT	sp|Q9GZT3|SLIRP_HUMAN	SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.09	18.0	1	1	0
PRT	sp|P26368|U2AF2_HUMAN	Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.02	18.0	1	1	1
PRT	sp|O60493|SNX3_HUMAN	Sorting nexin-3 OS=Homo sapiens OX=9606 GN=SNX3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.06	18.0	2	1	0
PRT	sp|O00622|CCN1_HUMAN	CCN family member 1 OS=Homo sapiens OX=9606 GN=CCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	337-UNIMOD:385,337-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|O00255|MEN1_HUMAN	Menin OS=Homo sapiens OX=9606 GN=MEN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q8TD16|BICD2_HUMAN	Protein bicaudal D homolog 2 OS=Homo sapiens OX=9606 GN=BICD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P54578|UBP14_HUMAN	Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	488-UNIMOD:35	0.02	18.0	1	1	0
PRT	sp|P04075-2|ALDOA_HUMAN	Isoform 2 of Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P13682|ZNF35_HUMAN	Zinc finger protein 35 OS=Homo sapiens OX=9606 GN=ZNF35 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	156-UNIMOD:4	0.03	17.0	1	1	1
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|O94762-4|RECQ5_HUMAN	Isoform 4 of ATP-dependent DNA helicase Q5 OS=Homo sapiens OX=9606 GN=RECQL5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q13547|HDAC1_HUMAN	Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q14108-2|SCRB2_HUMAN	Isoform 2 of Lysosome membrane protein 2 OS=Homo sapiens OX=9606 GN=SCARB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q9H082|RB33B_HUMAN	Ras-related protein Rab-33B OS=Homo sapiens OX=9606 GN=RAB33B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q8WXE1-2|ATRIP_HUMAN	Isoform 2 of ATR-interacting protein OS=Homo sapiens OX=9606 GN=ATRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q14CZ7|FAKD3_HUMAN	FAST kinase domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q9P2J5-2|SYLC_HUMAN	Isoform 2 of Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	194-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|Q8WYA0-3|IFT81_HUMAN	Isoform 2 of Intraflagellar transport protein 81 homolog OS=Homo sapiens OX=9606 GN=IFT81	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q68CP9-3|ARID2_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARID2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P27816-6|MAP4_HUMAN	Isoform 6 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	592-UNIMOD:35	0.01	17.0	1	1	1
PRT	sp|A1X283|SPD2B_HUMAN	SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q9Y5A9-2|YTHD2_HUMAN	Isoform 2 of YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q14696-2|MESD_HUMAN	Isoform 2 of LRP chaperone MESD OS=Homo sapiens OX=9606 GN=MESD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.07	17.0	1	1	1
PRT	sp|Q16774|KGUA_HUMAN	Guanylate kinase OS=Homo sapiens OX=9606 GN=GUK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|O95243-3|MBD4_HUMAN	Isoform 3 of Methyl-CpG-binding domain protein 4 OS=Homo sapiens OX=9606 GN=MBD4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q07687-2|DLX2_HUMAN	Isoform 2 of Homeobox protein DLX-2 OS=Homo sapiens OX=9606 GN=DLX2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P12081-3|HARS1_HUMAN	Isoform 3 of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q99633|PRP18_HUMAN	Pre-mRNA-splicing factor 18 OS=Homo sapiens OX=9606 GN=PRPF18 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q13136-2|LIPA1_HUMAN	Isoform 2 of Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q53SF7|COBL1_HUMAN	Cordon-bleu protein-like 1 OS=Homo sapiens OX=9606 GN=COBLL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q9UHD2|TBK1_HUMAN	Serine/threonine-protein kinase TBK1 OS=Homo sapiens OX=9606 GN=TBK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	544-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|P48147|PPCE_HUMAN	Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	255-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|Q14457|BECN1_HUMAN	Beclin-1 OS=Homo sapiens OX=9606 GN=BECN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q8NF91-4|SYNE1_HUMAN	Isoform 4 of Nesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.00	17.0	1	1	1
PRT	sp|Q13625-3|ASPP2_HUMAN	Isoform 3 of Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q9UJK0|TSR3_HUMAN	Ribosome biogenesis protein TSR3 homolog OS=Homo sapiens OX=9606 GN=TSR3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|P05023-2|AT1A1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q9UNH6-2|SNX7_HUMAN	Isoform 2 of Sorting nexin-7 OS=Homo sapiens OX=9606 GN=SNX7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q7Z304|MAMC2_HUMAN	MAM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAMDC2 PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q8TDD1|DDX54_HUMAN	ATP-dependent RNA helicase DDX54 OS=Homo sapiens OX=9606 GN=DDX54 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|P09543-2|CN37_HUMAN	Isoform CNPI of 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Homo sapiens OX=9606 GN=CNP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q9NR31-2|SAR1A_HUMAN	Isoform 2 of GTP-binding protein SAR1a OS=Homo sapiens OX=9606 GN=SAR1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.08	17.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q9BUH8|BEGIN_HUMAN	Brain-enriched guanylate kinase-associated protein OS=Homo sapiens OX=9606 GN=BEGAIN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q9NQZ5|STAR7_HUMAN	StAR-related lipid transfer protein 7, mitochondrial OS=Homo sapiens OX=9606 GN=STARD7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P68104-2|EF1A1_HUMAN	Isoform 2 of Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	3	1	0
PRT	sp|Q9NS87-2|KIF15_HUMAN	Isoform 2 of Kinesin-like protein KIF15 OS=Homo sapiens OX=9606 GN=KIF15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q9Y3P9|RBGP1_HUMAN	Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q9H5N1-2|RABE2_HUMAN	Isoform 2 of Rab GTPase-binding effector protein 2 OS=Homo sapiens OX=9606 GN=RABEP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	519-UNIMOD:35	0.01	17.0	1	1	1
PRT	sp|Q9NYK5|RM39_HUMAN	39S ribosomal protein L39, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL39 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	3	1	0
PRT	sp|Q7KYR7-6|BT2A1_HUMAN	Isoform 6 of Butyrophilin subfamily 2 member A1 OS=Homo sapiens OX=9606 GN=BTN2A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|O60610-2|DIAP1_HUMAN	Isoform 2 of Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	17.0	null	79-UNIMOD:35	0.00	17.0	2	1	0
PRT	sp|Q6ZRQ5|MMS22_HUMAN	Protein MMS22-like OS=Homo sapiens OX=9606 GN=MMS22L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q86UV5-2|UBP48_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 48 OS=Homo sapiens OX=9606 GN=USP48	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q99543-2|DNJC2_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q9Y5I4-2|PCDC2_HUMAN	Isoform Short of Protocadherin alpha-C2 OS=Homo sapiens OX=9606 GN=PCDHAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q8NG31-3|KNL1_HUMAN	Isoform 3 of Kinetochore scaffold 1 OS=Homo sapiens OX=9606 GN=KNL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|O00151|PDLI1_HUMAN	PDZ and LIM domain protein 1 OS=Homo sapiens OX=9606 GN=PDLIM1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	2	1	0
PRT	sp|O95140-2|MFN2_HUMAN	Isoform 2 of Mitofusin-2 OS=Homo sapiens OX=9606 GN=MFN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|O00273-2|DFFA_HUMAN	Isoform DFF35 of DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	165-UNIMOD:4	0.03	17.0	1	1	1
PRT	sp|O60565-2|GREM1_HUMAN	Isoform 2 of Gremlin-1 OS=Homo sapiens OX=9606 GN=GREM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	67-UNIMOD:4	0.08	17.0	1	1	1
PRT	sp|Q9BW19|KIFC1_HUMAN	Kinesin-like protein KIFC1 OS=Homo sapiens OX=9606 GN=KIFC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q8NI27-2|THOC2_HUMAN	Isoform 2 of THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|O75044|SRGP2_HUMAN	SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q14126|DSG2_HUMAN	Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P26358-2|DNMT1_HUMAN	Isoform 2 of DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.00	17.0	1	1	1
PRT	sp|Q8NFH5-3|NUP35_HUMAN	Isoform 3 of Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|Q9NXE4-5|NSMA3_HUMAN	Isoform 5 of Sphingomyelin phosphodiesterase 4 OS=Homo sapiens OX=9606 GN=SMPD4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P55211-4|CASP9_HUMAN	Isoform 4 of Caspase-9 OS=Homo sapiens OX=9606 GN=CASP9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	104-UNIMOD:4	0.04	17.0	1	1	1
PRT	sp|O43592|XPOT_HUMAN	Exportin-T OS=Homo sapiens OX=9606 GN=XPOT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q9P0K7-4|RAI14_HUMAN	Isoform 4 of Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q8NBS9|TXND5_HUMAN	Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	0
PRT	sp|Q8IVL6|P3H3_HUMAN	Prolyl 3-hydroxylase 3 OS=Homo sapiens OX=9606 GN=P3H3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	0
PRT	sp|Q9NX55|HYPK_HUMAN	Huntingtin-interacting protein K OS=Homo sapiens OX=9606 GN=HYPK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.09	17.0	1	1	0
PRT	sp|A0MZ66|SHOT1_HUMAN	Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	0
PRT	sp|Q5M775|CYTSB_HUMAN	Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	740-UNIMOD:385,740-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	635-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|P46100|ATRX_HUMAN	Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q13439|GOGA4_HUMAN	Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	841-UNIMOD:28	0.00	17.0	1	1	1
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	70-UNIMOD:27	0.03	17.0	1	1	1
PRT	sp|P23193|TCEA1_HUMAN	Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	17.0	1	1	1
PRT	sp|Q6UX04|CWC27_HUMAN	Spliceosome-associated protein CWC27 homolog OS=Homo sapiens OX=9606 GN=CWC27 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	0
PRT	sp|Q9UBF2|COPG2_HUMAN	Coatomer subunit gamma-2 OS=Homo sapiens OX=9606 GN=COPG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	516-UNIMOD:385,516-UNIMOD:4	0.01	17.0	1	1	0
PRT	sp|P07108|ACBP_HUMAN	Acyl-CoA-binding protein OS=Homo sapiens OX=9606 GN=DBI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1	0.09	17.0	1	1	1
PRT	sp|Q9NPD8|UBE2T_HUMAN	Ubiquitin-conjugating enzyme E2 T OS=Homo sapiens OX=9606 GN=UBE2T PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	162-UNIMOD:35	0.10	17.0	1	1	1
PRT	sp|P08183|MDR1_HUMAN	ATP-dependent translocase ABCB1 OS=Homo sapiens OX=9606 GN=ABCB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	436-UNIMOD:35	0.02	17.0	1	1	0
PRT	sp|Q14643|ITPR1_HUMAN	Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens OX=9606 GN=ITPR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	1671-UNIMOD:28	0.00	17.0	1	1	1
PRT	sp|Q13057|COASY_HUMAN	Bifunctional coenzyme A synthase OS=Homo sapiens OX=9606 GN=COASY PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P42224|STAT1_HUMAN	Signal transducer and activator of transcription 1-alpha/beta OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q15833|STXB2_HUMAN	Syntaxin-binding protein 2 OS=Homo sapiens OX=9606 GN=STXBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	0
PRT	sp|Q14644|RASA3_HUMAN	Ras GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=RASA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1	0.01	17.0	1	1	1
PRT	sp|Q8IUH3|RBM45_HUMAN	RNA-binding protein 45 OS=Homo sapiens OX=9606 GN=RBM45 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q96IU4|ABHEB_HUMAN	Protein ABHD14B OS=Homo sapiens OX=9606 GN=ABHD14B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1	0.04	17.0	1	1	1
PRT	sp|Q9HC36|MRM3_HUMAN	rRNA methyltransferase 3, mitochondrial OS=Homo sapiens OX=9606 GN=MRM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	74-UNIMOD:28	0.02	17.0	1	1	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	28-UNIMOD:28	0.02	17.0	2	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	0
PRT	sp|Q9H2G2|SLK_HUMAN	STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.01	17.0	1	1	0
PRT	sp|P30837|AL1B1_HUMAN	Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH1B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q9C0B5|ZDHC5_HUMAN	Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q13630|FCL_HUMAN	GDP-L-fucose synthase OS=Homo sapiens OX=9606 GN=TSTA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1	0.03	17.0	1	1	1
PRT	sp|Q9HCM7|FBSL_HUMAN	Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q9NPE2|NGRN_HUMAN	Neugrin OS=Homo sapiens OX=9606 GN=NGRN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q9NP74|PALMD_HUMAN	Palmdelphin OS=Homo sapiens OX=9606 GN=PALMD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	17.0	1	1	1
PRT	sp|O00170|AIP_HUMAN	AH receptor-interacting protein OS=Homo sapiens OX=9606 GN=AIP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|P52756|RBM5_HUMAN	RNA-binding protein 5 OS=Homo sapiens OX=9606 GN=RBM5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.01	17.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	IEELDQENEAALENGIKNEENTEPGAESSENADDPNK	1	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	72.0		ms_run[2]:scan=17432	18.003	3	4041.7683	4041.7683	K	D	720	757
PSM	SGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTAK	2	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	70.0		ms_run[2]:scan=7246	8.1742	3	3584.5735	3584.5735	K	A	173	210
PSM	MESEGGADDSAEEGDLLDDDDNEDRGDDQLELIK	3	sp|P07910-3|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	69.0		ms_run[2]:scan=20260	21.939	3	3709.5181	3709.5181	K	D	171	205
PSM	ASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASK	4	sp|O60936|NOL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	67.0		ms_run[2]:scan=15117	15.562	3	3395.4648	3395.4648	R	E	130	164
PSM	AAEAAAAPAESAAPAAGEEPSKEEGEPK	5	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	66.0		ms_run[2]:scan=6157	7.1355	2	2635.2249	2635.2249	K	K	122	150
PSM	SGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTAK	6	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	66.0		ms_run[2]:scan=7247	8.1749	4	3584.5735	3584.5735	K	A	173	210
PSM	TRDDGDEEGLLTHSEEELEHSQDTDADDGALQ	7	sp|Q9UKM9-2|RALY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	66.0		ms_run[2]:scan=18670	19.499	3	3526.4728	3526.4728	R	-	259	291
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	8	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	64.0	27-UNIMOD:35	ms_run[2]:scan=19965	21.473	3	3772.4337	3772.4337	K	A	469	503
PSM	IEELDQENEAALENGIKNEENTEPGAESSENADDPNK	9	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	64.0		ms_run[2]:scan=17401	17.97	4	4041.7683	4041.7683	K	D	720	757
PSM	SEDADRCTLPEHESPSQDISDACEAESTER	10	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	64.0	7-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=10947	11.527	3	3420.3954	3420.3954	K	C	664	694
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	11	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	62.0	27-UNIMOD:35	ms_run[2]:scan=20289	21.975	3	3772.4337	3772.4337	K	A	469	503
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	12	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	62.0		ms_run[2]:scan=20772	22.907	3	3756.4388	3756.4388	K	A	469	503
PSM	AQETEAAPSQAPADEPEPESAAAQSQENQDTRPK	13	sp|Q9UNF1-2|MAGD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	61.0		ms_run[2]:scan=7354	8.2614	3	3577.6041	3577.6041	K	V	120	154
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	14	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	61.0		ms_run[2]:scan=17155	17.684	3	3657.4246	3657.4246	K	R	176	207
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	15	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	61.0	27-UNIMOD:35	ms_run[2]:scan=20568	22.477	3	3772.4337	3772.4337	K	A	469	503
PSM	GPGASGEQPEPGEAAAGGAAEEAR	16	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	61.0		ms_run[2]:scan=6719	7.6916	2	2164.9621	2164.9621	R	R	50	74
PSM	DTSENADGQSDENKDDYTIPDEYR	17	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	60.0		ms_run[2]:scan=11898	12.389	2	2776.122	2776.1220	K	I	757	781
PSM	MQVDQEEPHVEEQQQQTPAENKAESEEMETSQAGSK	18	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	60.0		ms_run[2]:scan=9240	9.9905	3	4085.7702	4085.7702	K	D	522	558
PSM	RHYEDEEDDEEDAPGNDPQEAVPSAAGK	19	sp|P19447|ERCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	60.0		ms_run[2]:scan=7046	7.9886	3	3069.2708	3069.2708	K	Q	17	45
PSM	ERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAK	20	sp|Q12797|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	60.0		ms_run[1]:scan=15717	16.188218	4	4224.923256	4222.930216	K	E	111	149
PSM	AAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAK	21	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	59.0		ms_run[2]:scan=11659	12.177	4	4445.5536	4445.5536	K	G	177	218
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	22	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	59.0		ms_run[2]:scan=16827	17.331	4	3657.4246	3657.4246	K	R	176	207
PSM	MESEGGADDSAEEGDLLDDDDNEDRGDDQLELIK	23	sp|P07910-3|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	59.0		ms_run[2]:scan=20268	21.947	4	3709.5181	3709.5181	K	D	171	205
PSM	MQVDQEEPHVEEQQQQTPAENK	24	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	59.0	1-UNIMOD:35	ms_run[2]:scan=4814	5.7709	2	2637.1613	2637.1613	K	A	522	544
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAKK	25	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	59.0	1-UNIMOD:1	ms_run[1]:scan=20055	21.636221	3	3391.4731	3391.4694	M	D	2	34
PSM	EASDGTGASQEPPTTDSQEAQSPGHSSAGQEGEDTLR	26	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	59.0		ms_run[1]:scan=6942	7.8986989	3	3715.563086	3713.579707	K	R	142	179
PSM	ERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAK	27	sp|Q12797|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	59.0		ms_run[1]:scan=16207	16.692248	4	4224.923256	4222.930216	K	E	111	149
PSM	DELTDLDQSNVTEETPEGEEHHPVADTENK	28	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58.0		ms_run[2]:scan=13408	13.919	3	3377.4655	3377.4655	K	E	223	253
PSM	EDEKGDDVDDPENQNSALADTDASGGLTK	29	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58.0		ms_run[2]:scan=11458	11.987	3	3005.2858	3005.2858	K	E	1592	1621
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	30	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58.0		ms_run[2]:scan=21062	23.408	3	3756.4388	3756.4388	K	A	469	503
PSM	GGAAPEGPNEAEVTSGKPEQEVPDAEEEK	31	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58.0		ms_run[2]:scan=10146	10.813	4	2950.3316	2950.3316	K	S	215	244
PSM	TAMSTPHVAEPAENEQDEQDENGAEASADLR	32	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58.0	3-UNIMOD:35	ms_run[2]:scan=9736	10.455	3	3327.407	3327.4070	K	A	465	496
PSM	AATEQEPLEGTEQTLDAEEEQEESEEAACGSK	33	sp|Q9ULW3|ABT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	57.0	29-UNIMOD:4	ms_run[2]:scan=17932	18.6	3	3494.4639	3494.4639	K	K	9	41
PSM	GPAESPDEGITTTEGEGECEQTPEELEPVEK	34	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	57.0	19-UNIMOD:4	ms_run[2]:scan=16459	16.939	3	3343.4409	3343.4409	K	Q	887	918
PSM	TRDDGDEEGLLTHSEEELEHSQDTDADDGALQ	35	sp|Q9UKM9-2|RALY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	57.0		ms_run[2]:scan=18823	19.702	4	3526.4728	3526.4728	R	-	259	291
PSM	DLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNK	36	sp|Q6NXS1|IPP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	57.0		ms_run[1]:scan=15842	16.327872	4	4267.658488	4267.667337	K	L	164	202
PSM	AEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPR	37	sp|Q8IYN2|TCAL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56.0		ms_run[2]:scan=13736	14.233	3	3688.6361	3688.6361	K	G	18	52
PSM	AQETEAAPSQAPADEPEPESAAAQSQENQDTRPK	38	sp|Q9UNF1-2|MAGD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56.0		ms_run[2]:scan=7353	8.2606	4	3577.6041	3577.6041	K	V	120	154
PSM	ERDSELSDTDSGCCLGQSESDK	39	sp|Q96T88|UHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56.0	13-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=6055	7.0484	2	2473.9809	2473.9809	K	S	85	107
PSM	KFVEEEDDDEEEEEENLDDQDEQGNLK	40	sp|Q7KZ85-3|SPT6H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56.0		ms_run[2]:scan=11943	12.427	3	3268.3175	3268.3175	K	G	29	56
PSM	TAMSTPHVAEPAENEQDEQDENGAEASADLR	41	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56.0	3-UNIMOD:35	ms_run[2]:scan=9732	10.452	3	3327.407	3327.4070	K	A	465	496
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	42	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	56.0		ms_run[1]:scan=10864	11.453165	3	3369.482550	3368.476411	K	E	312	341
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	43	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0		ms_run[2]:scan=15413	15.864	3	3773.6195	3773.6195	K	A	735	771
PSM	EASDGTGASQEPPTTDSQEAQSPGHSSAGQEGEDTLR	44	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0		ms_run[2]:scan=6956	7.9107	4	3713.5797	3713.5797	K	R	142	179
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	45	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0		ms_run[2]:scan=18000	18.692	3	3657.4246	3657.4246	K	R	176	207
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	46	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0		ms_run[2]:scan=19156	20.208	3	3657.4246	3657.4246	K	R	176	207
PSM	GGAAPEGPNEAEVTSGKPEQEVPDAEEEK	47	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0		ms_run[2]:scan=10295	10.945	3	2950.3316	2950.3316	K	S	215	244
PSM	MQVDQEEPHVEEQQQQTPAENKAESEEMETSQAGSK	48	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0		ms_run[2]:scan=9212	9.9634	4	4085.7702	4085.7702	K	D	522	558
PSM	QVCGDSIKPEETEQEVAADETR	49	sp|Q96GM8-2|TOE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	3-UNIMOD:4	ms_run[2]:scan=10481	11.113	2	2490.118	2490.1180	K	N	289	311
PSM	RHYEDEEDDEEDAPGNDPQEAVPSAAGK	50	sp|P19447|ERCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0		ms_run[2]:scan=7051	7.9924	4	3069.2708	3069.2708	K	Q	17	45
PSM	SEDEPPAASASAAPPPQRDEEEPDGVPEK	51	sp|Q96IZ0|PAWR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0		ms_run[2]:scan=8636	9.4247	3	3001.3425	3001.3425	R	G	108	137
PSM	SGGGTGEEPGSQGLNGEAGPEDSTR	52	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0		ms_run[2]:scan=6585	7.5643	2	2345.0004	2345.0004	K	E	173	198
PSM	NVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVK	53	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	55.0		ms_run[1]:scan=11788	12.292059	4	5277.7191	5277.7115	K	E	231	275
PSM	RQDPGDNWEEGGGGGGGMEK	54	sp|Q9UKY7|CDV3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	55.0		ms_run[1]:scan=5359	6.2539794	2	2032.840131	2031.834081	K	S	117	137
PSM	AAPEEHDSPTEASQPIVEEEETK	55	sp|Q9H0S4|DDX47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	55.0	1-UNIMOD:1	ms_run[1]:scan=13143	13.673918	2	2564.1421	2564.1397	M	T	2	25
PSM	AAEAAAAPAESAAPAAGEEPSKEEGEPK	56	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0		ms_run[2]:scan=6712	7.6845	3	2635.2249	2635.2249	K	K	122	150
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	57	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0		ms_run[2]:scan=18050	18.748	3	3313.3794	3313.3794	K	F	86	114
PSM	GDAEKPEEELEEDDDEELDETLSER	58	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0		ms_run[2]:scan=18194	18.916	3	2920.2105	2920.2105	K	L	23	48
PSM	GGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	59	sp|P08621-2|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0		ms_run[2]:scan=15384	15.836	3	3372.3848	3372.3848	R	G	302	338
PSM	GGTVADLDEQDEETVTAGGKEDEDPAK	60	sp|Q92922|SMRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0		ms_run[2]:scan=11160	11.715	2	2775.2206	2775.2206	K	G	402	429
PSM	HMTLEGEEENGEVHQAREDK	61	sp|P41214|EIF2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0		ms_run[2]:scan=3717	4.7895	3	2337.0292	2337.0292	R	S	217	237
PSM	KAEENASQEEEEAAEDEGGEEDLASELR	62	sp|Q9H4I2|ZHX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0		ms_run[2]:scan=15284	15.738	3	3063.2912	3063.2912	K	V	674	702
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	63	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0		ms_run[2]:scan=12217	12.752	3	4118.4357	4118.4357	K	A	142	177
PSM	KFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	64	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0		ms_run[2]:scan=19656	20.959	3	3884.5338	3884.5338	K	A	468	503
PSM	KWSLEDDDDDEDDPAEAEK	65	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0		ms_run[2]:scan=11485	12.012	2	2220.8819	2220.8819	K	E	197	216
PSM	MQVDQEEPHVEEQQQQTPAENK	66	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0		ms_run[2]:scan=6841	7.8078	2	2621.1664	2621.1664	K	A	522	544
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	67	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0		ms_run[2]:scan=10675	11.285	4	3368.4764	3368.4764	K	E	312	341
PSM	FASDDEHDEHDENGATGPVK	68	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	54.0		ms_run[1]:scan=3285	4.4118618	2	2169.892502	2168.888284	K	R	364	384
PSM	ELQDGAESNGGGGGGGAGSGGGPGAEPDLK	69	sp|O14497|ARI1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	54.0		ms_run[1]:scan=8763	9.5441553	2	2555.104321	2554.116781	K	N	72	102
PSM	AAEAAAAPAESAAPAAGEEPSKEEGEPK	70	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0		ms_run[2]:scan=6151	7.129	4	2635.2249	2635.2249	K	K	122	150
PSM	AAEAAAAPAESAAPAAGEEPSKEEGEPK	71	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0		ms_run[2]:scan=6202	7.1746	3	2635.2249	2635.2249	K	K	122	150
PSM	AAEAAAAPAESAAPAAGEEPSKEEGEPK	72	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0		ms_run[2]:scan=6582	7.562	2	2635.2249	2635.2249	K	K	122	150
PSM	DEGEGAAGAGDHKDPSLGAGEAASK	73	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0		ms_run[2]:scan=3917	4.9733	3	2296.0204	2296.0204	K	E	99	124
PSM	EGDEVGTGITDDNEDENSANQIAGK	74	sp|Q96SY0-4|INT14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0		ms_run[2]:scan=11317	11.855	2	2577.095	2577.0950	K	I	202	227
PSM	EHHPEEGSSGSEVEEIPETPCESQGEELK	75	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	21-UNIMOD:4	ms_run[2]:scan=11167	11.724	4	3235.3735	3235.3735	K	E	652	681
PSM	GEDPFTSETVDPEMEGDDNLGGEDK	76	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0		ms_run[2]:scan=19166	20.221	2	2682.0763	2682.0763	K	K	542	567
PSM	IKEDLEEQEALEDGVACADEK	77	sp|O75691|UTP20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	17-UNIMOD:4	ms_run[2]:scan=14930	15.355	2	2390.0795	2390.0795	K	A	2578	2599
PSM	IKEEPVSEEGEEDEEQEAEEEPMDTSPSGLHSK	78	sp|Q9NVU0-3|RPC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0		ms_run[2]:scan=11273	11.816	3	3699.5741	3699.5741	R	L	497	530
PSM	KFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	79	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0		ms_run[2]:scan=19667	20.974	4	3884.5338	3884.5338	K	A	468	503
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	80	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	53.0		ms_run[1]:scan=15283	15.737233	4	3900.659129	3899.655180	K	G	307	347
PSM	DLGSTEDGDGTDDFLTDKEDEK	81	sp|Q15527|SURF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	53.0		ms_run[1]:scan=14458	14.903798	2	2402.001761	2400.992869	K	A	180	202
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	82	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	53.0		ms_run[1]:scan=11629	12.148217	3	3370.478793	3368.476411	K	E	312	341
PSM	ASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASK	83	sp|O60936|NOL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0		ms_run[2]:scan=15071	15.508	4	3395.4648	3395.4648	R	E	130	164
PSM	EVEEDSEDEEMSEDEEDDSSGEEVVIPQKK	84	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0		ms_run[2]:scan=12474	13.032	4	3440.3944	3440.3944	K	G	23	53
PSM	GGTMTDLDEQEDESMETTGKDEDENSTGNK	85	sp|Q8TAQ2-2|SMRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0		ms_run[2]:scan=10044	10.722	3	3262.2885	3262.2885	K	G	374	404
PSM	GLGEHEMEEDEEDYESSAK	86	sp|Q9UIQ6-3|LCAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0		ms_run[2]:scan=9534	10.275	2	2182.8485	2182.8485	R	L	38	57
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	87	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0		ms_run[2]:scan=12227	12.762	3	4118.4357	4118.4357	K	A	142	177
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	88	sp|P29692-2|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0		ms_run[2]:scan=16763	17.263	3	2908.1894	2908.1894	K	E	510	536
PSM	MQVDQEEPHVEEQQQQTPAENK	89	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	1-UNIMOD:35	ms_run[2]:scan=4797	5.7567	3	2637.1613	2637.1613	K	A	522	544
PSM	MQVDQEEPHVEEQQQQTPAENKAESEEMETSQAGSK	90	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	1-UNIMOD:35	ms_run[2]:scan=7637	8.5346	4	4101.7651	4101.7651	K	D	522	558
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	91	sp|Q14694|UBP10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0		ms_run[2]:scan=11442	11.973	3	3026.2398	3026.2398	K	N	561	587
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	92	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0		ms_run[2]:scan=17481	18.061	4	3574.4874	3574.4874	K	A	737	771
PSM	VGGGGTAGGDRWEGEDEDEDVK	93	sp|O75822-2|EIF3J_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0		ms_run[2]:scan=6187	7.1615	3	2233.936	2233.9360	K	D	28	50
PSM	VRDEAEPGGEGDPGPEPAGTPSPSGEADGDCAPEDAAPSSGGAPR	94	sp|Q8WVT3|TPC12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	31-UNIMOD:4	ms_run[2]:scan=10709	11.316	4	4271.8058	4271.8058	R	Q	88	133
PSM	DELTDLDQSNVTEETPEGEEHHPVADTENK	95	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	52.0		ms_run[1]:scan=13422	13.933752	4	3378.459791	3377.465512	K	E	229	259
PSM	KQEEQEPTGEEPAVLGGDK	96	sp|Q6NS38|ALKB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	52.0		ms_run[1]:scan=7552	8.4522218	2	2040.995579	2039.964744	R	E	16	35
PSM	SDEREVAEAATGEDASSPPPK	97	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	52.0	1-UNIMOD:1	ms_run[1]:scan=10676	11.285328	2	2183.9841	2183.9813	M	T	2	23
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	98	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	52.0		ms_run[1]:scan=12139	12.668595	3	3369.475233	3368.476411	K	E	312	341
PSM	DIREQSETTAEGGQGQAQEGPAQPGEPEAEGSR	99	sp|Q13671|RIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	52.0		ms_run[1]:scan=7426	8.3267596	3	3396.513350	3395.509777	R	A	747	780
PSM	DTDMDGVGDQCDNCPLEHNPDQLDSDSDR	100	sp|P07996-2|TSP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=14219	14.68	3	3319.2572	3319.2572	R	I	738	767
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	101	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=18425	19.197	3	3657.4246	3657.4246	K	R	176	207
PSM	GDAEKPEEELEEDDDEELDETLSER	102	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=18605	19.42	3	2920.2105	2920.2105	K	L	23	48
PSM	GSGSGGSGSDSEPDSPVFEDSK	103	sp|P36956-6|SRBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=8847	9.6162	2	2083.8454	2083.8454	R	T	423	445
PSM	LEDGQTADGQTEEAAEPGEQLQTQK	104	sp|Q96G46-2|DUS3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=9294	10.046	2	2672.2049	2672.2049	R	R	77	102
PSM	RGGPGGGMDVEQQEEEDNDEEAAAGSR	105	sp|Q96GS4|BORC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=6852	7.818	3	2789.1431	2789.1431	R	A	128	155
PSM	RSEGVGTSSSESTHPEGPEEEENPQQSEELLEVSN	106	sp|O75461-2|E2F6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=14714	15.147	3	3783.6467	3783.6467	K	-	172	207
PSM	SMSDPDQDFDKEPDSDSTK	107	sp|Q9Y5S2|MRCKB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=7282	8.2022	2	2142.8535	2142.8535	R	H	1657	1676
PSM	SREQSSEAAETGVSENEENPVR	108	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=5107	6.0275	2	2404.0739	2404.0739	R	I	1182	1204
PSM	SSTSETSLGEERAPDEGGAPVDK	109	sp|Q562E7-3|WDR81_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=7032	7.9762	2	2318.051	2318.0510	K	S	61	84
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAKK	110	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	51.0	1-UNIMOD:1	ms_run[1]:scan=21542	24.452412	4	3391.4698	3391.4694	M	D	2	34
PSM	IEELDQENEAALENGIKNEENTEPGAESSENADDPNK	111	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0		ms_run[1]:scan=14356	14.810279	3	4042.758745	4041.768296	K	D	720	757
PSM	IEELDQENEAALENGIKNEENTEPGAESSENADDPNK	112	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0		ms_run[1]:scan=16504	16.985451	3	4042.755923	4041.768296	K	D	720	757
PSM	ADGGAASQDESSAAAAAAADSR	113	sp|P14859-6|PO2F1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	51.0	1-UNIMOD:1	ms_run[1]:scan=10847	11.438251	2	1990.8489	1990.8459	M	M	2	24
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	114	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	51.0		ms_run[1]:scan=21897	25.203093	4	5140.9065	5140.9086	K	R	36	81
PSM	AAVEDINPADDPNNQGEDEFEEAEQVR	115	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=18202	18.926	3	3000.2857	3000.2857	R	E	543	570
PSM	AQETEAAPSQAPADEPEPESAAAQSQENQDTRPK	116	sp|Q9UNF1-2|MAGD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=7375	8.2809	5	3577.6041	3577.6041	K	V	120	154
PSM	ASNGNARPETVTNDDEEALDEETK	117	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=7995	8.8529	2	2604.1423	2604.1423	K	R	178	202
PSM	EDEEDEEDDDVSHVDEEDCLGVQR	118	sp|O75381-2|PEX14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	19-UNIMOD:4	ms_run[2]:scan=12302	12.846	3	2862.0894	2862.0894	K	E	281	305
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	119	sp|P08621-2|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	10-UNIMOD:35	ms_run[2]:scan=13340	13.856	3	3915.6501	3915.6501	K	G	298	338
PSM	EHHPEEGSSGSEVEEIPETPCESQGEELK	120	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	21-UNIMOD:4	ms_run[2]:scan=11168	11.725	3	3235.3735	3235.3735	K	E	652	681
PSM	ENAPKPQDAAEVSSEQEK	121	sp|Q14865|ARI5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=4285	5.3067	2	1955.9072	1955.9072	K	E	456	474
PSM	FASDDEHDEHDENGATGPVK	122	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=3280	4.4085	3	2168.8883	2168.8883	K	R	364	384
PSM	FVDEEDGGDGQAGPDEGEVDSCLR	123	sp|O15511|ARPC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	22-UNIMOD:4	ms_run[2]:scan=13727	14.226	2	2552.0245	2552.0245	K	Q	24	48
PSM	GADDAADADTAIINAEGGQNNSEEK	124	sp|Q9BY67-5|CADM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=13044	13.578	2	2475.0633	2475.0633	K	K	385	410
PSM	GDAEKPEEELEEDDDEELDETLSER	125	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=18962	19.922	3	2920.2105	2920.2105	K	L	23	48
PSM	GGTVADLDEQDEETVTAGGKEDEDPAK	126	sp|Q92922|SMRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=11481	12.007	3	2775.2206	2775.2206	K	G	402	429
PSM	GSLGSQGAKDEPEEELQK	127	sp|Q13428-2|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=5618	6.6273	2	1900.9014	1900.9014	K	G	1329	1347
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	128	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=11610	12.13	3	3722.1951	3722.1951	K	A	158	190
PSM	MESEGGADDSAEEGDLLDDDDNEDRGDDQLELIK	129	sp|P07910-3|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	1-UNIMOD:35	ms_run[2]:scan=20079	21.663	3	3725.513	3725.5130	K	D	171	205
PSM	SEYSELDEDESQAPYDPNGKPER	130	sp|P19387|RPB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=11286	11.828	2	2654.1256	2654.1256	K	F	206	229
PSM	TCRETEVGDPAGNELAEPEAK	131	sp|Q96G46-2|DUS3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	2-UNIMOD:4	ms_run[2]:scan=8751	9.5331	2	2272.0278	2272.0278	K	R	53	74
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAKK	132	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	50.0	1-UNIMOD:1	ms_run[1]:scan=21601	24.570207	3	3392.4632	3391.4692	M	D	2	34
PSM	SDEREVAEAATGEDASSPPPK	133	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	50.0	1-UNIMOD:1	ms_run[1]:scan=11257	11.802105	2	2183.9841	2183.9813	M	T	2	23
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	134	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	50.0		ms_run[1]:scan=21664	24.69956	4	5140.9065	5140.9086	K	R	36	81
PSM	AAAPAPEEEMDECEQALAAEPK	135	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	13-UNIMOD:4	ms_run[2]:scan=17866	18.524	2	2356.0199	2356.0199	K	A	254	276
PSM	AGPGADNGEEGEIEEEMENPEMVDLPEK	136	sp|Q13330-2|MTA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=21401	24.146	3	3014.2645	3014.2645	K	L	71	99
PSM	DELTDLDQSNVTEETPEGEEHHPVADTENK	137	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=12899	13.431	4	3377.4655	3377.4655	K	E	223	253
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	138	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=13733	14.231	3	3044.152	3044.1520	K	L	595	622
PSM	ENAIEDEEEEEEEDDDEEEDDLEVK	139	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=15931	16.422	3	3024.1375	3024.1375	R	E	35	60
PSM	EPEEINADDEIEDTCDHKEDDLGAVEEQR	140	sp|Q9BXB4|OSB11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	15-UNIMOD:4	ms_run[2]:scan=14435	14.882	4	3399.4168	3399.4168	R	S	339	368
PSM	EQAGGDATENFEDVGHSTDAR	141	sp|P00167-2|CYB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=8555	9.3524	2	2204.9206	2204.9206	R	E	53	74
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	142	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=12613	13.164	3	3624.5459	3624.5459	K	-	158	196
PSM	GEDPFTSETVDPEMEGDDNLGGEDK	143	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=19161	20.216	3	2682.0763	2682.0763	K	K	542	567
PSM	GEDPFTSETVDPEMEGDDNLGGEDKK	144	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	14-UNIMOD:35	ms_run[2]:scan=15198	15.652	3	2826.1662	2826.1662	K	E	542	568
PSM	HSTSPSLDSEYNEELNEDDSQSDEK	145	sp|P35251-2|RFC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=10507	11.136	3	2854.1537	2854.1537	R	D	1084	1109
PSM	KGHEENGDVVTEPQVAEK	146	sp|Q9UG63|ABCF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=4165	5.1994	2	1964.9439	1964.9439	R	N	25	43
PSM	KQEETAVLEEDSADWEK	147	sp|Q96A49|SYAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=13415	13.926	2	2005.9116	2005.9116	K	E	302	319
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	148	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=17469	18.047	3	3574.4874	3574.4874	K	A	737	771
PSM	RPVHGESDTEQLQDDDIETTK	149	sp|Q9BW27-3|NUP85_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=5576	6.5717	3	2412.1041	2412.1041	R	V	565	586
PSM	SGERPVTAGEEDEQVPDSIDAR	150	sp|Q9Y3D0|CIA2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=10297	10.947	2	2356.0779	2356.0779	R	E	23	45
PSM	TRVSDPISTSESSEEEEEAEAETAK	151	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=11440	11.972	3	2710.1941	2710.1941	K	A	76	101
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	152	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=13570	14.074	3	3368.4764	3368.4764	K	E	312	341
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAK	153	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	49.0	1-UNIMOD:1	ms_run[1]:scan=22769	27.149913	3	3264.3712	3263.3742	M	K	2	33
PSM	APETDDSFSDVDCHSNQEDTGCK	154	sp|Q68D20|PMS2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	13-UNIMOD:4,22-UNIMOD:4	ms_run[1]:scan=6913	7.8732323	3	2612.998316	2612.986755	K	F	153	176
PSM	AAAPAPEEEMDECEQALAAEPK	155	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	13-UNIMOD:4	ms_run[2]:scan=17884	18.542	3	2356.0199	2356.0199	K	A	254	276
PSM	AEASATDAGDESATSSIEGGVTDK	156	sp|Q8WY91|THAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=10052	10.728	2	2267.9877	2267.9877	K	S	190	214
PSM	AHEEQDEESQDNLFSSDR	157	sp|Q15058|KIF14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=8119	8.9668	2	2134.8675	2134.8675	K	A	1284	1302
PSM	CGQEEHDVLLSNEEDRK	158	sp|Q9UGI8-2|TES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	1-UNIMOD:4	ms_run[2]:scan=4909	5.855	2	2056.912	2056.9120	K	V	37	54
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	159	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=13751	14.249	4	3044.152	3044.1520	K	L	595	622
PSM	EDEEEDDDVVAPKPPIEPEEEK	160	sp|Q13409-6|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=14005	14.483	2	2537.1181	2537.1181	K	T	144	166
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	161	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=17579	18.186	3	3657.4246	3657.4246	K	R	176	207
PSM	EPVADEEEEDSDDDVEPITEFR	162	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=18767	19.639	2	2564.0562	2564.0562	K	F	92	114
PSM	FRENPDQVEPEDGSDVSPGPNSEDSIEEVK	163	sp|Q96JN0-3|LCOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=13943	14.425	3	3300.4542	3300.4542	K	E	1261	1291
PSM	GDAEKPEEELEEDDDEELDETLSER	164	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=19940	21.433	3	2920.2105	2920.2105	K	L	23	48
PSM	GTMDDISQEEGSSQGEDSVSGSQR	165	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=8656	9.4417	2	2485.0147	2485.0147	K	I	945	969
PSM	HCECSTDEVNSEDMDAYCR	166	sp|P05556-2|ITB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	2-UNIMOD:4,4-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=7715	8.6031	2	2376.8351	2376.8351	R	K	499	518
PSM	HEEQSNEDIPIAEQSSK	167	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=6188	7.1623	2	1939.8759	1939.8759	K	D	218	235
PSM	KVEEVLEEEEEEYVVEK	168	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=17420	17.992	2	2108.0049	2108.0049	K	V	9	26
PSM	SLQDDTEPENGSDISSAENEQTEADQATAAETLSK	169	sp|Q9Y6D6|BIG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=16547	17.036	3	3680.5933	3680.5933	K	N	275	310
PSM	SREDAGDNDDTEGAIGVR	170	sp|Q9H0S4-2|DDX47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=4973	5.9091	2	1875.8195	1875.8195	R	N	375	393
PSM	SSTSETSLGEERAPDEGGAPVDK	171	sp|Q562E7-3|WDR81_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=7033	7.9769	3	2318.051	2318.0510	K	S	61	84
PSM	TECAEPPRDEPPADGALK	172	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	3-UNIMOD:4	ms_run[2]:scan=6763	7.7341	2	1951.8946	1951.8946	R	R	9	27
PSM	TEGDEEAEEEQEENLEASGDYK	173	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=10758	11.359	2	2499.9885	2499.9885	K	Y	10	32
PSM	TPVDESDDEIQHDEIPTGK	174	sp|Q86TC9-2|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=10683	11.292	3	2123.9495	2123.9495	R	C	648	667
PSM	KAEDIENDALSPEEQEECK	175	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	18-UNIMOD:4	ms_run[1]:scan=8820	9.5919748	2	2233.977236	2232.969237	R	N	690	709
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	176	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=14561	15.001236	3	3045.138233	3044.151982	K	L	595	622
PSM	SDEREVAEAATGEDASSPPPK	177	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	48.0	1-UNIMOD:1	ms_run[1]:scan=10696	11.304285	3	2183.9827	2183.9813	M	T	2	23
PSM	AQEEEDVRDYNLTEEQK	178	sp|Q8IWT0|ARCH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	48.0	1-UNIMOD:1	ms_run[1]:scan=13427	13.937612	2	2136.9444	2136.9442	M	A	2	19
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	179	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0		ms_run[1]:scan=7612	8.5137016	3	2984.372895	2981.385017	K	G	56	88
PSM	AAVATTRGDQESAEANK	180	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=2163	3.4892	2	1717.8231	1717.8231	R	F	179	196
PSM	ALSQAAVEEEEEEEEEEEPAQGK	181	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=12378	12.93	2	2559.0984	2559.0984	R	G	947	970
PSM	DDDGGEDDDANCNLICGDEYGPETR	182	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	12-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=15754	16.224	3	2801.0301	2801.0301	K	L	597	622
PSM	DEENHEESESLQEDMLGNR	183	sp|Q8IX12-2|CCAR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=13024	13.559	2	2259.9186	2259.9186	K	L	970	989
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	184	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=13798	14.291	5	3044.152	3044.1520	K	L	595	622
PSM	ELDEHELDYDEEVPEEPAPAVQEDEAEK	185	sp|Q86VM9-2|ZCH18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=17488	18.072	3	3253.3946	3253.3946	R	A	122	150
PSM	EPKDEAQNEGPATESEAPLK	186	sp|Q8N163-2|CCAR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=5929	6.9359	2	2138.9968	2138.9968	K	E	597	617
PSM	ETQTHENMSQLSEEEQNK	187	sp|Q9BWU0|NADAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=4579	5.5695	2	2160.923	2160.9230	K	D	701	719
PSM	GADDAADADTAIINAEGGQNNSEEK	188	sp|Q9BY67-5|CADM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=12990	13.526	3	2475.0633	2475.0633	K	K	385	410
PSM	GDAEKPEEELEEDDDEELDETLSER	189	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=19638	20.93	3	2920.2105	2920.2105	K	L	23	48
PSM	GSVSDCSDGTSELEEPLGEDPR	190	sp|P50548-2|ERF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	6-UNIMOD:4	ms_run[2]:scan=14927	15.353	2	2334.9758	2334.9758	R	A	109	131
PSM	KFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	191	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	28-UNIMOD:35	ms_run[2]:scan=18514	19.306	3	3900.5287	3900.5287	K	A	468	503
PSM	KFVEEEDDDEEEEEENLDDQDEQGNLK	192	sp|Q7KZ85-3|SPT6H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=11971	12.452	4	3268.3175	3268.3175	K	G	29	56
PSM	KIEESETIEDSSNQAAAR	193	sp|Q8N573-2|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=4850	5.8052	2	1976.9287	1976.9287	K	E	625	643
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	194	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=9708	10.429	3	3365.4516	3365.4516	K	K	799	833
PSM	NFDDEDSVDGNRPSSASSTSSK	195	sp|Q7Z460-2|CLAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=4533	5.5299	2	2300.9629	2300.9629	K	A	240	262
PSM	NRPDYVSEEEEDDEDFETAVK	196	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=14404	14.853	2	2515.0511	2515.0511	K	K	2662	2683
PSM	RNAGSSSDGTEDSDFSTDLEHTDSSESDGTSR	197	sp|O95251-3|KAT7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=8638	9.4262	4	3348.337	3348.3370	K	R	6	38
PSM	SEDADRCTLPEHESPSQDISDACEAESTER	198	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	7-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=10913	11.496	4	3420.3954	3420.3954	K	C	664	694
PSM	SGAQQLEEEGPMEEEEAQPMAAPEGK	199	sp|Q9Y6B2|EID1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=15530	15.991	3	2771.1902	2771.1902	R	R	47	73
PSM	SGAQQLEEEGPMEEEEAQPMAAPEGK	200	sp|Q9Y6B2|EID1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=15560	16.024	2	2771.1902	2771.1902	R	R	47	73
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	201	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	27-UNIMOD:35	ms_run[1]:scan=20805	22.977771	3	3773.462477	3772.433739	K	A	469	503
PSM	IEELDQENEAALENGIKNEENTEPGAESSENADDPNK	202	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0		ms_run[1]:scan=16948	17.466052	4	4042.753867	4041.768296	K	D	720	757
PSM	DELTDLDQSNVTEETPEGEEHHPVADTENK	203	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0		ms_run[1]:scan=13950	14.431841	3	3378.458086	3377.465512	K	E	229	259
PSM	SDEREVAEAATGEDASSPPPK	204	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:1	ms_run[1]:scan=11263	11.808526	3	2183.9827	2183.9813	M	T	2	23
PSM	MEANGSQGTSGSANDSQHDPGK	205	sp|Q96DH6|MSI2H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:1	ms_run[1]:scan=3662	4.7324767	2	2215.9039	2215.9031	-	M	1	23
PSM	QSQQEAEEEEREEEEEAQIIQR	206	sp|Q9NQZ2|SAS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:28	ms_run[1]:scan=16621	17.12317	3	2699.1823	2699.1789	R	R	149	171
PSM	AIEDEGGNPDEIEITSEGNK	207	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=13236	13.76	2	2115.9444	2115.9444	K	K	64	84
PSM	ANNPEQNRLSECEEQAK	208	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	12-UNIMOD:4	ms_run[2]:scan=3636	4.707	2	2015.8967	2015.8967	R	A	141	158
PSM	DDDDEEIGGPKEELIPEK	209	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=14197	14.662	2	2026.9219	2026.9219	K	L	629	647
PSM	DLIHDQDEDEEEEEGQR	210	sp|Q9UNZ2-4|NSF1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=7224	8.1539	2	2084.8407	2084.8407	R	F	77	94
PSM	EDEEDEEDDDVSHVDEEDCLGVQREDR	211	sp|O75381-2|PEX14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	19-UNIMOD:4	ms_run[2]:scan=10948	11.528	3	3262.26	3262.2600	K	R	281	308
PSM	EDEGASAAQGQEPEADSQELVQPK	212	sp|O75459|PAGE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=10786	11.384	2	2512.1201	2512.1201	R	T	47	71
PSM	EEVEPEEAEEGISEQPCPADTEVVEDSLR	213	sp|Q9H1E5|TMX4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	17-UNIMOD:4	ms_run[2]:scan=20533	22.412	3	3271.4198	3271.4198	R	Q	310	339
PSM	FVDEEDGGDGQAGPDEGEVDSCLR	214	sp|O15511|ARPC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	22-UNIMOD:4	ms_run[2]:scan=13714	14.213	3	2552.0245	2552.0245	K	Q	24	48
PSM	FVDEEDGGDGQAGPDEGEVDSCLR	215	sp|O15511|ARPC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	22-UNIMOD:4	ms_run[2]:scan=13748	14.246	4	2552.0245	2552.0245	K	Q	24	48
PSM	GDAEKPEEELEEDDDEELDETLSER	216	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=19323	20.425	3	2920.2105	2920.2105	K	L	23	48
PSM	GGMNDDEDFYDEDMGDGGGGSYR	217	sp|Q9UPT8|ZC3H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=15737	16.209	2	2457.8598	2457.8598	K	S	355	378
PSM	HLEPEPEEEIIAEDYDDDPVDYEATR	218	sp|O60828-10|PQBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=20263	21.941	3	3088.3309	3088.3309	K	L	19	45
PSM	KAAAPAPEEEMDECEQALAAEPK	219	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	11-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=9792	10.503	3	2500.1098	2500.1098	K	A	253	276
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	220	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=9703	10.426	3	3365.4516	3365.4516	K	K	799	833
PSM	NETEDQYALMEDEDDLPHHEER	221	sp|O00459|P85B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=13398	13.91	3	2714.1038	2714.1038	K	T	599	621
PSM	QLHQSCQTDDGEDDLK	222	sp|P61201|CSN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:4	ms_run[2]:scan=3158	4.3113	2	1887.7905	1887.7905	R	K	174	190
PSM	RSELSQDAEPAGSQETK	223	sp|Q9BVJ6-2|UT14A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=2941	4.1272	2	1831.8548	1831.8548	K	D	265	282
PSM	TAEPAQPSSASGSGNSDDAIR	224	sp|P39880-4|CUX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=4768	5.7321	2	2016.8985	2016.8985	K	S	585	606
PSM	TAMSTPHVAEPAENEQDEQDENGAEASADLR	225	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	3-UNIMOD:35	ms_run[2]:scan=9738	10.456	4	3327.407	3327.4070	K	A	465	496
PSM	TDICEDEDEGDQAASVEELEK	226	sp|Q9UIF8-4|BAZ2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:4	ms_run[2]:scan=15003	15.429	2	2380.97	2380.9700	K	Q	1133	1154
PSM	VAIQEAEDVDELEDEEEGAETR	227	sp|Q9BRS8-2|LARP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=18370	19.128	2	2475.0773	2475.0773	R	G	20	42
PSM	IEELDQENEAALENGIKNEENTEPGAESSENADDPNK	228	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0		ms_run[1]:scan=16973	17.494019	3	4042.756468	4041.768296	K	D	720	757
PSM	REEGPPPPSPDGASSDAEPEPPSGR	229	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0		ms_run[1]:scan=6943	7.8994571	3	2516.141682	2514.125889	R	T	14	39
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	230	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0		ms_run[1]:scan=21192	23.692532	4	5140.9046	5140.9086	K	R	36	81
PSM	AAAPAPEEEMDECEQALAAEPK	231	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=16253	16.739	3	2372.0148	2372.0148	K	A	254	276
PSM	AATEQEPLEGTEQTLDAEEEQEESEEAACGSK	232	sp|Q9ULW3|ABT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	29-UNIMOD:4	ms_run[2]:scan=17821	18.479	3	3494.4639	3494.4639	K	K	9	41
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	233	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	25-UNIMOD:35	ms_run[2]:scan=9915	10.609	4	3789.6144	3789.6144	K	A	735	771
PSM	ALSDREEEEEDDEEEEEEVEAAAQR	234	sp|Q8N3E9|PLCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=13216	13.741	3	2935.1963	2935.1963	R	R	494	519
PSM	CALEDETYADGAETEVDCNR	235	sp|Q12841-2|FSTL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=13188	13.714	2	2316.9111	2316.9111	K	C	198	218
PSM	DDAVFDDEVAPNAASDNASAEK	236	sp|Q9Y4K1|CRBG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=14625	15.062	2	2249.956	2249.9560	R	K	36	58
PSM	DGEDQTQDTELVETRPAGDR	237	sp|P01889|HLAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=8345	9.1683	2	2230.9938	2230.9938	R	T	244	264
PSM	DLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNK	238	sp|Q6NXS1|IPP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	20-UNIMOD:35	ms_run[2]:scan=14117	14.589	4	4283.6623	4283.6623	K	L	164	202
PSM	DRNENEVESTSSANEDMPVER	239	sp|P19793-2|RXRA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=7832	8.7066	2	2407.0194	2407.0194	K	I	117	138
PSM	DSGSDEDFLMEDDDDSDYGSSK	240	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=17403	17.973	2	2427.8656	2427.8656	K	K	89	111
PSM	EAELESPEVMPEEEDEDDEDGGEEAPAPGGAGK	241	sp|Q8IX01|SUGP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=16457	16.938	3	3413.3736	3413.3736	R	S	882	915
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	242	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=19504	20.713	3	3657.4246	3657.4246	K	R	176	207
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	243	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=19821	21.215	3	3657.4246	3657.4246	K	R	176	207
PSM	EGDGEEEEEEEVEEEEQEAQGGVSGSLK	244	sp|Q9ULD4|BRPF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=18524	19.321	3	3036.2327	3036.2327	K	G	415	443
PSM	EGDVEEPTDDSLPTTGDAGGREPMEEK	245	sp|Q9UKN8|TF3C4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=12184	12.719	3	2860.2193	2860.2193	K	L	642	669
PSM	EGQEENETCSGGNENQELQDGCSEAFEK	246	sp|Q7Z2Z2-2|EFL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	9-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=10665	11.275	3	3174.2262	3174.2262	K	R	862	890
PSM	EHGQCADVDECSLAEK	247	sp|Q6UXH1-4|CREL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	5-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=4813	5.7701	2	1846.7462	1846.7462	R	T	256	272
PSM	ELDEHELDYDEEVPEEPAPAVQEDEAEK	248	sp|Q86VM9-2|ZCH18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=17495	18.081	4	3253.3946	3253.3946	R	A	122	150
PSM	ELGPDGEEAEGPGAGDGPPR	249	sp|P18615-3|NELFE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=8900	9.6658	2	1905.8341	1905.8341	R	S	152	172
PSM	EPSQDTVATEPSEVEGSAANK	250	sp|Q96RU2|UBP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=8469	9.2792	2	2144.971	2144.9710	K	E	65	86
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	251	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	27-UNIMOD:35	ms_run[2]:scan=20073	21.654	4	3772.4337	3772.4337	K	A	469	503
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	252	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	27-UNIMOD:35	ms_run[2]:scan=20385	22.159	4	3772.4337	3772.4337	K	A	469	503
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	253	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=12625	13.175	4	3624.5459	3624.5459	K	-	158	196
PSM	GDAEKPEEELEEDDDEELDETLSER	254	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=17762	18.41	3	2920.2105	2920.2105	K	L	23	48
PSM	GPSAAGEQEPDKESGASVDEVAR	255	sp|P50579|MAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=5883	6.8908	3	2285.0408	2285.0408	K	Q	47	70
PSM	HHESSSVDTEPGLEESK	256	sp|Q8N157-3|AHI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=3329	4.447	2	1866.8232	1866.8232	R	E	566	583
PSM	KWSLEDDDDDEDDPAEAEK	257	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=11463	11.991	3	2220.8819	2220.8819	K	E	197	216
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	258	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=11052	11.62	3	3722.1951	3722.1951	K	A	158	190
PSM	LNQSGTSVGTDEESDVTQEEER	259	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=8383	9.2025	2	2409.0415	2409.0415	K	D	2284	2306
PSM	LPLPDDREDGELEEGELEDDGAEETQDTSGGPER	260	sp|Q9UPT8|ZC3H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=18107	18.812	3	3698.5827	3698.5827	R	S	48	82
PSM	MDTIQEDPSTDSHMDEDGFEK	261	sp|P78536|ADA17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=12299	12.844	2	2425.9526	2425.9526	R	D	759	780
PSM	MESEGGADDSAEEGDLLDDDDNEDRGDDQLELIK	262	sp|P07910-3|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:35	ms_run[2]:scan=19890	21.336	4	3725.513	3725.5130	K	D	171	205
PSM	NAYNQGLECDHGDDEGGDDGVSPK	263	sp|Q14571|ITPR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	9-UNIMOD:4	ms_run[2]:scan=6741	7.7137	3	2548.0045	2548.0045	K	D	2079	2103
PSM	PKIEDVGSDEEDDSGK	264	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=4320	5.3371	2	1718.7483	1718.7483	K	D	248	264
PSM	QQAGAQGPGSADLEDGEMGK	265	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=8533	9.3343	2	1944.8483	1944.8483	R	R	1064	1084
PSM	QSQQEAEEEEREEEEEAQIIQR	266	sp|Q9NQZ2|SAS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=12795	13.336	3	2716.206	2716.2060	R	R	149	171
PSM	RSEEEEAPPDGAVAEYR	267	sp|Q6UX04-2|CWC27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=7075	8.016	2	1903.8548	1903.8548	K	R	345	362
PSM	SEDDESGAGELTREELR	268	sp|P33993-2|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=9451	10.199	2	1891.8395	1891.8395	K	Q	309	326
PSM	SEGEGEAASADDGSLNTSGAGPK	269	sp|Q9NWV8-3|BABA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=5822	6.8183	2	2105.8985	2105.8985	R	S	49	72
PSM	SRDSLAPGPEPQDEDQK	270	sp|O15013-7|ARHGA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=4571	5.5635	2	1867.8548	1867.8548	K	D	1166	1183
PSM	SVSSDSHQDDEISSMEQSTEDSMQDDTKPK	271	sp|Q8N157-3|AHI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=13712	14.211	4	3342.3624	3342.3624	R	P	271	301
PSM	VGGGGTAGGDRWEGEDEDEDVK	272	sp|O75822-2|EIF3J_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=6697	7.6694	3	2233.936	2233.9360	K	D	28	50
PSM	VPGPAEGPAEPAAEASDEAER	273	sp|Q24JP5-4|T132A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=9759	10.474	2	2048.9287	2048.9287	R	R	265	286
PSM	VRQGQGQSEPGEYEQR	274	sp|P43121|MUC18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=2299	3.5966	2	1846.8558	1846.8558	R	L	76	92
PSM	VSALEEDMDDVESSEEEEEEDEK	275	sp|Q8NAV1|PR38A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=18993	19.965	2	2671.0338	2671.0338	R	L	181	204
PSM	KDDENIPMETEETHLEETTESQQNGEEGTSTPEDK	276	sp|Q969G3|SMCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0		ms_run[1]:scan=13804	14.297186	4	3977.669778	3976.676369	K	E	333	368
PSM	ETVEEGVEHDPGMPASK	277	sp|Q96L73|NSD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0		ms_run[1]:scan=7253	8.1794428	2	1811.810908	1810.804344	K	K	1513	1530
PSM	QVCGDSIKPEETEQEVAADETR	278	sp|Q96GM8|TOE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:28,3-UNIMOD:4	ms_run[1]:scan=14952	15.378029	2	2473.0937	2473.0910	K	N	369	391
PSM	AAAPAPEEEMDECEQALAAEPK	279	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=16745	17.242	3	2372.0148	2372.0148	K	A	254	276
PSM	AATEQEPLEGTEQTLDAEEEQEESEEAACGSKK	280	sp|Q9ULW3|ABT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	29-UNIMOD:4	ms_run[2]:scan=16281	16.765	3	3622.5588	3622.5588	K	R	9	42
PSM	ADNNIDANEETLETDDTTICSDRPPENEK	281	sp|Q6VMQ6|MCAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	20-UNIMOD:4	ms_run[2]:scan=13476	13.985	3	3305.4114	3305.4114	K	K	341	370
PSM	ADVLEAHEAEAEEPEAGKSEAEDDEDEVDDLPSSR	282	sp|Q8IVT5-4|KSR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=14230	14.695	4	3782.6039	3782.6039	K	R	414	449
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	283	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	25-UNIMOD:35	ms_run[2]:scan=9882	10.581	3	3789.6144	3789.6144	K	A	735	771
PSM	ALEPEAEAEAEAGAGGEAAAEEGAAGRK	284	sp|Q96CK0|ZN653_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=13483	13.992	3	2611.1998	2611.1998	R	A	5	33
PSM	DSSESQLASTESDKPTTGR	285	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=4510	5.5092	2	1994.9029	1994.9029	R	V	65	84
PSM	DSSHNSTNSEFAAEAEGQNDTIEEPNK	286	sp|Q93075|TATD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=11055	11.622	3	2920.2231	2920.2231	K	V	143	170
PSM	DTDMDGVGDQCDNCPLEHNPDQLDSDSDR	287	sp|P07996-2|TSP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=14319	14.776	4	3319.2572	3319.2572	R	I	738	767
PSM	DTSENADGQSDENKDDYTIPDEYR	288	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=11872	12.365	3	2776.122	2776.1220	K	I	757	781
PSM	DVTEAEQAEEQARQEEQVVR	289	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=14133	14.603	2	2343.0939	2343.0939	K	Q	634	654
PSM	ECEEEAINIQSTAPEEEHESPR	290	sp|P46939-2|UTRO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	2-UNIMOD:4	ms_run[2]:scan=10944	11.525	3	2583.1031	2583.1031	K	A	281	303
PSM	EDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	291	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=14247	14.71	3	3990.3407	3990.3407	K	A	143	177
PSM	EEIPEEELAEDVEEIDHAER	292	sp|P20020-5|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=22377	26.314	2	2380.0554	2380.0554	K	E	1079	1099
PSM	ENGASESGDPLDEDDVDTVVDEQPK	293	sp|Q96JN0-3|LCOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=17714	18.357	3	2659.1257	2659.1257	K	F	1073	1098
PSM	EVEEDSEDEEMSEDEEDDSSGEEVVIPQKK	294	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:35	ms_run[2]:scan=10285	10.936	3	3456.3894	3456.3894	K	G	23	53
PSM	GDAEKPEEELEEDDDEELDETLSER	295	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=20261	21.939	3	2920.2105	2920.2105	K	L	23	48
PSM	GEDPFTSETVDPEMEGDDNLGGEDKK	296	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=17181	17.711	3	2810.1712	2810.1712	K	E	542	568
PSM	GGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	297	sp|P08621-2|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=15400	15.85	4	3372.3848	3372.3848	R	G	302	338
PSM	GHEENGDVVTEPQVAEK	298	sp|Q9UG63|ABCF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=5751	6.7456	2	1836.849	1836.8490	K	N	26	43
PSM	GQEADLEAGGEEVPEANGSAGK	299	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=9804	10.512	2	2113.94	2113.9400	K	R	226	248
PSM	HLYECTEEENDNSLEK	300	sp|Q9NXC5-2|MIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	5-UNIMOD:4	ms_run[2]:scan=5850	6.8481	2	2008.832	2008.8320	R	D	373	389
PSM	IEELDQENEAALENGIKNEENTEPGAESSENADDPNK	301	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=17386	17.951	5	4041.7683	4041.7683	K	D	720	757
PSM	KDDENIPMETEETHLEETTESQQNGEEGTSTPEDK	302	sp|Q969G3-3|SMCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	8-UNIMOD:35	ms_run[2]:scan=10060	10.736	4	3992.6713	3992.6713	K	E	263	298
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	303	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=12229	12.763	4	4118.4357	4118.4357	K	A	142	177
PSM	KIDDPIDEEEEFEELK	304	sp|Q8WWQ0|PHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=19172	20.228	2	1976.9102	1976.9102	K	G	1745	1761
PSM	KLETEETVPETDVETK	305	sp|Q03701|CEBPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=8069	8.9222	2	1846.9048	1846.9048	K	K	659	675
PSM	KVEEVLEEEEEEYVVEK	306	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=19169	20.226	2	2108.0049	2108.0049	K	V	9	26
PSM	NETEDQYALMEDEDDLPHHEER	307	sp|O00459|P85B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=13394	13.907	4	2714.1038	2714.1038	K	T	599	621
PSM	PATPAEDDEDDDIDLFGSDNEEEDK	308	sp|P29692-2|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=19162	20.216	3	2780.0944	2780.0944	K	E	511	536
PSM	QGTTETIEEVEAEQEEEAGSTAPEPR	309	sp|Q9H5I5-2|PIEZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=17119	17.643	3	2816.2472	2816.2472	R	E	1762	1788
PSM	RAEPHTPSSHDAEEDEPLK	310	sp|Q8NB46|ANR52_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=3418	4.5174	3	2143.977	2143.9770	R	E	504	523
PSM	SPDGDGVGNSYIEDNDDDSK	311	sp|Q9UK97-3|FBX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=8776	9.5537	2	2097.8247	2097.8247	R	M	92	112
PSM	SREQSSEAAETGVSENEENPVR	312	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=5065	5.9907	3	2404.0739	2404.0739	R	I	1182	1204
PSM	SSDDTTDAQMDEQDLNEPLAK	313	sp|Q14BN4-2|SLMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=13954	14.435	2	2321.9805	2321.9805	K	V	420	441
PSM	STEDAVDYSDINEVAEDESR	314	sp|P21675-10|TAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=17049	17.575	2	2242.935	2242.9350	R	R	103	123
PSM	STSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAK	315	sp|Q12797-9|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=17433	18.004	4	3937.7865	3937.7865	R	E	99	135
PSM	QHCTEEDEEEDEEEEEESFMTSR	316	sp|Q9NY27|PP4R2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,3-UNIMOD:4	ms_run[1]:scan=16042	16.535667	3	2887.0262	2886.0232	R	E	294	317
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAKK	317	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:1	ms_run[1]:scan=20564	22.47164	3	3391.4775	3391.4694	M	D	2	34
PSM	KGQEADLEAGGEEVPEANGSAGK	318	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=7957	8.8171723	2	2243.022199	2242.034949	K	R	225	248
PSM	SGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTAK	319	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=7910	8.7760533	3	3585.561707	3584.573499	K	A	173	210
PSM	EEQPPVPSSPTEEEEEEEEEEEEEAEEEEEEEDSEVQGEQPKPASPAEEDK	320	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0		ms_run[1]:scan=18010	18.702511	5	5840.3582	5840.3518	K	M	302	353
PSM	EEQPPVPSSPTEEEEEEEEEEEEEAEEEEEEEDSEVQGEQPK	321	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=18655	19.481575	4	4915.940220	4915.933427	K	P	302	344
PSM	AAAPAPEEEMDECEQALAAEPK	322	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	13-UNIMOD:4	ms_run[1]:scan=18297	19.044834	3	2357.015731	2356.019893	K	A	254	276
PSM	DELTDLDQSNVTEETPEGEEHHPVADTENK	323	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=13967	14.446599	4	3378.459614	3377.465512	K	E	229	259
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	324	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=10982	11.557568	3	3369.482550	3368.476411	K	E	312	341
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	325	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=11358	11.895917	4	3368.478945	3368.476411	K	E	312	341
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	326	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=12172	12.70562	3	3370.475857	3368.476411	K	E	312	341
PSM	ELDAISTNEEEKEENEAESDVK	327	sp|P49642|PRI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=12182	12.715341	2	2508.108373	2507.103482	R	H	356	378
PSM	ERDSELSDTDSGCCLGQSESDK	328	sp|Q96T88|UHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	13-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=6071	7.061861	3	2475.982696	2473.980941	K	S	85	107
PSM	AAAPAPEEEMDECEQALAAEPK	329	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=12775	13.317	2	2372.0148	2372.0148	K	A	254	276
PSM	AAAPAPEEEMDECEQALAAEPK	330	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	13-UNIMOD:4	ms_run[2]:scan=17447	18.017	2	2356.0199	2356.0199	K	A	254	276
PSM	AAPTAASDQPDSAATTEK	331	sp|Q9BRP8-2|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=3422	4.5201	2	1730.7959	1730.7959	R	A	132	150
PSM	AATEQEPLEGTEQTLDAEEEQEESEEAACGSKK	332	sp|Q9ULW3|ABT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	29-UNIMOD:4	ms_run[2]:scan=16298	16.781	3	3622.5588	3622.5588	K	R	9	42
PSM	AGEAEESSAVCQVDAEQR	333	sp|Q8N3D4|EH1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:4	ms_run[2]:scan=7227	8.1562	2	1934.8276	1934.8276	R	S	412	430
PSM	ATEMVEVGADDDEGGAERGEAGDLR	334	sp|Q6NZI2|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=12251	12.793	3	2548.0984	2548.0984	K	R	338	363
PSM	CDGERDCPDGSDEAPEICPQSK	335	sp|Q07954|LRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:4,7-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=7068	8.0088	2	2520.9792	2520.9792	R	A	47	69
PSM	DGAVEDEEGEGEDGEERDPETEEPLWASR	336	sp|Q9Y2U8|MAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=16078	16.57	3	3231.3236	3231.3236	K	T	214	243
PSM	DLGHPVEEEDELESGDQEDEDDESEDPGK	337	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=12581	13.136	3	3242.2655	3242.2655	K	D	929	958
PSM	DLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNK	338	sp|Q6NXS1|IPP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:35	ms_run[2]:scan=11818	12.317	4	4283.6623	4283.6623	K	L	164	202
PSM	DSGSDEDFLMEDDDDSDYGSSK	339	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:35	ms_run[2]:scan=14752	15.182	2	2443.8605	2443.8605	K	K	89	111
PSM	DTDMDGVGDQCDNCPLEHNPDQLDSDSDR	340	sp|P07996-2|TSP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:35,11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=12162	12.696	3	3335.2521	3335.2521	R	I	738	767
PSM	EAEESLQQQQQEQEEALK	341	sp|Q4V328|GRAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8853	9.6208	2	2143.9869	2143.9869	K	Q	531	549
PSM	EDEEDEEDDDVSHVDEEDCLGVQREDR	342	sp|O75381-2|PEX14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	19-UNIMOD:4	ms_run[2]:scan=10912	11.495	4	3262.26	3262.2600	K	R	281	308
PSM	EDEEEDDDVVAPKPPIEPEEEK	343	sp|Q13409-6|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=14023	14.501	3	2537.1181	2537.1181	K	T	144	166
PSM	EDEGASAAQGQEPEADSQELVQPK	344	sp|O75459|PAGE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=10789	11.386	3	2512.1201	2512.1201	R	T	47	71
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLR	345	sp|Q9BTT0-3|AN32E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=18042	18.74	3	3343.2655	3343.2655	K	G	176	204
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	346	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=17289	17.84	4	3657.4246	3657.4246	K	R	176	207
PSM	EGQGEGETQEAAAATAAAR	347	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6213	7.1824	2	1816.8187	1816.8187	R	R	3681	3700
PSM	EPSEEPLPMETEEEDPKEEPIK	348	sp|O14776-2|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=14940	15.367	2	2581.1629	2581.1629	K	E	458	480
PSM	EQVMEVEEDPQTITTEETMEEDK	349	sp|Q8TEY7|UBP33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=18174	18.887	2	2739.1627	2739.1627	K	S	289	312
PSM	FVDEEDGGDGQAGPDEGEVDSCLR	350	sp|O15511|ARPC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	22-UNIMOD:4	ms_run[2]:scan=14274	14.736	2	2552.0245	2552.0245	K	Q	24	48
PSM	FVEEEDDDEEEEEENLDDQDEQGNLK	351	sp|Q7KZ85-3|SPT6H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=13543	14.049	3	3140.2225	3140.2225	K	G	30	56
PSM	GLAEVQQDGEAEEGATSDGEK	352	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8728	9.5118	2	2118.9189	2118.9189	K	K	477	498
PSM	GPGASGEQPEPGEAAAGGAAEEAR	353	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6726	7.7007	3	2164.9621	2164.9621	R	R	50	74
PSM	IYYSEETSSDQGNEDEEEPK	354	sp|P19174|PLCG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=7308	8.2245	2	2347.9452	2347.9452	K	E	517	537
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	355	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=12322	12.87	4	4118.4357	4118.4357	K	A	142	177
PSM	KQEEQEPTGEEPAVLGGDK	356	sp|Q6NS38-2|ALKB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=7563	8.4624	3	2039.9647	2039.9647	R	E	16	35
PSM	KQEETAVLEEDSADWEK	357	sp|Q96A49|SYAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=13952	14.433	2	2005.9116	2005.9116	K	E	302	319
PSM	KTDICEDEDEGDQAASVEELEK	358	sp|Q9UIF8-4|BAZ2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:4	ms_run[2]:scan=12294	12.838	3	2509.065	2509.0650	K	Q	1132	1154
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	359	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=11446	11.976	4	3722.1951	3722.1951	K	A	158	190
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	360	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=11465	11.993	4	3722.1951	3722.1951	K	A	158	190
PSM	LASAEDSAPADKDEDEGEPPAQAPVAK	361	sp|Q5T0F9-3|C2D1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=7516	8.4177	3	2707.2461	2707.2461	K	K	163	190
PSM	LPPNTNDEVDEDPTGNK	362	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=7154	8.0908	2	1853.8279	1853.8279	R	A	1058	1075
PSM	LWGDDDEEEDEEEEDNKTEETGPGMDEEDSELVAK	363	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=17632	18.257	3	4012.5811	4012.5811	R	D	4778	4813
PSM	MQVDQEEPHVEEQQQQTPAENK	364	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=7040	7.9821	3	2621.1664	2621.1664	K	A	522	544
PSM	NYAGEEEEEGSGSSEGFDPPATDR	365	sp|P16989-3|YBOX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=11019	11.59	2	2529.0052	2529.0052	R	Q	191	215
PSM	SGGAATVEEAPSEFEEEASR	366	sp|Q8TF64|GIPC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=15790	16.262	2	2051.892	2051.8920	R	K	226	246
PSM	SNDSEEGLEDAVEGADEALQK	367	sp|Q9NUJ3|T11L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=20970	23.229	2	2204.9557	2204.9557	K	A	18	39
PSM	SSESSCGVDGDYEDAELNPR	368	sp|P11274-2|BCR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:4	ms_run[2]:scan=11365	11.903	2	2185.8706	2185.8706	R	F	235	255
PSM	TEEDETSEDANCLALSGHDK	369	sp|P51003|PAPOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	12-UNIMOD:4	ms_run[2]:scan=8180	9.0201	3	2219.9124	2219.9125	K	T	666	686
PSM	THVNPMDEEENEVNHVNGEQENR	370	sp|Q8TAF3-5|WDR48_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=7913	8.7783	3	2719.1528	2719.1528	R	V	202	225
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	371	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	25-UNIMOD:35	ms_run[1]:scan=10465	11.098603	3	3789.606040	3789.614378	K	A	735	771
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	372	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=17929	18.597378	3	3575.472423	3574.487386	K	A	737	771
PSM	ASNGNARPETVTNDDEEALDEETK	373	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=7953	8.8141201	2	2604.144426	2604.142327	K	R	178	202
PSM	MEVAEPSSPTEEEEEEEEHSAEPRPR	374	sp|Q9NWV8|BABA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:1	ms_run[1]:scan=13300	13.820325	3	3051.2888	3051.2882	-	T	1	27
PSM	DLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNK	375	sp|Q6NXS1|IPP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	20-UNIMOD:35	ms_run[1]:scan=15835	16.31562	4	4284.680246	4283.662252	K	L	164	202
PSM	CHAEHTPEEEIDHTGAK	376	sp|O95757|HS74L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=4261	5.2869581	2	1942.8126	1942.8110	K	T	540	557
PSM	ADGGAASQDESSAAAAAAADSR	377	sp|P14859-6|PO2F1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:1	ms_run[1]:scan=10833	11.4256	3	1990.8465	1990.8459	M	M	2	24
PSM	CGQEEHDVLLSNEEDRK	378	sp|Q9UGI8|TES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=10053	10.728788	2	2039.8852	2039.8849	K	V	46	63
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	379	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0		ms_run[1]:scan=22113	25.707562	4	5140.9065	5140.9086	K	R	36	81
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	380	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0		ms_run[1]:scan=21425	24.196482	4	5140.9021	5140.9086	K	R	36	81
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	381	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0		ms_run[1]:scan=22552	26.714086	4	5140.9065	5140.9086	K	R	36	81
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	382	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0		ms_run[1]:scan=22322	26.212054	4	5140.9065	5140.9086	K	R	36	81
PSM	AAAPAPEEEMDECEQALAAEPK	383	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	13-UNIMOD:4	ms_run[2]:scan=13772	14.267	2	2356.0199	2356.0199	K	A	254	276
PSM	AAAPAPEEEMDECEQALAAEPK	384	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	13-UNIMOD:4	ms_run[2]:scan=18287	19.032	2	2356.0199	2356.0199	K	A	254	276
PSM	AAAPAPEEEMDECEQALAAEPK	385	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	13-UNIMOD:4	ms_run[2]:scan=17459	18.031	3	2356.0199	2356.0199	K	A	254	276
PSM	AAEAAAAPAESAAPAAGEEPSKEEGEPK	386	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=6897	7.8574	3	2635.2249	2635.2249	K	K	122	150
PSM	AAELTATQVEEEEEEEDFRK	387	sp|O75717-2|WDHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=13957	14.437	2	2352.0605	2352.0605	K	K	697	717
PSM	AIEDEGGNPDEIEITSEGNK	388	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=13249	13.772	3	2115.9444	2115.9444	K	K	64	84
PSM	ATEMVEVGADDDEGGAERGEAGDLR	389	sp|Q6NZI2|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=11786	12.291	3	2548.0984	2548.0984	K	R	338	363
PSM	CHAEHTPEEEIDHTGAK	390	sp|O95757|HS74L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:4	ms_run[2]:scan=2571	3.8133	3	1959.8381	1959.8381	K	T	540	557
PSM	DEDEENDASLANSSTTTLEDK	391	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=11875	12.367	2	2282.951	2282.9510	K	G	986	1007
PSM	DETDESSKEETEPQVLK	392	sp|Q9BV44|THUM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=6855	7.8203	2	1962.8906	1962.8906	K	F	210	227
PSM	DRNENEVESTSSANEDMPVER	393	sp|P19793-2|RXRA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=7806	8.6853	3	2407.0194	2407.0194	K	I	117	138
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	394	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=16797	17.295	4	3657.4246	3657.4246	K	R	176	207
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	395	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=18824	19.703	3	3657.4246	3657.4246	K	R	176	207
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	396	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=20119	21.717	3	3657.4246	3657.4246	K	R	176	207
PSM	ELGGLEGDPSPEEDEGIQK	397	sp|Q9BT09|CNPY3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=13591	14.094	2	1997.9066	1997.9066	K	A	248	267
PSM	ELLQESQEEEEEEEEEMPSK	398	sp|Q8IVL6-2|P3H3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=14272	14.732	2	2450.0166	2450.0166	K	D	504	524
PSM	EPEIEVPLDDEDEEGENEEGKPK	399	sp|Q15542-2|TAF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=15568	16.035	3	2625.1453	2625.1453	K	K	379	402
PSM	EVEEDSEDEEMSEDEEDDSSGEEVVIPQKK	400	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:35	ms_run[2]:scan=10308	10.957	4	3456.3894	3456.3894	K	G	23	53
PSM	FEDEGAGFEESSETGDYEEK	401	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=12337	12.887	2	2253.871	2253.8710	K	A	926	946
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	402	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=20797	22.962	5	3756.4388	3756.4388	K	A	469	503
PSM	GDAEKPEEELEEDDDEELDETLSER	403	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=17111	17.634	3	2920.2105	2920.2105	K	L	23	48
PSM	GDVEEDETIPDSEQDIRPR	404	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=11480	12.006	2	2198.9927	2198.9927	K	F	278	297
PSM	GGAAPEGPNEAEVTSGKPEQEVPDAEEEK	405	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9718	10.439	3	2950.3316	2950.3316	K	S	215	244
PSM	GLAEVQQDGEAEEGATSDGEK	406	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8163	9.0055	2	2118.9189	2118.9189	K	K	477	498
PSM	ILEQEEEEEQAGKPGEPSK	407	sp|Q9BXP5-5|SRRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=5612	6.6147	2	2126.0015	2126.0015	R	K	231	250
PSM	KAIEDEGGNPDEIEITSEGNK	408	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10243	10.898	3	2244.0394	2244.0394	K	K	63	84
PSM	KGQEADLEAGGEEVPEANGSAGK	409	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=7327	8.2399	3	2242.0349	2242.0349	K	R	225	248
PSM	LAEGEEEKPEPDISSEESVSTVEEQENETPPATSSEAEQPK	410	sp|Q5SSJ5-5|HP1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=14685	15.119	5	4441.978	4441.9780	K	G	57	98
PSM	MNEAAEEDRQLNNQK	411	sp|Q96ST2-2|IWS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=2964	4.1445	2	1788.8061	1788.8061	K	K	242	257
PSM	RLEEGTEETSETLEK	412	sp|Q08378-4|GOGA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=4947	5.8884	2	1749.8269	1749.8269	R	L	798	813
PSM	RLSEGQEEENLENEMK	413	sp|Q15276-2|RABE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10417	11.056	2	1933.8687	1933.8687	R	K	160	176
PSM	SEDEDSLEEAGSPAPGPCPR	414	sp|Q8TBB5-2|KLDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:4	ms_run[2]:scan=10310	10.958	2	2098.8749	2098.8749	R	S	356	376
PSM	SEPELTTVAEVDESNGEEK	415	sp|Q9HAU0-8|PKHA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=14436	14.883	2	2061.9226	2061.9226	K	S	791	810
PSM	SEQDQAENEGEDSAVLMER	416	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:35	ms_run[2]:scan=8734	9.5183	2	2151.8862	2151.8862	K	L	522	541
PSM	SEYSELDEDESQAPYDPNGKPER	417	sp|P19387|RPB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=11265	11.81	3	2654.1256	2654.1256	K	F	206	229
PSM	SGGAATVEEAPSEFEEEASRK	418	sp|Q8TF64|GIPC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=13924	14.408	2	2179.9869	2179.9869	R	V	226	247
PSM	TECAEPPRDEPPADGALK	419	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:4	ms_run[2]:scan=6266	7.2296	2	1951.8946	1951.8946	R	R	9	27
PSM	TPDSFEESQGEEIGK	420	sp|Q5VZK9-2|CARL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9156	9.9047	2	1651.7213	1651.7213	K	V	1128	1143
PSM	VQPPPETPAEEEMETETEAEALQEK	421	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=19629	20.912	3	2811.2644	2811.2644	K	E	1076	1101
PSM	YQGDGIVEDEEETMENNEEK	422	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:35	ms_run[2]:scan=9868	10.568	2	2372.9438	2372.9438	K	K	841	861
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	423	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28	ms_run[1]:scan=19527	20.74072	4	3557.4620	3557.4603	K	A	737	771
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	424	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:27	ms_run[1]:scan=10811	11.405074	3	2964.3652	2963.3742	K	G	56	88
PSM	MEVAEPSSPTEEEEEEEEHSAEPRPR	425	sp|Q9NWV8|BABA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:1	ms_run[1]:scan=13306	13.824868	4	3051.2913	3051.2882	-	T	1	27
PSM	MEVAEPSSPTEEEEEEEEHSAEPRPR	426	sp|Q9NWV8|BABA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:1	ms_run[1]:scan=13314	13.832864	4	3051.2913	3051.2882	-	T	1	27
PSM	VEEEPEEEPEETAEDTTEDTEQDEDEEMDVGTDEEEETAK	427	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=16400	16.88047	4	4615.761007	4615.757043	K	E	755	795
PSM	KPEYDLEEDDQEVLK	428	sp|Q13416|ORC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=12860	13.3951	2	1848.867932	1848.862904	K	D	52	67
PSM	RPVHGESDTEQLQDDDIETTK	429	sp|Q9BW27|NUP85_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=5596	6.5955317	2	2413.106297	2412.104091	R	V	611	632
PSM	MESEGGADDSAEEGDLLDDDDNEDRGDDQLELIK	430	sp|P07910|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	1-UNIMOD:35	ms_run[1]:scan=20196	21.842562	4	3726.536260	3725.512992	K	D	251	285
PSM	QADIGNLDDFEEDNEDDDENRVNQEEK	431	sp|Q8NDI1|EHBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=15713	16.183209	3	3194.296095	3194.303197	K	A	180	207
PSM	AAAPAPEEEMDECEQALAAEPK	432	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:4	ms_run[2]:scan=13769	14.264	3	2356.0199	2356.0199	K	A	254	276
PSM	AEEATEAQEVVEATPEGACTEPR	433	sp|O75683|SURF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	19-UNIMOD:4	ms_run[2]:scan=14204	14.667	3	2473.0915	2473.0915	K	E	171	194
PSM	AKAEASSGDHPTDTEMK	434	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=2021	3.3797	3	1773.7839	1773.7839	K	E	425	442
PSM	ALTDDSDENEEEDAFTDQK	435	sp|Q8NI35-5|INADL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=11757	12.265	2	2170.8662	2170.8662	K	I	666	685
PSM	ATEMVEVGADDDEGGAERGEAGDLR	436	sp|Q6NZI2|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=11816	12.315	2	2548.0984	2548.0984	K	R	338	363
PSM	CALEDETYADGAETEVDCNR	437	sp|Q12841-2|FSTL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=13207	13.732	3	2316.9111	2316.9111	K	C	198	218
PSM	CHAEHTPEEEIDHTGAK	438	sp|O95757|HS74L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:4	ms_run[2]:scan=2586	3.8261	2	1959.8381	1959.8381	K	T	540	557
PSM	DCATEEDEPPAPELHQDAAR	439	sp|Q66K14-2|TBC9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4	ms_run[2]:scan=8992	9.7465	2	2249.9495	2249.9495	R	E	1061	1081
PSM	DELTDLDQSNVTEETPEGEEHHPVADTENK	440	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=13383	13.897	5	3377.4655	3377.4655	K	E	223	253
PSM	DGARPDVTESESGSPEYR	441	sp|P10696|PPBN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=5723	6.7211	2	1950.8555	1950.8555	K	Q	422	440
PSM	DLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNK	442	sp|Q6NXS1|IPP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=16359	16.839	4	4267.6673	4267.6673	K	L	164	202
PSM	DSGRGDSVSDSGSDALR	443	sp|Q53EL6-2|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=3943	4.9965	2	1679.7347	1679.7347	R	S	59	76
PSM	DSGSDEDFLMEDDDDSDYGSSK	444	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:35	ms_run[2]:scan=14791	15.217	3	2443.8605	2443.8605	K	K	89	111
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	445	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=16834	17.336	5	3657.4246	3657.4246	K	R	176	207
PSM	EEPAAAGSGAASPSAAEK	446	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=3470	4.5601	2	1599.7376	1599.7376	K	G	70	88
PSM	EHHPEEGSSGSEVEEIPETPCESQGEELK	447	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	21-UNIMOD:4	ms_run[2]:scan=11242	11.789	3	3235.3735	3235.3735	K	E	652	681
PSM	ELENEENQEEQGLEEKGEEFAR	448	sp|Q8IWE2-2|NXP20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=15515	15.973	3	2635.1522	2635.1522	K	M	139	161
PSM	ELLQESQEEEEEEEEEMPSK	449	sp|Q8IVL6-2|P3H3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=14277	14.738	3	2450.0166	2450.0166	K	D	504	524
PSM	ENGASESGDPLDEDDVDTVVDEQPK	450	sp|Q96JN0-3|LCOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=17705	18.345	2	2659.1257	2659.1257	K	F	1073	1098
PSM	EPEEINADDEIEDTCDHKEDDLGAVEEQR	451	sp|Q9BXB4|OSB11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:4	ms_run[2]:scan=14428	14.875	3	3399.4168	3399.4168	R	S	339	368
PSM	EPSEEPLPMETEEEDPKEEPIK	452	sp|O14776-2|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=14954	15.38	4	2581.1629	2581.1629	K	E	458	480
PSM	EQTEGEYSSLEHESAR	453	sp|O43837-2|IDH3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=5698	6.7013	2	1850.7919	1850.7919	R	G	165	181
PSM	ESDDALTVNEETSEENNQMEESDVSQAEK	454	sp|Q9NY27-3|PP4R2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=13711	14.21	3	3256.3321	3256.3321	K	D	272	301
PSM	GGMNDDEDFYDEDMGDGGGGSYR	455	sp|Q9UPT8|ZC3H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:35	ms_run[2]:scan=13851	14.341	2	2473.8547	2473.8547	K	S	355	378
PSM	GSGGGGGGGGQGSTNYGK	456	sp|Q99729-3|ROAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=42	0.03956	2	1453.6182	1453.6182	R	S	254	272
PSM	HYNGEAYEDDEHHPR	457	sp|P31689|DNJA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=2168	3.4925	3	1867.751	1867.7510	R	G	375	390
PSM	KMDPAEEDTNVYTEK	458	sp|P34741|SDC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6160	7.1375	2	1768.7825	1768.7825	R	H	120	135
PSM	KVEEVLEEEEEEYVVEK	459	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=18689	19.517	2	2108.0049	2108.0049	K	V	9	26
PSM	KVEEVLEEEEEEYVVEK	460	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=18828	19.706	2	2108.0049	2108.0049	K	V	9	26
PSM	KVEEVLEEEEEEYVVEK	461	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=18198	18.921	2	2108.0049	2108.0049	K	V	9	26
PSM	LADLEEESESWDNSEAEEEEK	462	sp|Q8NFG4|FLCN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=16819	17.321	2	2467.0034	2467.0034	K	A	289	310
PSM	LWGDDDEEEDEEEEDNK	463	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=9958	10.645	2	2094.7662	2094.7662	R	T	4778	4795
PSM	MAGQEIPEEGREVEEFSEDDDEDDSDDSEAEK	464	sp|Q9Y2W2|WBP11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=16176	16.663	3	3630.4071	3630.4071	R	Q	337	369
PSM	MREDYDSVEQDGDEPGPQR	465	sp|Q9Y5S9-2|RBM8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:35	ms_run[2]:scan=5559	6.5434	2	2237.9131	2237.9131	R	S	49	68
PSM	NRPDYVSEEEEDDEDFETAVK	466	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=14384	14.835	3	2515.0511	2515.0511	K	K	2662	2683
PSM	NVPHEDICEDSDIDGDYR	467	sp|O00629|IMA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:4	ms_run[2]:scan=10778	11.376	2	2147.8702	2147.8702	R	V	50	68
PSM	QEPLEEDSPSSSSAGLDK	468	sp|P15408-3|FOSL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8958	9.715	2	1874.8381	1874.8381	K	A	184	202
PSM	QHLENDPGSNEDTDIPK	469	sp|O43396|TXNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=5506	6.4901	2	1907.8497	1907.8497	K	G	105	122
PSM	QVFESDEAPDGNSYQDDQDDLK	470	sp|Q96N67-7|DOCK7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=13217	13.742	2	2514.0307	2514.0307	K	R	156	178
PSM	RTEQEEDEELLTESSK	471	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8288	9.1138	2	1921.8753	1921.8753	R	A	145	161
PSM	SEQDQAENEGEDSAVLMER	472	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=11895	12.386	2	2135.8913	2135.8913	K	L	522	541
PSM	SEYSELDEDESQAPYDPNGKPER	473	sp|P19387|RPB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=11343	11.881	4	2654.1256	2654.1256	K	F	206	229
PSM	SREQSSEAAETGVSENEENPVR	474	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=5115	6.0354	2	2404.0739	2404.0739	R	I	1182	1204
PSM	SSDDTTDAQMDEQDLNEPLAK	475	sp|Q14BN4-2|SLMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=13901	14.387	3	2321.9805	2321.9805	K	V	420	441
PSM	STSCDDTPDGAGGAFAAQPEDCDGEK	476	sp|O95613|PCNT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=10420	11.059	2	2657.013	2657.0130	K	R	72	98
PSM	TEGDEEAEEEQEENLEASGDYK	477	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10846	11.437	3	2499.9885	2499.9885	K	Y	10	32
PSM	TFDECVAEGGSDCAPEK	478	sp|Q7LGA3-3|HS2ST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8523	9.3272	2	1870.7349	1870.7349	K	L	197	214
PSM	TPSPAAEDAREPEAK	479	sp|Q92797|SYMPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=3055	4.2191	2	1567.7478	1567.7478	K	G	1257	1272
PSM	VAGESAEPEPEPEADYYAK	480	sp|P01137|TGFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=11033	11.604	2	2050.9007	2050.9007	R	E	88	107
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	481	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=13925	14.409	4	3368.4764	3368.4764	K	E	312	341
PSM	VDENFDCVEADDVEGK	482	sp|O14929-2|HAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:4	ms_run[2]:scan=13362	13.877	2	1839.7469	1839.7469	K	I	10	26
PSM	VEEDDYPSEELLEDENAINAK	483	sp|Q5JRA6|TGO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=20080	21.663	2	2421.0707	2421.0707	K	R	720	741
PSM	WSLEDDDDDEDDPAEAEK	484	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=14824	15.25	2	2092.7869	2092.7869	K	E	198	216
PSM	YKLDEDEDEDDADLSK	485	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8103	8.9529	2	1898.7905	1898.7905	K	Y	167	183
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	486	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=16394	16.873945	3	3774.606315	3773.619463	K	A	735	771
PSM	EVEEDSEDEEMSEDEEDDSSGEEVVIPQKK	487	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	11-UNIMOD:35	ms_run[1]:scan=12483	13.04062	4	3457.421964	3456.389355	K	G	23	53
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	488	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:27	ms_run[1]:scan=8045	8.9000765	3	2964.3612	2963.3742	K	G	56	88
PSM	AEGTAEAPLENGGGGDSGAGALER	489	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:1	ms_run[1]:scan=16072	16.565672	2	2228.9882	2226.9982	M	G	2	26
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAKK	490	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:1	ms_run[1]:scan=21352	24.068251	3	3392.4572	3391.4692	M	D	2	34
PSM	IEELDQENEAALENGIKNEENTEPGAESSENADDPNK	491	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=14338	14.792571	4	4042.756351	4041.768296	K	D	720	757
PSM	KAAAPAPEEEMDECEQALAAEPK	492	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	14-UNIMOD:4	ms_run[1]:scan=11183	11.736392	3	2485.119728	2484.114856	K	A	253	276
PSM	QMEEEGEEFTEGEHPETLSR	493	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28	ms_run[1]:scan=16625	17.126308	2	2345.9732	2345.9592	K	L	1056	1076
PSM	ERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAK	494	sp|Q12797|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:27	ms_run[1]:scan=17097	17.619295	4	4204.9233	4204.9191	K	E	111	149
PSM	EAELESPEVMPEEEDEDDEDGGEEAPAPGGAGK	495	sp|Q8IX01|SUGP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	10-UNIMOD:35	ms_run[1]:scan=16485	16.96693	3	3430.402570	3429.368560	R	S	882	915
PSM	QVCGDSIKPEETEQEVAADETR	496	sp|Q96GM8|TOE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,3-UNIMOD:4	ms_run[1]:scan=14942	15.368353	3	2473.0934	2473.0910	K	N	369	391
PSM	QLHQSCQTDDGEDDLK	497	sp|P61201|CSN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,6-UNIMOD:4	ms_run[1]:scan=7153	8.0900324	2	1870.7650	1870.7634	R	K	174	190
PSM	EQSELDQDLDDVEEVEEEETGEETK	498	sp|P55209|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:27	ms_run[1]:scan=23722	29.670562	3	2905.2038	2905.1991	K	L	8	33
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	499	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0		ms_run[1]:scan=23771	29.813637	4	5140.9065	5140.9086	K	R	36	81
PSM	AAAPAPEEEMDECEQALAAEPK	500	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=15719	16.19	2	2372.0148	2372.0148	K	A	254	276
PSM	AAAPAPEEEMDECEQALAAEPK	501	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=15762	16.232	3	2372.0148	2372.0148	K	A	254	276
PSM	AAEAAAAPAESAAPAAGEEPSKEEGEPK	502	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6667	7.6437	4	2635.2249	2635.2249	K	K	122	150
PSM	AAELTATQVEEEEEEEDFRK	503	sp|O75717-2|WDHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=13928	14.411	3	2352.0605	2352.0605	K	K	697	717
PSM	AEAERPEEQAEASGLK	504	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=4293	5.3163	2	1713.817	1713.8170	R	K	967	983
PSM	AEEATEAQEVVEATPEGACTEPR	505	sp|O75683|SURF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:4	ms_run[2]:scan=14259	14.72	2	2473.0915	2473.0915	K	E	171	194
PSM	AEIPCEDEQEQEHNGPLDNK	506	sp|Q96SB4-4|SRPK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:4	ms_run[2]:scan=7960	8.8194	2	2350.9972	2350.9972	R	G	435	455
PSM	ATEDGEEDEEMIESIENLEDLK	507	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:35	ms_run[2]:scan=21627	24.616	2	2553.08	2553.0800	R	G	157	179
PSM	AVGDTVAEDEVVCEIETDK	508	sp|P36957|ODO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:4	ms_run[2]:scan=20185	21.821	2	2077.9361	2077.9361	K	T	92	111
PSM	CDGERDCPDGSDEAPEICPQSK	509	sp|Q07954|LRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:4,7-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=7042	7.9836	3	2520.9792	2520.9792	R	A	47	69
PSM	CGQEEHDVLLSNEEDRK	510	sp|Q9UGI8-2|TES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:4	ms_run[2]:scan=4904	5.8517	3	2056.912	2056.9120	K	V	37	54
PSM	DGAVEDEEGEGEDGEERDPETEEPLWASR	511	sp|Q9Y2U8|MAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=16086	16.578	3	3231.3236	3231.3236	K	T	214	243
PSM	DSGKDQEEEEIEDTLMDTEEQEEFK	512	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:35	ms_run[2]:scan=20991	23.265	3	3018.2295	3018.2295	K	A	5176	5201
PSM	DSSHNELYYEEAEHER	513	sp|Q8TAA9-2|VANG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6901	7.8604	2	2006.8242	2006.8242	R	R	335	351
PSM	EDEGEIQPENKEDSIENVR	514	sp|A0MZ66-7|SHOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8791	9.5686	3	2229.0033	2229.0033	K	E	194	213
PSM	EDQEAAELLSEPEEESER	515	sp|Q63HN8|RN213_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=16227	16.713	2	2088.8971	2088.8971	K	H	1249	1267
PSM	EEETETSDLFLPDDDDEDEDEYESR	516	sp|Q9P2N5|RBM27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=19925	21.409	3	3021.1531	3021.1531	K	S	1032	1057
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	517	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=20718	22.807	3	3657.4246	3657.4246	K	R	176	207
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	518	sp|P08621-2|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:35	ms_run[2]:scan=13873	14.36	4	3915.6501	3915.6501	K	G	298	338
PSM	EGTGSTATSSSSTAGAAGK	519	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=2040	3.3944	2	1626.7333	1626.7333	K	G	6	25
PSM	EKNDIHLDADDPNSADK	520	sp|Q99590-2|SCAFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=4618	5.6021	3	1895.8497	1895.8497	K	H	684	701
PSM	ELLQESQEEEEEEEEEMPSKDPSPEPPSR	521	sp|Q8IVL6-2|P3H3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=14623	15.06	3	3412.4624	3412.4624	K	R	504	533
PSM	ELVSSSSSGSDSDSEVDKK	522	sp|P53999|TCP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=3249	4.382	2	1941.8651	1941.8651	K	L	6	25
PSM	EQVMEVEEDPQTITTEETMEEDK	523	sp|Q8TEY7|UBP33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=18135	18.84	3	2739.1627	2739.1627	K	S	289	312
PSM	ERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAK	524	sp|Q12797-9|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=16046	16.541	5	4222.9302	4222.9302	K	E	97	135
PSM	ESSEEEYDSGVEEEGWPRQADAANS	525	sp|O76031|CLPX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=14838	15.264	2	2770.1114	2770.1114	K	-	609	634
PSM	ETDYPAGEDLSESGQVDK	526	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10257	10.911	2	1938.8331	1938.8331	R	A	789	807
PSM	FVEEEDDDEEEEEENLDDQDEQGNLK	527	sp|Q7KZ85-3|SPT6H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=13718	14.216	3	3140.2225	3140.2225	K	G	30	56
PSM	GAEAFGDSEEDGEDVFEVEK	528	sp|Q99549|MPP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=18807	19.683	2	2157.8862	2157.8862	R	I	44	64
PSM	GDVEEDEAVPDSEQDIKPR	529	sp|O14787-2|TNPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9321	10.072	2	2126.9604	2126.9604	K	F	318	337
PSM	GDVEEDEAVPDSEQDIKPR	530	sp|O14787-2|TNPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9330	10.084	3	2126.9604	2126.9604	K	F	318	337
PSM	GGTVADLDEQDEETVTAGGK	531	sp|Q92922|SMRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=11525	12.046	2	1990.8967	1990.8967	K	E	402	422
PSM	GGTVADLDEQDEETVTAGGKEDEDPAK	532	sp|Q92922|SMRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=13250	13.773	3	2775.2206	2775.2206	K	G	402	429
PSM	GPPPTTEEEASGPPGEPR	533	sp|Q96RK0|CIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5993	6.999	2	1803.8275	1803.8275	K	L	122	140
PSM	IEDSGENLETEPLESQDR	534	sp|P78345|RPP38_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=12525	13.082	2	2059.9182	2059.9182	R	E	212	230
PSM	LNQSGTSVGTDEESDVTQEEER	535	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8377	9.198	3	2409.0415	2409.0415	K	D	2284	2306
PSM	LSSSSEPYEEDEFNDDQSIKK	536	sp|Q9H4L7|SMRCD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10701	11.31	3	2446.066	2446.0660	K	T	210	231
PSM	MQDIPEETESRDGEAVASES	537	sp|Q92974-3|ARHG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10829	11.423	2	2178.9223	2178.9223	R	-	939	959
PSM	MQMLEDEDDLAYAETEKK	538	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35	ms_run[2]:scan=13770	14.265	3	2173.9395	2173.9395	K	T	4346	4364
PSM	MQQNIQELEEQLEEEESAR	539	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35	ms_run[2]:scan=20863	23.066	3	2348.0438	2348.0438	K	Q	941	960
PSM	NCEVPEEPEDEDLVHPTYEK	540	sp|Q14149|MORC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:4	ms_run[2]:scan=13942	14.424	2	2428.0377	2428.0377	R	T	445	465
PSM	NEDEEEEEEEKDEAEDLLGR	541	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=16148	16.635	3	2405.983	2405.9830	K	G	434	454
PSM	NFDDEDSVDGNRPSSASSTSSK	542	sp|Q7Z460-2|CLAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=4522	5.5199	3	2300.9629	2300.9629	K	A	240	262
PSM	NRPDYVSEEEEDDEDFETAVK	543	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=15053	15.484	3	2515.0511	2515.0511	K	K	2662	2683
PSM	NTNEEDDEVREAMTR	544	sp|P49959-2|MRE11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7273	8.1957	2	1807.7643	1807.7643	K	A	511	526
PSM	PMDNSESSEESSDSADSEEAPAAMTAAQAK	545	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10645	11.258	3	3042.219	3042.2190	K	P	527	557
PSM	PSWADQVEEEGEDDK	546	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=13105	13.637	2	1732.7064	1732.7064	K	C	10	25
PSM	QEEEQDLDGEKGPSSEGPEEEDGEGFSFK	547	sp|P84157-2|MXRA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=14874	15.303	3	3184.3116	3184.3116	R	Y	114	143
PSM	QMEEEGEEFTEGEHPETLSR	548	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=11790	12.294	3	2362.9859	2362.9859	K	L	1056	1076
PSM	RPVHGESDTEQLQDDDIETTK	549	sp|Q9BW27-3|NUP85_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5498	6.4841	4	2412.1041	2412.1041	R	V	565	586
PSM	RSSDTSGNEASEIESVK	550	sp|Q71F23-3|CENPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5001	5.9328	2	1794.8232	1794.8232	K	I	106	123
PSM	SDGAPASDSKPGSSEAAPSSK	551	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=2247	3.5542	3	1931.8708	1931.8708	K	E	164	185
PSM	SEEDSSDHDENEDEFSDEEDFLNSTK	552	sp|Q5QJE6|TDIF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=17658	18.289	3	3048.1388	3048.1388	K	A	528	554
PSM	SISCEEATCSDTSESILEEEPQENQKK	553	sp|O94763-2|RMP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=12587	13.141	3	3127.3445	3127.3445	R	L	364	391
PSM	SSRLEEDDGDVAMSDAQDGPR	554	sp|Q9UBU9-2|NXF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8435	9.2498	3	2248.9502	2248.9502	R	V	49	70
PSM	SSSNDSVDEETAESDTSPVLEK	555	sp|Q99590-2|SCAFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=11099	11.659	2	2324.998	2324.9980	K	E	85	107
PSM	TECAEPPRDEPPADGALK	556	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4	ms_run[2]:scan=6222	7.1908	3	1951.8946	1951.8946	R	R	9	27
PSM	TTSEDNEVFGEADANQNNGTSSQDTAVTDSK	557	sp|P02686-2|MBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=11587	12.105	3	3231.356	3231.3560	R	R	38	69
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	558	sp|Q9BXV9|GON7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=11583	12.102	3	2831.1125	2831.1125	R	T	60	86
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	559	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=12449	13.004	3	3368.4764	3368.4764	K	E	312	341
PSM	VEEEEERNQILQNEK	560	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5620	6.6288	2	1885.9017	1885.9017	R	K	931	946
PSM	VQVVDEEGDQQHQEGK	561	sp|Q02447-4|SP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=3216	4.3577	2	1823.8286	1823.8286	R	R	276	292
PSM	YQGDGIVEDEEETMENNEEK	562	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=15514	15.972	2	2356.9489	2356.9489	K	K	841	861
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	563	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=15877	16.367316	3	3774.606315	3773.619463	K	A	735	771
PSM	GEDPFTSETVDPEMEGDDNLGGEDK	564	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	14-UNIMOD:35	ms_run[1]:scan=19175	20.232249	3	2699.102330	2698.071196	K	K	542	567
PSM	TAMSTPHVAEPAENEQDEQDENGAEASADLR	565	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:35	ms_run[1]:scan=10326	10.972299	3	3328.393166	3327.406951	K	A	465	496
PSM	GGTMTDLDEQEDESMETTGKDEDENSTGNK	566	sp|Q8TAQ2|SMRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	15-UNIMOD:35	ms_run[1]:scan=7140	8.0781824	3	3279.290048	3278.283450	K	G	374	404
PSM	AAAPAPEEEMDECEQALAAEPK	567	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[1]:scan=17623	18.247236	3	2373.039209	2372.014808	K	A	254	276
PSM	AAGDTTVIENSDVSPETESSEK	568	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=11290	11.830849	2	2266.000385	2265.013210	K	E	1300	1322
PSM	QQQEELEAEHGTGDKPAAPR	569	sp|Q13895|BYST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28	ms_run[1]:scan=6156	7.134663	3	2173.0043	2173.0031	R	E	64	84
PSM	VEEEPEEEPEETAEDTTEDTEQDEDEEMDVGTDEEEETAK	570	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	28-UNIMOD:35	ms_run[1]:scan=14097	14.570352	4	4631.754176	4631.751958	K	E	755	795
PSM	SDNQSWNSSGSEEDPETESGPPVER	571	sp|Q9Y5P4|CERT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1	ms_run[1]:scan=13729	14.227983	3	2761.1259	2761.1218	M	C	2	27
PSM	IQVKEEPVEEAEEEAPEASTAPK	572	sp|Q9ULJ3|ZBT21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=12641	13.189456	3	2510.210822	2509.207159	K	E	876	899
PSM	SYDKPAVDDDDEGMETLEEDTEESSR	573	sp|Q8TEW0|PARD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	14-UNIMOD:35	ms_run[1]:scan=11280	11.823303	3	2978.180822	2977.177846	K	S	932	958
PSM	TYASTEQEQDAEENGVTGVSGPGK	574	sp|P33527|MRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=9199	9.9516831	2	2454.070815	2453.083021	R	E	868	892
PSM	AAAPAPEEEMDECEQALAAEPK	575	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=12258	12.804	2	2372.0148	2372.0148	K	A	254	276
PSM	AAAPAPEEEMDECEQALAAEPK	576	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=16212	16.698	2	2372.0148	2372.0148	K	A	254	276
PSM	AAELTATQVEEEEEEEDFRK	577	sp|O75717-2|WDHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15576	16.045	3	2352.0605	2352.0605	K	K	697	717
PSM	AAGDTTVIENSDVSPETESSEK	578	sp|Q86UP2-2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10419	11.058	2	2265.0132	2265.0132	K	E	1243	1265
PSM	AEEATEAQEVVEATPEGACTEPR	579	sp|O75683|SURF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	19-UNIMOD:4	ms_run[2]:scan=14365	14.817	2	2473.0915	2473.0915	K	E	171	194
PSM	AGEAAELQDAEVESSAK	580	sp|Q9NZT2-2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9551	10.291	2	1703.785	1703.7850	K	S	637	654
PSM	AGEQQLSEPEDMEMEAGDTDDPPR	581	sp|Q93009|UBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15299	15.751	2	2646.0698	2646.0698	K	I	12	36
PSM	AGPGADNGEEGEIEEEMENPEMVDLPEK	582	sp|Q13330-2|MTA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	22-UNIMOD:35	ms_run[2]:scan=20202	21.852	3	3030.2594	3030.2594	K	L	71	99
PSM	ALTDDSDENEEEDAFTDQK	583	sp|Q8NI35-5|INADL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11749	12.257	2	2170.8662	2170.8662	K	I	666	685
PSM	ASGEGMAGDAAGETEGSMER	584	sp|O95359-3|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7651	8.547	2	1911.7575	1911.7575	K	M	1357	1377
PSM	ASNGNARPETVTNDDEEALDEETK	585	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7891	8.76	3	2604.1423	2604.1423	K	R	178	202
PSM	AVTEQGHELSNEER	586	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=2847	4.0488	2	1597.7332	1597.7332	K	N	28	42
PSM	DAPGEDEEEDGVSEAASLEEPK	587	sp|Q9H0E9-3|BRD8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15759	16.228	2	2301.9608	2301.9608	K	E	519	541
PSM	DGARPDVTESESGSPEYR	588	sp|P10696|PPBN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5700	6.7028	3	1950.8555	1950.8555	K	Q	422	440
PSM	DSGSDEDFLMEDDDDSDYGSSK	589	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=17419	17.991	3	2427.8656	2427.8656	K	K	89	111
PSM	DSSESQLASTESDKPTTGR	590	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=4519	5.5178	3	1994.9029	1994.9029	R	V	65	84
PSM	EAEEVMDAGCQESAGPER	591	sp|Q99575|POP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:4	ms_run[2]:scan=7773	8.6569	2	1963.7888	1963.7888	R	I	768	786
PSM	EAQGNSSAGVEAAEQRPVEDGER	592	sp|Q6NYC8-2|PPR18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5109	6.0309	2	2385.0793	2385.0793	R	G	302	325
PSM	EDLEEQEALEDGVACADEK	593	sp|O75691|UTP20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:4	ms_run[2]:scan=15868	16.357	3	2148.9005	2148.9005	K	A	2580	2599
PSM	EFEEESKQPGVSEQQR	594	sp|O94776|MTA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=4223	5.2514	2	1905.8704	1905.8704	R	H	65	81
PSM	EGEAAAVEGPCPSQESLSQEENPEPTEDERSEEK	595	sp|Q86W50|MET16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:4	ms_run[2]:scan=11356	11.895	3	3743.5864	3743.5864	R	G	438	472
PSM	EGEEPQASAQDETPITSAK	596	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8093	8.9457	3	1986.9018	1986.9018	K	E	1492	1511
PSM	EIVEVKEENIEDATEK	597	sp|P82970|HMGN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11532	12.051	2	1873.9157	1873.9157	K	G	96	112
PSM	ENALDRAEQAEADK	598	sp|P09493-9|TPM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=6756	7.7267	2	1558.7223	1558.7223	K	K	16	30
PSM	ENAPKPQDAAEVSSEQEK	599	sp|Q14865|ARI5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=4284	5.3059	3	1955.9072	1955.9072	K	E	456	474
PSM	EQSELDQDLDDVEEVEEEETGEETK	600	sp|P55209-2|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=22483	26.57	3	2923.2102	2923.2102	K	L	8	33
PSM	ESVQQEPEREQVQPK	601	sp|Q96LR5|UB2E2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=3187	4.3335	2	1809.8857	1809.8857	R	K	25	40
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	602	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=21287	23.912	3	3756.4388	3756.4388	K	A	469	503
PSM	GESSASSPEEPEEITCLEK	603	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:4	ms_run[2]:scan=14218	14.68	2	2077.8998	2077.8998	K	G	458	477
PSM	GMVAEEIEEEPAAGDDEELEEEAVPQDESSQK	604	sp|O75691|UTP20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:35	ms_run[2]:scan=17744	18.391	3	3504.4734	3504.4734	K	K	873	905
PSM	GMVAEEIEEEPAAGDDEELEEEAVPQDESSQKK	605	sp|O75691|UTP20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=17919	18.582	3	3616.5734	3616.5734	K	K	873	906
PSM	GQEADLEAGGEEVPEANGSAGK	606	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9876	10.576	3	2113.94	2113.9400	K	R	226	248
PSM	GSAPHSESDLPEQEEEILGSDDDEQEDPNDYCK	607	sp|Q96SB4-4|SRPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	32-UNIMOD:4	ms_run[2]:scan=16818	17.32	3	3733.4969	3733.4969	R	G	16	49
PSM	GTEASSGTEAATGLEGEEK	608	sp|Q8IY81|SPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=6261	7.2258	2	1822.8068	1822.8068	K	D	594	613
PSM	IEENSLKEEESIEGEK	609	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8026	8.8818	2	1861.8793	1861.8793	K	E	1566	1582
PSM	KDDENIPMETEETHLEETTESQQNGEEGTSTPEDK	610	sp|Q969G3-3|SMCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=13272	13.793	4	3976.6764	3976.6764	K	E	263	298
PSM	KEDEPPEQAEPEPTEAWK	611	sp|P11171-7|41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9743	10.46	2	2108.9538	2108.9538	K	V	598	616
PSM	LAEGEEEKPEPDISSEESVSTVEEQENETPPATSSEAEQPK	612	sp|Q5SSJ5-5|HP1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15125	15.57	4	4441.978	4441.9780	K	G	57	98
PSM	LEDGQTADGQTEEAAEPGEQLQTQK	613	sp|Q96G46-2|DUS3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9273	10.023	3	2672.2049	2672.2049	R	R	77	102
PSM	LEDGQTADGQTEEAAEPGEQLQTQK	614	sp|Q96G46-2|DUS3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9277	10.026	3	2672.2049	2672.2049	R	R	77	102
PSM	LEGALGADTTEDGDEK	615	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7293	8.2117	2	1619.7162	1619.7162	K	S	1052	1068
PSM	LEGGGGPAGGFEDEGEDK	616	sp|P50548-2|ERF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8565	9.3617	2	1719.7224	1719.7224	R	K	419	437
PSM	MDTIQEDPSTDSHMDEDGFEK	617	sp|P78536|ADA17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12286	12.832	3	2425.9526	2425.9526	R	D	759	780
PSM	MKLPEHPEGGEPEDDEAPAK	618	sp|Q9NX58|LYAR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35	ms_run[2]:scan=4304	5.3239	3	2190.9739	2190.9739	K	G	287	307
PSM	NEDEEEEEEEKDEAEDLLGR	619	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15024	15.451	3	2405.983	2405.9830	K	G	434	454
PSM	NRPDYVSEEEEDDEDFETAVK	620	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15527	15.988	3	2515.0511	2515.0511	K	K	2662	2683
PSM	NYAGEEEEEGSGSSEGFDPPATDR	621	sp|P16989-3|YBOX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11073	11.638	3	2529.0052	2529.0052	R	Q	191	215
PSM	QEEELQAKDEELLK	622	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10666	11.276	2	1700.8469	1700.8469	R	V	850	864
PSM	RLQPDPEPTEEDIEK	623	sp|P41229-4|KDM5C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8161	9.0039	2	1794.8636	1794.8636	K	N	148	163
PSM	RSYEDDDDMDLQPNK	624	sp|Q9BTE3-2|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7242	8.1713	2	1839.7581	1839.7581	K	Q	166	181
PSM	SDKTEEIAEEEETVFPK	625	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=16216	16.703	2	1979.9211	1979.9211	K	A	38	55
PSM	SGERPVTAGEEDEQVPDSIDAR	626	sp|Q9Y3D0|CIA2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10278	10.93	3	2356.0779	2356.0779	R	E	23	45
PSM	SGGAATVEEAPSEFEEEASR	627	sp|Q8TF64|GIPC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15784	16.255	3	2051.892	2051.8920	R	K	226	246
PSM	SHGKDEECVLEAENK	628	sp|Q9UHQ4|BAP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:4	ms_run[2]:scan=3382	4.489	2	1743.7734	1743.7734	K	K	164	179
PSM	SYDKPAVDDDDEGMETLEEDTEESSR	629	sp|Q8TEW0-9|PARD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15985	16.473	3	2961.1829	2961.1829	K	S	886	912
PSM	TAEEENPEHVEIQK	630	sp|O00566|MPP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=4886	5.8372	2	1651.7689	1651.7689	K	M	485	499
PSM	TEPEEVSIEDSAQSDLK	631	sp|Q16666-3|IF16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=14198	14.662	2	1875.8585	1875.8585	K	E	450	467
PSM	TPQEYAEGSVEETKEEPTEIK	632	sp|Q68DQ2|CRBG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10750	11.353	3	2393.1122	2393.1122	K	E	1895	1916
PSM	TQLEELEDELQATEDAK	633	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=16113	16.603	2	1960.9113	1960.9113	K	L	1539	1556
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	634	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28,23-UNIMOD:35	ms_run[1]:scan=14784	15.209903	3	3573.4615	3573.4552	K	A	737	771
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	635	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28	ms_run[1]:scan=19810	21.194666	3	3558.4492	3557.4602	K	A	737	771
PSM	EKNDIHLDADDPNSADK	636	sp|Q99590|SCAFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=4640	5.6196166	2	1896.849095	1895.849714	K	H	999	1016
PSM	ADSGLREPQEDSQK	637	sp|Q8NFQ8|TOIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1	ms_run[1]:scan=5320	6.2200322	2	1600.7325	1600.7324	M	D	2	16
PSM	KGQEADLEAGGEEVPEANGSAGK	638	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=7981	8.8403932	3	2243.021302	2242.034949	K	R	225	248
PSM	ELDEHELDYDEEVPEEPAPAVQEDEAEK	639	sp|Q86VM9|ZCH18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:27	ms_run[1]:scan=20028	21.585312	3	3235.3972	3235.3832	R	A	122	150
PSM	EREESEDELEEANGNNPIDIEVDQNK	640	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=16546	17.035104	3	3014.334223	3014.322476	R	E	256	282
PSM	YRIQEQESSGEEDSDLSPEER	641	sp|Q6NXS1|IPP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=8324	9.1466684	3	2484.078827	2482.073185	K	E	114	135
PSM	CHAEHTPEEEIDHTGAK	642	sp|O95757|HS74L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=4241	5.2665686	3	1942.8110	1942.8110	K	T	540	557
PSM	SDEREVAEAATGEDASSPPPK	643	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1	ms_run[1]:scan=11378	11.91492	3	2183.9827	2183.9813	M	T	2	23
PSM	GTEASSGTEAATGLEGEEK	644	sp|Q8IY81|SPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=6369	7.3188589	3	1822.810764	1822.806846	K	D	594	613
PSM	DYEEVGVDSVEGEGEEEGEEY	645	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=23098	27.99178	2	2347.901016	2347.897571	K	-	431	452
PSM	DTSDVEPTAPMEEPTVVEESQGTPEEESPAK	646	sp|Q5JVS0|HABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=17982	18.669023	3	3316.462211	3314.450773	K	V	246	277
PSM	EEEEEAAAAAAMATEGGK	647	sp|Q02446|SP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=13867	14.355079	2	1764.757662	1763.751974	K	T	7	25
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	648	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0		ms_run[1]:scan=23403	28.795209	4	5140.9126	5140.9086	K	R	36	81
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	649	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0		ms_run[1]:scan=22997	27.721119	4	5140.9065	5140.9086	K	R	36	81
PSM	AAAPAPEEEMDECEQALAAEPK	650	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=12759	13.303	3	2372.0148	2372.0148	K	A	254	276
PSM	AAAPAPEEEMDECEQALAAEPK	651	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=17206	17.743	3	2372.0148	2372.0148	K	A	254	276
PSM	ADDSREEEEENDDDNSLEGETFPLER	652	sp|Q5VSL9-3|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=16993	17.518	3	3039.2337	3039.2337	K	D	111	137
PSM	ADGATSDDLDLHDDR	653	sp|Q07157-2|ZO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6304	7.261	2	1614.6758	1614.6758	K	L	805	820
PSM	ADTSLNNCEGAAGSTSEK	654	sp|O76080|ZFAN5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:4	ms_run[2]:scan=3541	4.6212	2	1810.7639	1810.7639	R	S	69	87
PSM	AEAERPEEQAEASGLK	655	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4277	5.3006	3	1713.817	1713.8170	R	K	967	983
PSM	AEPHTPSSHDAEEDEPLK	656	sp|Q8NB46|ANR52_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4328	5.3427	3	1987.8759	1987.8759	R	E	505	523
PSM	AHEEQDEESQDNLFSSDR	657	sp|Q15058|KIF14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8132	8.9804	3	2134.8675	2134.8675	K	A	1284	1302
PSM	DAINQGMDEELERDEK	658	sp|P11177-3|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:35	ms_run[2]:scan=5964	6.9697	2	1906.8214	1906.8215	R	V	37	53
PSM	DCNDTLEEENTNLETPTK	659	sp|Q9BZE2|PUS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4	ms_run[2]:scan=11741	12.251	2	2121.9008	2121.9008	R	R	452	470
PSM	DDAVFDDEVAPNAASDNASAEK	660	sp|Q9Y4K1|CRBG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=14633	15.07	3	2249.956	2249.9560	R	K	36	58
PSM	DDDDIDLFGSDDEEESEEAK	661	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=19318	20.419	2	2271.8663	2271.8663	K	R	97	117
PSM	DEERAEEIVAAQEK	662	sp|Q9Y4A5-2|TRRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8284	9.1108	2	1615.7689	1615.7689	K	S	1223	1237
PSM	DEPQEPSNKVPEQQR	663	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=3286	4.4126	2	1779.8388	1779.8388	R	Q	1629	1644
PSM	DGAVEDEEGEGEDGEERDPETEEPLWASR	664	sp|Q9Y2U8|MAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=16093	16.586	4	3231.3236	3231.3236	K	T	214	243
PSM	DVTEAEQAEEQARQEEQVVR	665	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=14152	14.62	4	2343.0939	2343.0939	K	Q	634	654
PSM	DYDENEVDPYHGNQEK	666	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6896	7.8566	2	1950.7868	1950.7868	R	V	4857	4873
PSM	EAAGEGPALYEDPPDQK	667	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10475	11.108	2	1785.8057	1785.8057	K	T	36	53
PSM	EDEEEDDDVVAPKPPIEPEEEK	668	sp|Q13409-6|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=14573	15.012	3	2537.1181	2537.1181	K	T	144	166
PSM	EEEMGEEEEVEREIIK	669	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=16780	17.278	2	1976.8885	1976.8885	R	Q	1289	1305
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	670	sp|P08621-2|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=15050	15.482	5	3899.6552	3899.6552	K	G	298	338
PSM	EEQELMEEINEDEPVK	671	sp|O14776-2|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:35	ms_run[2]:scan=13940	14.422	2	1975.8568	1975.8568	K	A	588	604
PSM	EEQREELLHEPQDVDK	672	sp|Q5T5Y3-2|CAMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7136	8.0733	3	1992.9389	1992.9389	K	E	683	699
PSM	EFDEDSEDRLVNEK	673	sp|Q9UHD8-4|SEPT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8867	9.6351	2	1723.7537	1723.7537	K	F	226	240
PSM	EGEAAAVEGPCPSQESLSQEENPEPTEDERSEEK	674	sp|Q86W50|MET16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:4	ms_run[2]:scan=11367	11.905	4	3743.5864	3743.5864	R	G	438	472
PSM	EIESEIDSEEELINK	675	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=17802	18.459	2	1775.8313	1775.8313	K	K	755	770
PSM	EIESEIDSEEELINK	676	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=18226	18.96	2	1775.8313	1775.8313	K	K	755	770
PSM	EIESEIDSEEELINK	677	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=18640	19.465	2	1775.8313	1775.8313	K	K	755	770
PSM	ELAQAEDELDEAHNQAR	678	sp|Q96A19|C102A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9449	10.197	2	1937.8715	1937.8715	K	K	466	483
PSM	ELDAISTNEEEKEENEAESDVK	679	sp|P49642|PRI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=12134	12.663	3	2507.1035	2507.1035	R	H	356	378
PSM	ELECAEDPGSAGEAAR	680	sp|O94966-4|UBP19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4	ms_run[2]:scan=5893	6.9031	2	1660.6999	1660.6999	K	A	1026	1042
PSM	ELVSSSSSGSDSDSEVDK	681	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4623	5.6057	2	1813.7701	1813.7701	K	K	6	24
PSM	ENALDRAEQAEAEQK	682	sp|P06753|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7228	8.1569	2	1700.7966	1700.7966	K	Q	17	32
PSM	EVNSQEEEEEELLRK	683	sp|Q96RL1-5|UIMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10201	10.861	2	1859.8749	1859.8749	R	A	98	113
PSM	GAVAEDGDELRTEPEAK	684	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5854	6.8512	2	1785.8381	1785.8381	K	K	8	25
PSM	GESSASSPEEPEEITCLEK	685	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:4	ms_run[2]:scan=14255	14.717	3	2077.8998	2077.8998	K	G	458	477
PSM	GGMNDDEDFYDEDMGDGGGGSYR	686	sp|Q9UPT8|ZC3H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=15736	16.208	3	2457.8598	2457.8598	K	S	355	378
PSM	GPAESPDEGITTTEGEGECEQTPEELEPVEK	687	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:4	ms_run[2]:scan=16469	16.949	4	3343.4409	3343.4409	K	Q	887	918
PSM	GTMDDISQEEGSSQGEDSVSGSQR	688	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8654	9.4402	3	2485.0147	2485.0147	K	I	945	969
PSM	HEEEATDITPAADK	689	sp|O15015-1|ZN646_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4187	5.2193	2	1525.6896	1525.6896	K	T	558	572
PSM	HMTLEGEEENGEVHQAREDK	690	sp|P41214|EIF2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=3719	4.7908	4	2337.0292	2337.0292	R	S	217	237
PSM	IKEDLEEQEALEDGVACADEK	691	sp|O75691|UTP20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:4	ms_run[2]:scan=15380	15.831	3	2390.0795	2390.0795	K	A	2578	2599
PSM	IPDPDSDDVSEVDAR	692	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11006	11.58	2	1628.7166	1628.7166	K	H	690	705
PSM	KTEESESQVEPEIK	693	sp|Q9GZR1-2|SENP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4603	5.5899	2	1631.789	1631.7890	K	R	182	196
PSM	LDADKYENDPELEK	694	sp|Q9BV57|MTND_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8091	8.9445	2	1677.7734	1677.7734	K	I	41	55
PSM	MDTIQEDPSTDSHMDEDGFEK	695	sp|P78536|ADA17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35	ms_run[2]:scan=10650	11.262	3	2441.9475	2441.9475	R	D	759	780
PSM	MGGEEKPIGAGEEK	696	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35	ms_run[2]:scan=2312	3.6082	2	1446.6661	1446.6661	K	Q	13	27
PSM	MNFDEDDREAADEEEEEEEAAVLHK	697	sp|Q68DQ2|CRBG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35	ms_run[2]:scan=14462	14.907	4	2965.2043	2965.2043	K	G	2136	2161
PSM	NKHPDEDAVEAEGHEVK	698	sp|Q9NY27-3|PP4R2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=2694	3.919	3	1902.8708	1902.8708	K	R	174	191
PSM	NSFREQLEEEEEAK	699	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9429	10.181	2	1736.7853	1736.7853	K	H	1339	1353
PSM	NSFREQLEEEEEAK	700	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11716	12.228	2	1736.7853	1736.7853	K	H	1339	1353
PSM	NVPHEDICEDSDIDGDYR	701	sp|O00629|IMA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:4	ms_run[2]:scan=10824	11.419	3	2147.8702	2147.8702	R	V	50	68
PSM	QEEEMMAKEEELVK	702	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11797	12.299	2	1721.7852	1721.7852	R	V	843	857
PSM	QQQFTEEEDNLYAEASEK	703	sp|Q5VT06|CE350_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=16153	16.639	3	2157.9338	2157.9338	K	L	2697	2715
PSM	RDIQENDEEAVQVK	704	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4776	5.7397	2	1671.8064	1671.8064	K	E	33	47
PSM	REESEAVEAGDPPEELR	705	sp|Q9H3S7|PTN23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8134	8.9818	2	1911.881	1911.8810	R	S	730	747
PSM	SIEGTADDEEEGVSPDTAIR	706	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=13303	13.823	2	2089.9288	2089.9288	K	S	638	658
PSM	SNGALSTEEREEEMK	707	sp|Q8IUD2-4|RB6I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4173	5.2091	2	1708.7574	1708.7574	K	Q	410	425
PSM	SQLDDHPESDDEENFIDANDDEDMEK	708	sp|Q03701|CEBPZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=15207	15.661	3	3051.1683	3051.1683	R	F	621	647
PSM	SSGAASSAPGGGDGAEYK	709	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=2992	4.169	2	1567.675	1567.6750	R	T	109	127
PSM	SYDEGLDDYREDAK	710	sp|Q5T5U3-3|RHG21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8178	9.0186	2	1674.7009	1674.7009	K	L	871	885
PSM	TDLKGDDLEEGVTSEEFDK	711	sp|Q6ZVM7-4|TM1L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=15142	15.591	3	2125.9539	2125.9539	R	F	177	196
PSM	TEVEETAGSVPAEELVEMDAEPQEAEPAK	712	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:35	ms_run[2]:scan=19288	20.382	3	3100.3918	3100.3918	K	E	328	357
PSM	TSGRVAVEEVDEEGK	713	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4799	5.7581	2	1603.7689	1603.7689	R	F	436	451
PSM	TTEEEDEDELHIGR	714	sp|Q14114-2|LRP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8544	9.3445	2	1671.7224	1671.7224	K	T	665	679
PSM	TVNEDVEEMEIDEQTK	715	sp|Q9NRL2-2|BAZ1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=14151	14.619	2	1907.8306	1907.8306	K	V	998	1014
PSM	VAEQCEPAESQPEALSEK	716	sp|P82094|TMF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:4	ms_run[2]:scan=7588	8.4867	2	2000.8997	2000.8997	K	E	427	445
PSM	VAIQEAEDVDELEDEEEGAETR	717	sp|Q9BRS8-2|LARP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=18346	19.104	3	2475.0773	2475.0773	R	G	20	42
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	718	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=15531	15.991	4	3368.4764	3368.4764	K	E	312	341
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	719	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=19089	20.121	4	3368.4764	3368.4764	K	E	312	341
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	720	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=16345	16.826906	4	3774.605913	3773.619463	K	A	735	771
PSM	AEGTAEAPLENGGGGDSGAGALER	721	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1	ms_run[1]:scan=16043	16.536426	3	2227.9832	2226.9982	M	G	2	26
PSM	AEGTAEAPLENGGGGDSGAGALER	722	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1	ms_run[1]:scan=16670	17.168628	3	2227.9802	2226.9982	M	G	2	26
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAKK	723	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1	ms_run[1]:scan=22060	25.57626	3	3391.4714	3391.4694	M	D	2	34
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAKK	724	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1	ms_run[1]:scan=19771	21.129734	3	3391.4791	3391.4694	M	D	2	34
PSM	SGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTAK	725	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=7914	8.7790723	4	3585.557284	3584.573499	K	A	173	210
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	726	sp|Q9BTT0|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:27	ms_run[1]:scan=16861	17.372057	3	3639.4214	3639.4135	K	R	224	255
PSM	MEDEEVAESWEEAADSGEIDR	727	sp|Q7Z422|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1	ms_run[1]:scan=23476	28.987874	3	2437.9721	2437.9698	-	R	1	22
PSM	EGEAAAVEGPCPSQESLSQEENPEPTEDER	728	sp|Q86W50|MET16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	11-UNIMOD:4	ms_run[1]:scan=13184	13.711129	3	3270.381587	3270.374254	R	S	438	468
PSM	VEEEPEEEPEETAEDTTEDTEQDEDEEMDVGTDEEEETAK	729	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	28-UNIMOD:35	ms_run[1]:scan=16415	16.89388	4	4632.787378	4631.751958	K	E	755	795
PSM	SEQDQAENEGEDSAVLMER	730	sp|Q99613|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=12347	12.896827	2	2137.893684	2135.891321	K	L	532	551
PSM	QHLENDPGSNEDTDIPK	731	sp|O43396|TXNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28	ms_run[1]:scan=9971	10.659075	2	1890.8239	1890.8226	K	G	105	122
PSM	SGAQQLEEEGPMEEEEAQPMAAPEGK	732	sp|Q9Y6B2|EID1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	12-UNIMOD:35	ms_run[1]:scan=15525	15.984742	3	2788.224672	2787.185120	R	R	47	73
PSM	AQEEEDVRDYNLTEEQK	733	sp|Q8IWT0|ARCH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1	ms_run[1]:scan=13432	13.941418	3	2136.9432	2136.9442	M	A	2	19
PSM	MEANGSQGTSGSANDSQHDPGK	734	sp|Q96DH6|MSI2H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1	ms_run[1]:scan=4091	5.1330977	3	2216.8872	2215.9032	-	M	1	23
PSM	AGPGADNGEEGEIEEEMENPEMVDLPEK	735	sp|Q13330|MTA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	17-UNIMOD:35	ms_run[1]:scan=21373	24.101865	3	3031.292104	3030.259407	K	L	71	99
PSM	QEPLEEDSPSSSSAGLDK	736	sp|P15408|FOSL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28	ms_run[1]:scan=14199	14.663228	2	1857.8118	1857.8111	K	A	223	241
PSM	AAEAAAAPAESAAPAAGEEPSKEEGEPK	737	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=6171	7.1476195	3	2638.229869	2635.224934	K	K	122	150
PSM	AAELTATQVEEEEEEEDFRK	738	sp|O75717-2|WDHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=13971	14.452	4	2352.0605	2352.0605	K	K	697	717
PSM	AGAGDEADDERSELSHVETDTEGAAGAGPGGR	739	sp|Q9P227|RHG23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12396	12.95	4	3083.33	3083.3300	R	L	1269	1301
PSM	ALSQAAVEEEEEEEEEEEPAQGK	740	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12363	12.913	3	2559.0984	2559.0984	R	G	947	970
PSM	ARDCTVNGDEPDCVPCQEGK	741	sp|P25445-7|TNR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=4912	5.8572	3	2305.9362	2305.9362	K	E	70	90
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	742	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:4	ms_run[2]:scan=10392	11.034	2	2338.9455	2338.9455	R	R	42	68
PSM	DEEAALADGEDVPYENSVR	743	sp|Q96Q15-2|SMG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16749	17.247	2	2077.9076	2077.9076	K	Q	3295	3314
PSM	DIDDDLEGEVTEECGK	744	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:4	ms_run[2]:scan=16957	17.478	2	1822.7415	1822.7415	K	F	414	430
PSM	DRVAGESAEPEPEPEADYYAK	745	sp|P01137|TGFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10236	10.891	2	2322.0288	2322.0288	R	E	86	107
PSM	DSGSDEDFLMEDDDDSDYGSSK	746	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:35	ms_run[2]:scan=14765	15.193	3	2443.8605	2443.8605	K	K	89	111
PSM	EAGVEMGDEDDLSTPNEK	747	sp|P14868-2|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:35	ms_run[2]:scan=7463	8.3603	2	1950.8	1950.8000	R	L	257	275
PSM	EDIESQEIEAQEGEDDTFLTAQDGEEEENEK	748	sp|Q9NWH9|SLTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=20109	21.701	3	3555.4656	3555.4656	K	D	166	197
PSM	EEAGGGISEEEAAQYDR	749	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9030	9.7795	2	1809.7653	1809.7653	K	Q	5	22
PSM	EEAGGGISEEEAAQYDR	750	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11624	12.144	2	1809.7653	1809.7653	K	Q	5	22
PSM	EPSEEPLPMETEEEDPKEEPIK	751	sp|O14776-2|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=14895	15.323	3	2581.1629	2581.1629	K	E	458	480
PSM	EQAGGDATENFEDVGHSTDAR	752	sp|P00167-2|CYB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8589	9.3831	3	2204.9206	2204.9206	R	E	53	74
PSM	ESQDTVAENDDGGFSEEWEAQR	753	sp|P49768-7|PSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16075	16.568	2	2498.0106	2498.0106	R	D	290	312
PSM	ETDYPAGEDLSESGQVDK	754	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10241	10.897	3	1938.8331	1938.8331	R	A	789	807
PSM	ETEVGDPAGNELAEPEAK	755	sp|Q96G46-2|DUS3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10908	11.492	2	1854.8483	1854.8483	R	R	56	74
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	756	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12664	13.213	5	3624.5459	3624.5459	K	-	158	196
PSM	GDVEEDETIPDSEQDIRPR	757	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10916	11.498	2	2198.9927	2198.9927	K	F	278	297
PSM	GEGGTDPELEGELDSR	758	sp|Q9UJX6-2|ANC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11683	12.199	2	1659.7224	1659.7224	K	Y	191	207
PSM	GGETGESDETAAVPGDPGATDTDGIPEETDGDADVDLK	759	sp|Q15544-2|TAF11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=18237	18.975	3	3702.5664	3702.5664	K	E	12	50
PSM	GLAEVQQDGEAEEGATSDGEK	760	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8158	9.0017	3	2118.9189	2118.9189	K	K	477	498
PSM	GPGDTSNFDDYEEEEIR	761	sp|P17612-2|KAPCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=14882	15.311	2	1971.797	1971.7970	K	V	313	330
PSM	GSVSDCSDGTSELEEPLGEDPR	762	sp|P50548-2|ERF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:4	ms_run[2]:scan=14991	15.414	3	2334.9758	2334.9758	R	A	109	131
PSM	HLEPEPEEEIIAEDYDDDPVDYEATR	763	sp|O60828-10|PQBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=20284	21.97	4	3088.3309	3088.3309	K	L	19	45
PSM	IKEDLEEQEALEDGVACADEK	764	sp|O75691|UTP20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:4	ms_run[2]:scan=14891	15.32	3	2390.0795	2390.0795	K	A	2578	2599
PSM	ILEQEEEEEQAGKPGEPSK	765	sp|Q9BXP5-5|SRRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5606	6.6049	3	2126.0015	2126.0015	R	K	231	250
PSM	IYYSEETSSDQGNEDEEEPK	766	sp|P19174|PLCG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7350	8.2586	3	2347.9452	2347.9452	K	E	517	537
PSM	KLEAQETLNEEDK	767	sp|Q9UIF9-2|BAZ2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4616	5.6008	2	1545.7522	1545.7522	K	A	668	681
PSM	KVEEVLEEEEEEYVVEK	768	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=17817	18.474	3	2108.0049	2108.0049	K	V	9	26
PSM	LSQVNESDADDEDNYGAR	769	sp|Q6V0I7|FAT4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6598	7.5779	2	1996.8246	1996.8246	K	L	4870	4888
PSM	LSVEESEAAGDGVDTK	770	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8564	9.361	2	1605.737	1605.7370	K	V	427	443
PSM	MQMLEDEDDLAYAETEK	771	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,3-UNIMOD:35	ms_run[2]:scan=13756	14.253	2	2061.8395	2061.8395	K	K	4346	4363
PSM	MQVDQEEPHVEEQQQQTPAENK	772	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35	ms_run[2]:scan=4817	5.7731	4	2637.1613	2637.1613	K	A	522	544
PSM	MQVDQEEPHVEEQQQQTPAENK	773	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6821	7.7891	3	2621.1664	2621.1664	K	A	522	544
PSM	MREDYDSVEQDGDEPGPQR	774	sp|Q9Y5S9-2|RBM8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6528	7.5098	2	2221.9182	2221.9182	R	S	49	68
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	775	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9735	10.454	4	3365.4516	3365.4516	K	K	799	833
PSM	NCEVPEEPEDEDLVHPTYEK	776	sp|Q14149|MORC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4	ms_run[2]:scan=13905	14.39	3	2428.0377	2428.0377	R	T	445	465
PSM	NEDRGEEEAESSISSTSNEQLK	777	sp|Q15326-4|ZMY11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8301	9.1254	3	2438.0681	2438.0681	K	V	313	335
PSM	NEEDDMVEMEEERLR	778	sp|P80303-2|NUCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16430	16.909	2	1922.7986	1922.7986	K	M	282	297
PSM	NETEDQYALMEDEDDLPHHEER	779	sp|O00459|P85B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:35	ms_run[2]:scan=10610	11.228	4	2730.0987	2730.0987	K	T	599	621
PSM	NRPDYVSEEEEDDEDFETAVK	780	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16002	16.492	3	2515.0511	2515.0511	K	K	2662	2683
PSM	NRPDYVSEEEEDDEDFETAVK	781	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16579	17.073	3	2515.0511	2515.0511	K	K	2662	2683
PSM	QDAQDRLDEMDQQK	782	sp|Q9UBC2-4|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5819	6.816	2	1718.753	1718.7530	K	A	443	457
PSM	QQQEEDEQETAALLEEAR	783	sp|Q9BW85|YJU2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=17515	18.107	3	2115.9556	2115.9556	R	K	186	204
PSM	QQQEEDEQETAALLEEAR	784	sp|Q9BW85|YJU2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=17528	18.12	2	2115.9556	2115.9556	R	K	186	204
PSM	QQQFTEEEDNLYAEASEK	785	sp|Q5VT06|CE350_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16200	16.685	2	2157.9338	2157.9338	K	L	2697	2715
PSM	QSSEMTETDEESGILSEAEK	786	sp|Q3T8J9|GON4L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=15721	16.193	2	2198.9373	2198.9373	R	V	411	431
PSM	QTGQIIEDDLEEEDIK	787	sp|Q8N4S0|CCD82_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=17839	18.498	2	1873.8793	1873.8793	K	R	163	179
PSM	RNVESGEEELASK	788	sp|Q96HS1-2|PGAM5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=3201	4.3451	2	1446.6951	1446.6951	K	L	76	89
PSM	RQDPGDNWEEGGGGGGGMEK	789	sp|Q9UKY7-3|CDV3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5347	6.2413	3	2031.8341	2031.8341	K	S	15	35
PSM	SEQDQAENEGEDSAVLMER	790	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:35	ms_run[2]:scan=8733	9.5175	3	2151.8862	2151.8862	K	L	522	541
PSM	SMSDPDQDFDKEPDSDSTK	791	sp|Q9Y5S2|MRCKB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7249	8.1765	3	2142.8535	2142.8535	R	H	1657	1676
PSM	SQSSIVPEEEQAANKGEEK	792	sp|Q969G3-3|SMCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5280	6.181	2	2058.9706	2058.9706	R	K	244	263
PSM	SVPVTVDDDDDDNDPENR	793	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8811	9.5852	2	2015.8192	2015.8192	K	I	1185	1203
PSM	TEQEEDEELLTESSK	794	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10807	11.402	2	1765.7741	1765.7741	R	A	146	161
PSM	TGGTVESDGSTESTGRLEEK	795	sp|Q8NDV7-6|TNR6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=3830	4.891	3	2038.9291	2038.9291	K	G	666	686
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	796	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12373	12.924	4	3368.4764	3368.4764	K	E	312	341
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	797	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=18355	19.113	4	3368.4764	3368.4764	K	E	312	341
PSM	VASRVDEDEDDLEEEHITK	798	sp|Q96FC9-4|DDX11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8230	9.063	2	2228.0081	2228.0081	K	I	210	229
PSM	VELEENAEDDKTENQIPQR	799	sp|Q6UB98-2|ANR12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8349	9.1712	3	2256.0506	2256.0506	K	M	1693	1712
PSM	VTETSSHDIYEEAEADNEESDK	800	sp|Q8IWC1-2|MA7D3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8433	9.2463	3	2497.0252	2497.0252	K	D	691	713
PSM	YNEEERAQQEAEAAQR	801	sp|Q99426-2|TBCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5377	6.2713	3	1920.8562	1920.8562	R	L	82	98
PSM	NSFREQLEEEEEAK	802	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=12200	12.735013	2	1737.775449	1736.785323	K	H	1339	1353
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	803	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	25-UNIMOD:35	ms_run[1]:scan=15373	15.823563	4	3790.640230	3789.614378	K	A	735	771
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	804	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=15839	16.323618	4	3774.605913	3773.619463	K	A	735	771
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	805	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	23-UNIMOD:35	ms_run[1]:scan=17422	17.993669	4	3591.516074	3590.482301	K	A	737	771
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	806	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=18148	18.856267	3	3575.472423	3574.487386	K	A	737	771
PSM	NRPDYVSEEEEDDEDFETAVK	807	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=17083	17.606681	3	2517.056503	2515.051052	K	K	2662	2683
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAK	808	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1	ms_run[1]:scan=21411	24.167701	3	3263.3743	3263.3744	M	K	2	33
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAKK	809	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1	ms_run[1]:scan=21137	23.56354	3	3391.4730	3391.4694	M	D	2	34
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAKK	810	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1	ms_run[1]:scan=21819	25.074082	3	3393.4682	3391.4692	M	D	2	34
PSM	GGTMTDLDEQEDESMETTGK	811	sp|Q8TAQ2|SMRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=11524	12.045257	2	2173.871327	2172.867474	K	D	374	394
PSM	DSGSDEDFLMEDDDDSDYGSSK	812	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	10-UNIMOD:35	ms_run[1]:scan=17437	18.007283	3	2444.893348	2443.860534	K	K	129	151
PSM	AAAPAPEEEMDECEQALAAEPK	813	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	13-UNIMOD:4	ms_run[1]:scan=19216	20.289047	3	2357.004715	2356.019893	K	A	254	276
PSM	MEVAEPSSPTEEEEEEEEHSAEPRPR	814	sp|Q9NWV8|BABA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=10133	10.800934	3	3067.2844	3067.2831	-	T	1	27
PSM	RDCNDTLEEENTNLETPTK	815	sp|Q9BZE2|PUS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:4	ms_run[1]:scan=8552	9.3500725	3	2279.006208	2278.001934	K	R	451	470
PSM	AASDTERDGLAPEK	816	sp|Q7L4I2|RSRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1	ms_run[1]:scan=6131	7.1104006	2	1500.7064	1500.7051	M	T	2	16
PSM	MEQLSDEEIDHGAEEDSDKEDQDLDK	817	sp|Q70E73|RAPH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1	ms_run[1]:scan=16257	16.742226	3	3061.2490	3061.2461	-	M	1	27
PSM	CALEDETYADGAETEVDCNR	818	sp|Q12841|FSTL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:385,1-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=18550	19.358105	2	2299.8833	2299.8840	K	C	233	253
PSM	EENQAGPEATTSDPQDLDMK	819	sp|O75781|PALM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=10485	11.11573	2	2175.933866	2174.927372	R	K	358	378
PSM	TVEEEDQIFLDGQENK	820	sp|Q96HA1|P121A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=16383	16.863553	2	1892.864121	1892.863967	R	R	324	340
PSM	AAAPAPEEEMDECEQALAAEPK	821	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=16710	17.207	2	2372.0148	2372.0148	K	A	254	276
PSM	AAAPAPEEEMDECEQALAAEPK	822	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=17177	17.708	2	2372.0148	2372.0148	K	A	254	276
PSM	AGEAAELQDAEVESSAK	823	sp|Q9NZT2-2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9552	10.292	3	1703.785	1703.7850	K	S	637	654
PSM	AGEQQLSEPEDMEMEAGDTDDPPR	824	sp|Q93009|UBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15220	15.673	3	2646.0698	2646.0698	K	I	12	36
PSM	AGGDATDSSQTALDNK	825	sp|O75122-3|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3477	4.565	2	1549.6856	1549.6856	R	A	1207	1223
PSM	APPGDEEGFDYNEEERYDCK	826	sp|Q75N03|HAKAI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	19-UNIMOD:4	ms_run[2]:scan=10942	11.523	3	2418.9546	2418.9546	K	G	55	75
PSM	ASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASK	827	sp|O60936|NOL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15090	15.528	5	3395.4648	3395.4648	R	E	130	164
PSM	CECDDGFTGADCGELK	828	sp|P24821-6|TENA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:4,3-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=10703	11.311	2	1832.6651	1832.6652	R	C	392	408
PSM	DAEDAMDAMDGAVLDGR	829	sp|Q01130-2|SRSF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:35	ms_run[2]:scan=14115	14.588	2	1766.7087	1766.7087	R	E	67	84
PSM	DAINQGMDEELERDEK	830	sp|P11177-3|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11791	12.294	2	1890.8265	1890.8265	R	V	37	53
PSM	DDDDIDLFGSDDEEESEEAK	831	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=19459	20.65	3	2271.8663	2271.8663	K	R	97	117
PSM	DELTDLDQSNVTEETPEGEEHHPVADTENK	832	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=14225	14.689	3	3377.4655	3377.4655	K	E	223	253
PSM	DESEVISQNETCSPAEVESNEK	833	sp|Q6VMQ6|MCAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:4	ms_run[2]:scan=11649	12.167	3	2480.0497	2480.0497	K	D	506	528
PSM	DGPGETDAFGNSEGK	834	sp|O94925-2|GLSK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6408	7.3695	2	1479.6114	1479.6114	K	E	107	122
PSM	DLGSTEDGDGTDDFLTDK	835	sp|Q15527|SURF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17126	17.651	2	1899.7858	1899.7858	K	E	180	198
PSM	DQEEEEIEDTLMDTEEQEEFK	836	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:35	ms_run[2]:scan=21755	24.93	3	2631.0541	2631.0541	K	A	5180	5201
PSM	DQEEEEIEDTLMDTEEQEEFK	837	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=22841	27.354	3	2615.0592	2615.0592	K	A	5180	5201
PSM	DREAAEGLGSHDR	838	sp|P17655|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=2233	3.5427	2	1411.644	1411.6440	K	A	11	24
PSM	DSEIRQIECDSEDMK	839	sp|Q96FV9|THOC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:4	ms_run[2]:scan=12550	13.107	2	1853.7771	1853.7771	K	M	596	611
PSM	EAGVEMGDEDDLSTPNEK	840	sp|P14868-2|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11437	11.969	3	1934.8051	1934.8051	R	L	257	275
PSM	EDLEEQEALEDGVACADEK	841	sp|O75691|UTP20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:4	ms_run[2]:scan=15872	16.362	2	2148.9005	2148.9005	K	A	2580	2599
PSM	EEAGGGISEEEAAQYDR	842	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9547	10.287	2	1809.7653	1809.7653	K	Q	5	22
PSM	EEAGGGISEEEAAQYDR	843	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10151	10.817	2	1809.7653	1809.7653	K	Q	5	22
PSM	EEQREELLHEPQDVDK	844	sp|Q5T5Y3-2|CAMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7141	8.079	2	1992.9389	1992.9389	K	E	683	699
PSM	EGDEVGTGITDDNEDENSANQIAGK	845	sp|Q96SY0-4|INT14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11301	11.841	3	2577.095	2577.0950	K	I	202	227
PSM	EQVMEVEEDPQTITTEETMEEDK	846	sp|Q8TEY7|UBP33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	19-UNIMOD:35	ms_run[2]:scan=16511	16.996	3	2755.1576	2755.1576	K	S	289	312
PSM	ETPDTLSDPQTVPEEEREAK	847	sp|O94822-2|LTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9233	9.9831	2	2270.055	2270.0550	K	F	201	221
PSM	ETPDTLSDPQTVPEEEREAK	848	sp|O94822-2|LTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9282	10.032	3	2270.055	2270.0550	K	F	201	221
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	849	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	27-UNIMOD:35	ms_run[2]:scan=20659	22.662	4	3772.4337	3772.4337	K	A	469	503
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	850	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=20760	22.881	5	3756.4388	3756.4388	K	A	469	503
PSM	GGMNDDEDFYDEDMGDGGGGSYR	851	sp|Q9UPT8|ZC3H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:35	ms_run[2]:scan=12785	13.326	2	2473.8547	2473.8547	K	S	355	378
PSM	GMVAEEIEEEPAAGDDEELEEEAVPQDESSQKK	852	sp|O75691|UTP20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:35	ms_run[2]:scan=16275	16.758	3	3632.5683	3632.5683	K	K	873	906
PSM	GSLGSQGAKDEPEEELQK	853	sp|Q13428-2|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5643	6.6548	3	1900.9014	1900.9014	K	G	1329	1347
PSM	KEDEPPEQAEPEPTEAWK	854	sp|P11171-7|41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9707	10.429	3	2108.9538	2108.9538	K	V	598	616
PSM	KFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	855	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	28-UNIMOD:35	ms_run[2]:scan=18525	19.322	4	3900.5287	3900.5287	K	A	468	503
PSM	KGHEENGDVVTEPQVAEK	856	sp|Q9UG63|ABCF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4158	5.1942	3	1964.9439	1964.9439	R	N	25	43
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	857	sp|P29692-2|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=16276	16.759	3	2908.1894	2908.1894	K	E	510	536
PSM	KQEETAVLEEDSADWEK	858	sp|Q96A49|SYAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=13382	13.896	3	2005.9116	2005.9116	K	E	302	319
PSM	KQEETAVLEEDSADWEK	859	sp|Q96A49|SYAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=13915	14.399	3	2005.9116	2005.9116	K	E	302	319
PSM	KTTDTASVQNEAK	860	sp|Q9ULV4|COR1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=2038	3.393	2	1391.6892	1391.6892	K	L	428	441
PSM	KVEEVLEEEEEEYVVEK	861	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=18242	18.981	3	2108.0049	2108.0049	K	V	9	26
PSM	KVEEVLEEEEEEYVVEK	862	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=18662	19.489	3	2108.0049	2108.0049	K	V	9	26
PSM	KVEEVLEEEEEEYVVEK	863	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=19011	19.991	3	2108.0049	2108.0049	K	V	9	26
PSM	LAGEELAGEEAPQEK	864	sp|Q7Z4V5-2|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8899	9.6651	2	1569.7522	1569.7522	K	A	575	590
PSM	LSVEESEAAGDGVDTK	865	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9120	9.8646	2	1605.737	1605.7370	K	V	427	443
PSM	LSVEESEAAGDGVDTK	866	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9638	10.369	2	1605.737	1605.7370	K	V	427	443
PSM	LWGDDDEEEDEEEEDNKTEETGPGMDEEDSELVAK	867	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17631	18.256	4	4012.5811	4012.5811	R	D	4778	4813
PSM	MREDYDSVEQDGDEPGPQR	868	sp|Q9Y5S9-2|RBM8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35	ms_run[2]:scan=5548	6.5311	3	2237.9131	2237.9131	R	S	49	68
PSM	NGHDPGRGHQDLDPDNEGELR	869	sp|Q9ULF5|S39AA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3996	5.042	3	2327.0275	2327.0275	R	H	286	307
PSM	QQQEELEAEHGTGDKPAAPR	870	sp|Q13895|BYST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3432	4.5291	2	2190.0301	2190.0301	R	E	64	84
PSM	RGAEEEDLGEEEEEGQAHLEDWR	871	sp|Q6ZU35|CRACD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15691	16.162	3	2712.1536	2712.1536	R	G	394	417
PSM	RPAEDMEEEQAFK	872	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6064	7.0571	2	1578.6984	1578.6984	K	R	22	35
PSM	RQQQEEDEQETAALLEEAR	873	sp|Q9BW85|YJU2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=14978	15.402	3	2272.0567	2272.0567	R	K	185	204
PSM	RTEALGDAEEDEDDEDFVEVPEK	874	sp|Q2YD98|UVSSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=16008	16.497	3	2636.1249	2636.1249	R	E	392	415
PSM	RVEVVEEDGPSEK	875	sp|O15231-2|ZN185_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4063	5.1066	2	1471.7155	1471.7155	K	S	79	92
PSM	SEDFGVNEDLADSDAR	876	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15240	15.692	2	1738.7282	1738.7282	R	A	189	205
PSM	SEQDQAENEGEDSAVLMER	877	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=12721	13.266	2	2135.8913	2135.8913	K	L	522	541
PSM	SNHYDPEEDEEYYRK	878	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4978	5.9125	3	1972.8075	1972.8075	R	Q	1263	1278
PSM	SSENSQEDQEVVVVK	879	sp|Q8N392-2|RHG18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7457	8.3538	2	1675.7901	1675.7901	K	E	43	58
PSM	SSINSVDGESPNGSSDR	880	sp|Q9NUY8-2|TBC23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4370	5.3759	2	1706.7343	1706.7343	R	G	465	482
PSM	SSRLEEDDGDVAMSDAQDGPR	881	sp|Q9UBU9-2|NXF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8427	9.2398	2	2248.9502	2248.9502	R	V	49	70
PSM	SSSNDSVDEETAESDTSPVLEK	882	sp|Q99590-2|SCAFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11098	11.659	3	2324.998	2324.9980	K	E	85	107
PSM	TEEQIAAEEAWNETEK	883	sp|Q92614-2|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15345	15.796	3	1876.8327	1876.8327	K	V	5	21
PSM	TELNSSAESEQPLDK	884	sp|Q9Y5B6-3|PAXB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7004	7.9515	2	1646.7635	1646.7635	K	T	150	165
PSM	TKGDSDEEVIQDGVR	885	sp|Q9BUE6|ISCA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6068	7.0599	2	1646.7748	1646.7748	K	V	69	84
PSM	TPPSEEDSAEAERLK	886	sp|O43765|SGTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4530	5.5277	3	1657.7795	1657.7795	R	T	81	96
PSM	TVSASESEDRLVAEQETEPSK	887	sp|Q9ULG6-3|CCPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8402	9.2189	3	2291.0765	2291.0765	K	E	184	205
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	888	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11927	12.415	4	3368.4764	3368.4764	K	E	312	341
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	889	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=12997	13.532	3	3368.4764	3368.4764	K	E	312	341
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	890	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=14474	14.918	4	3368.4764	3368.4764	K	E	312	341
PSM	VDSDKEDDITELK	891	sp|P52306-6|GDS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7291	8.2104	2	1505.7097	1505.7097	K	T	187	200
PSM	VGGGGTAGGDRWEGEDEDEDVK	892	sp|O75822-2|EIF3J_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6559	7.5409	2	2233.936	2233.9360	K	D	28	50
PSM	VSALEEDMDDVESSEEEEEEDEK	893	sp|Q8NAV1|PR38A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=18974	19.94	3	2671.0338	2671.0338	R	L	181	204
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	894	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	25-UNIMOD:35	ms_run[1]:scan=10488	11.119932	4	3790.603495	3789.614378	K	A	735	771
PSM	EQSPTAEKDEDEENDASLANSSTTTLEDK	895	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=10227	10.884052	3	3154.364690	3153.359315	K	G	978	1007
PSM	TGEDEDEEDNDALLK	896	sp|Q96FV9|THOC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=9291	10.04354	2	1691.699384	1691.700984	K	E	542	557
PSM	EESDDEAAVEEEEEEK	897	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=6164	7.140509	2	1866.719260	1865.717422	K	K	304	320
PSM	EDSHIGKDEEIPDSSK	898	sp|Q9BYW2|SETD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=3897	4.9551541	2	1784.793014	1784.806452	K	I	282	298
PSM	SEQDQAENEGEDSAVLMER	899	sp|Q99613|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=11891	12.383295	3	2135.885183	2135.891321	K	L	532	551
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	900	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=11554	12.071805	3	3368.460713	3368.476411	K	E	312	341
PSM	ENRDIEISTEEEK	901	sp|Q4G0J3|LARP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=5027	5.955273	2	1591.742091	1590.737310	K	D	330	343
PSM	AVTEQGHELSNEER	902	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=2835	4.0381657	2	1597.734301	1597.733228	K	N	30	44
PSM	CGQEEHDVLLSNEEDRK	903	sp|Q9UGI8|TES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=10104	10.775202	3	2039.8847	2039.8849	K	V	46	63
PSM	SDNEDKEETELGVMEDQR	904	sp|Q9BXB5|OSB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=10858	11.446638	2	2123.899912	2122.896072	K	S	380	398
PSM	RDIQENDEEAVQVK	905	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=5350	6.2455358	2	1672.804623	1671.806393	K	E	33	47
PSM	SQESQEADEQLVAEVVEK	906	sp|O75410|TACC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=19870	21.291783	2	2016.949351	2016.948759	K	C	91	109
PSM	QVFESDEAPDGNSYQDDQDDLK	907	sp|Q96N67|DOCK7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28	ms_run[1]:scan=18530	19.328542	2	2497.0030	2497.0036	K	R	156	178
PSM	SSDSSCQVLTDSESAEDQTK	908	sp|Q4W5G0|TIGD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	6-UNIMOD:4	ms_run[1]:scan=8450	9.2630878	2	2173.902473	2172.896466	R	A	436	456
PSM	DQTVSDNELQEMSNQGSK	909	sp|P10909-6|CLUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	12-UNIMOD:35	ms_run[1]:scan=5910	6.9177067	2	2024.8589	2024.8588	G	Y	3	21
PSM	EAGVEMGDEDDLSTPNEK	910	sp|P14868|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=11903	12.394379	2	1935.815255	1934.805132	R	L	357	375
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	911	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0		ms_run[1]:scan=23216	28.270263	4	5140.9126	5140.9086	K	R	36	81
PSM	SYESSEDCSEAAGSPARK	912	sp|Q6P6C2|ALKB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	8-UNIMOD:4	ms_run[1]:scan=2497	3.7544346	2	1930.8462	1929.8002	K	V	371	389
PSM	AAAPAPEEEMDECEQALAAEPK	913	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=12252	12.795	3	2372.0148	2372.0148	K	A	254	276
PSM	AAAPAPEEEMDECEQALAAEPK	914	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=15688	16.16	3	2372.0148	2372.0148	K	A	254	276
PSM	ACGADSYEMEEDGVRK	915	sp|P00533-2|EGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4	ms_run[2]:scan=5360	6.2547	3	1815.7404	1815.7404	R	C	310	326
PSM	ASRVPSSDEEVVEEPQSR	916	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6168	7.1454	3	1999.9447	1999.9447	R	R	1615	1633
PSM	ATEDGEEDEEMIESIENLEDLK	917	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:35	ms_run[2]:scan=21602	24.572	3	2553.08	2553.0800	R	G	157	179
PSM	AVDLVEEESGAPGEEQR	918	sp|O60231|DHX16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11377	11.914	3	1813.833	1813.8330	R	R	311	328
PSM	DCNDTLEEENTNLETPTK	919	sp|Q9BZE2|PUS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4	ms_run[2]:scan=11720	12.233	3	2121.9008	2121.9008	R	R	452	470
PSM	DGEQHEDLNEVAK	920	sp|O95831-3|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4345	5.3564	2	1482.6587	1482.6587	K	L	590	603
PSM	DGGGRGPDELEGPDSK	921	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4342	5.3544	3	1584.7016	1584.7016	R	L	209	225
PSM	DGQVINETSQHHDDLE	922	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7056	7.9981	2	1835.7922	1835.7922	R	-	451	467
PSM	DGTDGETEVGEIQQNK	923	sp|Q6NZY4-2|ZCHC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7554	8.4537	2	1718.7595	1718.7595	K	S	102	118
PSM	DIDDDLEGEVTEECGK	924	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:4	ms_run[2]:scan=17424	17.995	2	1822.7415	1822.7415	K	F	414	430
PSM	EADLAAQEEAAKK	925	sp|Q9Y3B7-2|RM11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=3315	4.4373	2	1372.6834	1372.6834	K	-	154	167
PSM	EAEEPGPDSENSQENPPLR	926	sp|Q8WXG6-6|MADD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7679	8.5722	2	2093.9138	2093.9138	K	S	681	700
PSM	EAGVEMGDEDDLSTPNEK	927	sp|P14868-2|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11339	11.878	2	1934.8051	1934.8051	R	L	257	275
PSM	EASQPETEGGGNSQQEPVVGDEEPALH	928	sp|A4D2B0|MBLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12654	13.201	3	2790.2216	2790.2216	R	-	240	267
PSM	EEEEEAAAAAAMATEGGK	929	sp|Q02446|SP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13883	14.369	3	1763.752	1763.7520	K	T	7	25
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	930	sp|P08621-2|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:35	ms_run[2]:scan=13891	14.375	3	3915.6501	3915.6501	K	G	298	338
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	931	sp|P08621-2|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14907	15.334	3	3899.6552	3899.6552	K	G	298	338
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	932	sp|P08621-2|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15399	15.849	3	3899.6552	3899.6552	K	G	298	338
PSM	EEPVSEEGEEDEEQEAEEEPMDTSPSGLHSK	933	sp|Q9NVU0-3|RPC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12132	12.661	3	3458.3951	3458.3951	K	L	499	530
PSM	EEVAYDPEDETILEEAK	934	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=18838	19.72	2	1978.8895	1978.8895	R	V	1422	1439
PSM	EIESEIDSEEELINK	935	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15422	15.872	2	1775.8313	1775.8313	K	K	755	770
PSM	ENALDRAEQAEADK	936	sp|P09493-9|TPM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6152	7.1297	2	1558.7223	1558.7223	K	K	16	30
PSM	EPLEDGDPEDDRTLDDDELAEYDLDK	937	sp|Q13610-2|PWP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=19505	20.714	3	3021.2735	3021.2735	R	Y	74	100
PSM	EQSELDQDLDDVEEVEEEETGEETK	938	sp|P55209-2|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=20464	22.288	3	2923.2102	2923.2102	K	L	8	33
PSM	EQVEPTPEDEDDDIELR	939	sp|Q86TG7-2|PEG10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14456	14.902	2	2027.8807	2027.8807	R	G	46	63
PSM	ESSEEEYDSGVEEEGWPR	940	sp|O76031|CLPX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14630	15.067	2	2112.8396	2112.8396	K	Q	609	627
PSM	ESSEEEYDSGVEEEGWPR	941	sp|O76031|CLPX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15149	15.598	2	2112.8396	2112.8396	K	Q	609	627
PSM	ETGHVSGPDGQNPEK	942	sp|Q9NVI1|FANCI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=2244	3.5522	2	1550.6961	1550.6961	K	I	855	870
PSM	GEDPFTSETVDPEMEGDDNLGGEDK	943	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:35	ms_run[2]:scan=17355	17.911	3	2698.0712	2698.0712	K	K	542	567
PSM	GGTVADLDEQDEETVTAGGKEDEDPAK	944	sp|Q92922|SMRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12705	13.252	3	2775.2206	2775.2206	K	G	402	429
PSM	HCECSTDEVNSEDMDAYCR	945	sp|P05556-2|ITB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,4-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=7702	8.5914	3	2376.8351	2376.8351	R	K	499	518
PSM	HQGAEELLDEESR	946	sp|Q567U6|CCD93_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8310	9.1342	2	1511.6852	1511.6852	R	I	185	198
PSM	IAAESSENVDCPENPK	947	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:4	ms_run[2]:scan=5135	6.0542	2	1758.773	1758.7730	K	I	578	594
PSM	IDEAESLNDEELEEK	948	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11980	12.461	2	1761.7792	1761.7792	K	E	820	835
PSM	IDGAEPLTPEETEEK	949	sp|P28370-2|SMCA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10346	10.989	2	1656.773	1656.7730	K	E	823	838
PSM	IEDSGENLETEPLESQDR	950	sp|P78345|RPP38_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12540	13.097	3	2059.9182	2059.9182	R	E	212	230
PSM	IEENSLKEEESIEGEK	951	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8025	8.881	3	1861.8793	1861.8793	K	E	1566	1582
PSM	ILEQEEEEEQAGKPGEPSK	952	sp|Q9BXP5-5|SRRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5609	6.6121	3	2126.0015	2126.0015	R	K	231	250
PSM	KDDENIPMETEETHLEETTESQQNGEEGTSTPEDK	953	sp|Q969G3-3|SMCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13321	13.838	3	3976.6764	3976.6764	K	E	263	298
PSM	KVEEVLEEEEEEYVVEK	954	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=19373	20.498	3	2108.0049	2108.0049	K	V	9	26
PSM	KVEEVLEEEEEEYVVEK	955	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=20305	22.007	3	2108.0049	2108.0049	K	V	9	26
PSM	KVEEVLEEEEEEYVVEK	956	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=20588	22.509	3	2108.0049	2108.0049	K	V	9	26
PSM	KVEEVLEEEEEEYVVEK	957	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=19683	21.003	3	2108.0049	2108.0049	K	V	9	26
PSM	LAEGEEEKPEPDISSEESVSTVEEQENETPPATSSEAEQPK	958	sp|Q5SSJ5-5|HP1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14626	15.062	4	4441.978	4441.9780	K	G	57	98
PSM	LFEESDDKEDEDADGK	959	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5077	6.0015	3	1840.7487	1840.7487	K	E	672	688
PSM	LGDVTDADSEADENEQVSAV	960	sp|Q8TEU7|RPGF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15342	15.792	2	2062.8815	2062.8815	K	-	1582	1602
PSM	LSEGQEEENLENEMK	961	sp|Q15276-2|RABE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13395	13.908	2	1777.7676	1777.7676	R	K	161	176
PSM	LSVEESEAAGDGVDTK	962	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10785	11.383	2	1605.737	1605.7370	K	V	427	443
PSM	LTSIGSDEDEETETYQEK	963	sp|Q9UHW9-6|S12A6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9385	10.139	2	2072.891	2072.8910	R	V	961	979
PSM	MEDSVGCLETAEEVK	964	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=12288	12.833	2	1711.7281	1711.7281	K	R	1373	1388
PSM	MGDEDDDESCAVELR	965	sp|O75676-2|KS6A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:4	ms_run[2]:scan=10517	11.144	2	1739.6614	1739.6614	-	I	1	16
PSM	MQMLEDEDDLAYAETEK	966	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35	ms_run[2]:scan=16461	16.941	2	2045.8446	2045.8446	K	K	4346	4363
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	967	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9818	10.524	5	3365.4516	3365.4516	K	K	799	833
PSM	NSDHGEDEVIAVSEK	968	sp|Q14865|ARI5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6868	7.8339	2	1627.7326	1627.7326	R	V	87	102
PSM	NSFREQLEEEEEAK	969	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10018	10.7	2	1736.7853	1736.7853	K	H	1339	1353
PSM	NSFREQLEEEEEAK	970	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14511	14.956	2	1736.7853	1736.7853	K	H	1339	1353
PSM	NSGQNLEEDMGQSEQK	971	sp|Q9HAV7|GRPE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6101	7.0849	2	1792.7534	1792.7534	K	A	35	51
PSM	QDPGDNWEEGGGGGGGMEK	972	sp|Q9UKY7-3|CDV3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8057	8.9111	2	1875.733	1875.7330	R	S	16	35
PSM	QEEEMMAKEEELVK	973	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:35	ms_run[2]:scan=8094	8.9464	2	1737.7801	1737.7801	R	V	843	857
PSM	QEEQEPTGEEPAVLGGDK	974	sp|Q6NS38-2|ALKB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10604	11.221	2	1911.8698	1911.8698	K	E	17	35
PSM	QLSESESSLEMDDER	975	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10062	10.737	2	1753.7312	1753.7312	R	Y	321	336
PSM	QQMAEEMVEAAGEDER	976	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14970	15.396	3	1821.7509	1821.7509	K	E	817	833
PSM	QSQQEAEEEEREEEEEAQIIQR	977	sp|Q9NQZ2|SAS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12789	13.33	2	2716.206	2716.2060	R	R	149	171
PSM	RLDEEEEDNEGGEWER	978	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7067	8.008	2	1990.8141	1990.8141	K	V	278	294
PSM	SANAEDAQEFSDVER	979	sp|Q9HCY8|S10AE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9395	10.152	2	1666.7071	1666.7071	R	A	6	21
PSM	SASELTAGAEAEAEEVK	980	sp|Q9H0U9|TSYL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13517	14.024	3	1690.7897	1690.7897	R	T	140	157
PSM	SATPEPVTDNRDVEDMELSDVEDDGSK	981	sp|Q5VT52-5|RPRD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16509	16.994	3	2949.2669	2949.2669	K	I	330	357
PSM	SDEREVAEAATGEDASSPPPK	982	sp|Q99536-3|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6577	7.5583	3	2141.9713	2141.9713	M	T	2	23
PSM	SDTVADIESEPVVESTETEGT	983	sp|Q9UPN6|SCAF8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=18781	19.654	2	2193.9649	2193.9649	K	-	1251	1272
PSM	SETRENGVTDDLDAPK	984	sp|Q9BQ39|DDX50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6012	7.0145	2	1745.8068	1745.8068	K	A	45	61
PSM	SGGAATVEEAPSEFEEEASRK	985	sp|Q8TF64|GIPC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13823	14.316	3	2179.9869	2179.9869	R	V	226	247
PSM	SISCEEATCSDTSESILEEEPQENQK	986	sp|O94763-2|RMP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=14866	15.292	3	2999.2496	2999.2496	R	K	364	390
PSM	SPYEAENSGEELDQR	987	sp|Q9NPC7-3|MYNN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6940	7.8971	2	1722.7333	1722.7333	K	Y	282	297
PSM	SQESQEADEQLVAEVVEK	988	sp|O75410-7|TACC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=19648	20.944	2	2016.9488	2016.9488	K	C	46	64
PSM	SSSDDEEQLTELDEEMENEICR	989	sp|Q96ER3|SAAL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	21-UNIMOD:4	ms_run[2]:scan=22536	26.671	3	2657.0592	2657.0593	K	V	54	76
PSM	STSCDDTPDGAGGAFAAQPEDCDGEK	990	sp|O95613|PCNT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=10411	11.052	3	2657.013	2657.0130	K	R	72	98
PSM	STSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAK	991	sp|Q12797-9|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16976	17.496	4	3937.7865	3937.7865	R	E	99	135
PSM	TECAEPPRDEPPADGALK	992	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:4	ms_run[2]:scan=6723	7.6965	3	1951.8946	1951.8946	R	R	9	27
PSM	TEETGPGMDEEDSELVAK	993	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:35	ms_run[2]:scan=8562	9.3596	2	1951.8204	1951.8204	K	D	4795	4813
PSM	TEPEEVSIEDSAQSDLK	994	sp|Q16666-3|IF16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14183	14.647	3	1875.8585	1875.8585	K	E	450	467
PSM	TGEDEDEEDNDALLK	995	sp|Q96FV9|THOC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9146	9.8902	2	1691.701	1691.7010	K	E	542	557
PSM	TGEPHCPGDEDETFK	996	sp|O75976-2|CBPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4	ms_run[2]:scan=4574	5.5657	3	1717.689	1717.6890	K	D	57	72
PSM	TPEVTDATEEIDK	997	sp|A6H8Y1-5|BDP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10708	11.315	2	1446.6726	1446.6726	K	N	360	373
PSM	TSEQTGEPAEDTSGVIK	998	sp|Q9NX74|DUS2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7217	8.1492	2	1747.8112	1747.8112	K	M	338	355
PSM	TSGRVAVEEVDEEGK	999	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4796	5.756	3	1603.7689	1603.7689	R	F	436	451
PSM	TVNEDVEEMEIDEQTK	1000	sp|Q9NRL2-2|BAZ1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:35	ms_run[2]:scan=9652	10.379	2	1923.8255	1923.8255	K	V	998	1014
PSM	TVNEDVEEMEIDEQTK	1001	sp|Q9NRL2-2|BAZ1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14165	14.631	3	1907.8306	1907.8306	K	V	998	1014
PSM	TVSASESEDRLVAEQETEPSK	1002	sp|Q9ULG6-3|CCPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8417	9.2323	2	2291.0765	2291.0765	K	E	184	205
PSM	TYEDMTLEELEDHEDEFNEEDER	1003	sp|Q9H2J4|PDCL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:35	ms_run[2]:scan=20049	21.623	3	2932.1353	2932.1353	K	A	47	70
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	1004	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12947	13.48	4	3368.4764	3368.4764	K	E	312	341
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	1005	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=18751	19.616	4	3368.4764	3368.4764	K	E	312	341
PSM	VDNVEVLDHEEEK	1006	sp|O00443|P3C2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7298	8.2151	2	1553.7209	1553.7209	K	N	281	294
PSM	VDSEGDFSENDDAAGDFR	1007	sp|O43823|AKAP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12534	13.091	2	1944.761	1944.7610	R	S	321	339
PSM	YQGDGIVEDEEETMENNEEK	1008	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:35	ms_run[2]:scan=9863	10.564	3	2372.9438	2372.9438	K	K	841	861
PSM	QEEEMMAKEEELVK	1009	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28	ms_run[1]:scan=18133	18.838067	2	1704.7574	1704.7581	R	V	843	857
PSM	QEEELQAKDEELLK	1010	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28	ms_run[1]:scan=16349	16.829841	2	1683.8199	1683.8198	R	V	850	864
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	1011	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28	ms_run[1]:scan=18078	18.784329	3	3557.4633	3557.4603	K	A	737	771
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	1012	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:27	ms_run[1]:scan=8021	8.8781707	3	2964.3612	2963.3742	K	G	56	88
PSM	KDDENIPMETEETHLEETTESQQNGEEGTSTPEDK	1013	sp|Q969G3|SMCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=14348	14.802232	4	3977.675334	3976.676369	K	E	333	368
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	1014	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=10296	10.945846	3	3366.444775	3365.451593	K	K	799	833
PSM	YKLDEDEDEDDADLSK	1015	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=8279	9.1072455	2	1898.826112	1898.790527	K	Y	167	183
PSM	AAEAAAAPAESAAPAAGEEPSKEEGEPK	1016	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=6325	7.2801674	5	2636.229679	2635.224934	K	K	122	150
PSM	TEEQIAAEEAWNETEK	1017	sp|Q92614|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=15371	15.822061	2	1876.840350	1876.832667	K	V	336	352
PSM	TEALGDAEEDEDDEDFVEVPEK	1018	sp|Q2YD98|UVSSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=18163	18.876229	2	2479.995135	2480.023835	R	E	393	415
PSM	AAELTATQVEEEEEEEDFRK	1019	sp|O75717|WDHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=16597	17.094002	3	2353.068486	2352.060495	K	K	820	840
PSM	ELRDEEQTAESIK	1020	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=5748	6.7433219	2	1547.752170	1546.747481	K	N	314	327
PSM	HYEDEEDDEEDAPGNDPQEAVPSAAGK	1021	sp|P19447|ERCC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=8620	9.4106083	3	2915.162563	2913.169664	R	Q	18	45
PSM	ERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAK	1022	sp|Q12797|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=16697	17.195017	4	4224.923256	4222.930216	K	E	111	149
PSM	SEQDQAENEGEDSAVLMER	1023	sp|Q99613|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=12232	12.770254	3	2135.885183	2135.891321	K	L	532	551
PSM	DAPGEDEEEDGVSEAASLEEPK	1024	sp|Q9H0E9|BRD8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=15745	16.215365	3	2302.964269	2301.960840	K	E	625	647
PSM	DYEEVGVDSVEGEGEEEGEEY	1025	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=22215	25.977975	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	1026	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=21087	23.461477	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	1027	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=23480	28.999068	2	2347.901016	2347.897571	K	-	431	452
PSM	AAAAPVAADDDERR	1028	sp|Q9H5N1|RABE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1	ms_run[1]:scan=6258	7.2235332	2	1468.6916	1468.6901	M	R	2	16
PSM	QHLENDPGSNEDTDIPK	1029	sp|O43396|TXNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28	ms_run[1]:scan=9976	10.662656	3	1890.8220	1890.8226	K	G	105	122
PSM	EDIESQEIEAQEGEDDTFLTAQDGEEEENEK	1030	sp|Q9NWH9|SLTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=19487	20.690787	3	3557.462283	3555.465631	K	D	166	197
PSM	EHGQCADVDECSLAEK	1031	sp|Q6UXH1|CREL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:27,5-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=7207	8.1378512	2	1828.7267	1828.7351	R	T	284	300
PSM	MEGAGENAPESSSSAPGSEESARDPQVPPPEEESGDCAR	1032	sp|Q9BYX2|TBD2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,37-UNIMOD:4	ms_run[1]:scan=13279	13.800485	4	4041.6773	4041.6707	-	S	1	40
PSM	EAGVEMGDEDDLSTPNEK	1033	sp|P14868|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=10776	11.37449	2	1935.811562	1934.805132	R	L	357	375
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	1034	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0		ms_run[1]:scan=20664	22.675292	4	5140.9024	5140.9086	K	R	36	81
PSM	MDIEDEENMSSSSTDVK	1035	sp|P78563|RED1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1	ms_run[1]:scan=17601	18.218525	2	1957.7738	1957.7763	-	E	1	18
PSM	AALSASEGEEVPQDK	1036	sp|O95831-3|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7016	7.9624	2	1529.7209	1529.7209	K	A	109	124
PSM	AAQSNENLSDSQQEPPK	1037	sp|P49750|YLPM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3515	4.5985	2	1841.8391	1841.8391	K	S	895	912
PSM	AEDGATPSPSNETPKK	1038	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=2380	3.6611	2	1627.7689	1627.7689	K	K	138	154
PSM	AEENTDQASPQEDYAGFER	1039	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11223	11.772	3	2155.893	2155.8930	K	L	4530	4549
PSM	AEIPCEDEQEQEHNGPLDNK	1040	sp|Q96SB4-4|SRPK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:4	ms_run[2]:scan=7928	8.7916	3	2350.9972	2350.9972	R	G	435	455
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAKK	1041	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19428	20.592	3	3349.4594	3349.4594	M	D	2	34
PSM	ASRVPSSDEEVVEEPQSR	1042	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6177	7.1521	2	1999.9447	1999.9447	R	R	1615	1633
PSM	CPEILSDESSSDEDEK	1043	sp|P35659-2|DEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4	ms_run[2]:scan=8641	9.4285	2	1838.7364	1838.7364	K	K	188	204
PSM	DDCDETGIEEANELTK	1044	sp|O60503|ADCY9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4	ms_run[2]:scan=14149	14.618	2	1837.7524	1837.7524	K	L	1331	1347
PSM	DDNFGEGNDGGILDDK	1045	sp|O60216|RAD21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14893	15.321	2	1679.6911	1679.6911	K	L	217	233
PSM	DEEAALADGEDVPYENSVR	1046	sp|Q96Q15-2|SMG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16758	17.257	3	2077.9076	2077.9076	K	Q	3295	3314
PSM	DGLTNAGELESDSGSDK	1047	sp|P35226|BMI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9704	10.426	2	1693.7279	1693.7279	R	A	241	258
PSM	DIDDDLEGEVTEECGK	1048	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:4	ms_run[2]:scan=13868	14.356	2	1822.7415	1822.7415	K	F	414	430
PSM	DITAEEEQEEVENLK	1049	sp|Q8TE04-3|PANK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15867	16.356	2	1774.8109	1774.8109	K	S	32	47
PSM	DSGQESESIPEYTAEEER	1050	sp|Q8WUY3-4|PRUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11721	12.234	2	2054.8553	2054.8553	K	E	2860	2878
PSM	DSGSDEDFLMEDDDDSDYGSSKK	1051	sp|Q9H1E3-2|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14670	15.104	3	2555.9606	2555.9606	K	K	89	112
PSM	DTDVEEGSEVEDERPAWNSK	1052	sp|Q9H2J7-2|S6A15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11056	11.623	3	2290.9826	2290.9826	K	L	48	68
PSM	DVDSEISDLENEVENK	1053	sp|Q96SB8|SMC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22462	26.53	2	1833.8116	1833.8116	R	T	663	679
PSM	EAAEPLSEPKEDQEAAELLSEPEEESER	1054	sp|Q63HN8|RN213_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19137	20.183	3	3140.4157	3140.4157	R	H	1239	1267
PSM	EATDEELERTLDK	1055	sp|Q13619-2|CUL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10354	10.999	2	1547.7315	1547.7315	K	I	323	336
PSM	EEAGGGISEEEAAQYDR	1056	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10720	11.326	2	1809.7653	1809.7653	K	Q	5	22
PSM	EEAGGGISEEEAAQYDR	1057	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12413	12.965	2	1809.7653	1809.7653	K	Q	5	22
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	1058	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16180	16.666	3	3657.4246	3657.4246	K	R	176	207
PSM	EEMDEAGNKVEQCK	1059	sp|Q68EM7-4|RHG17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:4	ms_run[2]:scan=3167	4.3178	2	1665.6974	1665.6974	K	D	178	192
PSM	EEQELMEEINEDEPVK	1060	sp|O14776-2|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18415	19.185	3	1959.8619	1959.8619	K	A	588	604
PSM	EGDVEEPTDDSLPTTGDAGGREPMEEK	1061	sp|Q9UKN8|TF3C4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	24-UNIMOD:35	ms_run[2]:scan=10048	10.725	3	2876.2142	2876.2142	K	L	642	669
PSM	EGEAAAVEGPCPSQESLSQEENPEPTEDER	1062	sp|Q86W50|MET16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:4	ms_run[2]:scan=13151	13.68	3	3270.3743	3270.3743	R	S	438	468
PSM	EGEDSSVIHYDDK	1063	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5916	6.9242	2	1492.6318	1492.6318	K	A	1240	1253
PSM	EGEEPQASAQDETPITSAK	1064	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8065	8.9192	2	1986.9018	1986.9018	K	E	1492	1511
PSM	EHLLDDEEEDEEIMR	1065	sp|Q9Y4E6-2|WDR7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14465	14.909	2	1900.7997	1900.7997	K	Q	756	771
PSM	EHLLDDEEEDEEIMR	1066	sp|Q9Y4E6-2|WDR7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14504	14.948	3	1900.7997	1900.7997	K	Q	756	771
PSM	EIESEIDSEEELINK	1067	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18999	19.975	2	1775.8313	1775.8313	K	K	755	770
PSM	EIFDDDLEDDALDADEK	1068	sp|P09884|DPOLA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20395	22.174	2	1966.8167	1966.8167	R	G	93	110
PSM	EIPLSETERGEVEEDK	1069	sp|Q14789-4|GOGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9158	9.9063	2	1858.8796	1858.8796	K	E	951	967
PSM	EIVEVKEENIEDATEK	1070	sp|P82970|HMGN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12050	12.557	2	1873.9157	1873.9157	K	G	96	112
PSM	ELEIESQTEEQPTTK	1071	sp|Q9NYH9|UTP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9414	10.168	2	1760.8316	1760.8316	R	Q	281	296
PSM	ELPTSQKGDDGPDIADEESR	1072	sp|O14686|KMT2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8437	9.2513	3	2157.9662	2157.9662	K	G	1816	1836
PSM	EQVMEVEEDPQTITTEETMEEDK	1073	sp|Q8TEY7|UBP33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18157	18.868	2	2739.1627	2739.1627	K	S	289	312
PSM	ERLGMSADPDNEDATDK	1074	sp|O75152|ZC11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5590	6.589	2	1862.7952	1862.7952	K	V	333	350
PSM	ETKPEPMEEDLPENK	1075	sp|P31948-3|STIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7311	8.2265	2	1784.8138	1784.8138	K	K	184	199
PSM	FEDEGAGFEESSETGDYEEK	1076	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12351	12.902	3	2253.871	2253.8710	K	A	926	946
PSM	FRENPDQVEPEDGSDVSPGPNSEDSIEEVK	1077	sp|Q96JN0-3|LCOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13984	14.465	4	3300.4542	3300.4542	K	E	1261	1291
PSM	GADNDGSGSESGYTTPK	1078	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3248	4.3813	2	1641.6754	1641.6754	K	K	206	223
PSM	GDAEKPEEELEEDDDEELDETLSER	1079	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21106	23.498	3	2920.2105	2920.2105	K	L	23	48
PSM	GLAEVQQDGEAEEGATSDGEK	1080	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9406	10.162	2	2118.9189	2118.9189	K	K	477	498
PSM	GLGEHEMEEDEEDYESSAK	1081	sp|Q9UIQ6-3|LCAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9532	10.273	3	2182.8485	2182.8485	R	L	38	57
PSM	GMVAEEIEEEPAAGDDEELEEEAVPQDESSQKK	1082	sp|O75691|UTP20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17940	18.612	3	3616.5734	3616.5734	K	K	873	906
PSM	IAECSSQLAEEEEK	1083	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:4	ms_run[2]:scan=6204	7.1759	2	1621.7141	1621.7141	R	A	1008	1022
PSM	IDDPIDEEEEFEELK	1084	sp|Q8WWQ0|PHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20738	22.837	2	1848.8153	1848.8153	K	G	1746	1761
PSM	KAEEELGELEAK	1085	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6932	7.8913	2	1344.6773	1344.6773	R	L	684	696
PSM	KGHEENGDVVTEPQVAEK	1086	sp|Q9UG63|ABCF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4232	5.26	4	1964.9439	1964.9439	R	N	25	43
PSM	KIDDPIDEEEEFEELK	1087	sp|Q8WWQ0|PHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19163	20.217	3	1976.9102	1976.9102	K	G	1745	1761
PSM	KPESEGYLQEEK	1088	sp|Q53EZ4-2|CEP55_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3407	4.5078	2	1435.6831	1435.6831	K	Q	222	234
PSM	KVEEVLEEEEEEYVVEK	1089	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19986	21.505	3	2108.0049	2108.0049	K	V	9	26
PSM	KYEEIDNAPEER	1090	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4135	5.1756	2	1491.6842	1491.6842	K	A	91	103
PSM	LEDVDEEINAENVESK	1091	sp|Q92834-4|RPGR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13557	14.062	2	1831.8323	1831.8323	K	K	585	601
PSM	LEDVDEEINAENVESK	1092	sp|Q92834-4|RPGR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13567	14.07	2	1831.8323	1831.8323	K	K	585	601
PSM	LPPNTNDEVDEDPTGNK	1093	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7707	8.5972	2	1853.8279	1853.8279	R	A	1058	1075
PSM	MQMLEDEDDLAYAETEK	1094	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:35	ms_run[2]:scan=15572	16.04	2	2045.8446	2045.8446	K	K	4346	4363
PSM	NSFREQLEEEEEAK	1095	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10592	11.21	2	1736.7853	1736.7853	K	H	1339	1353
PSM	NSFREQLEEEEEAK	1096	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12691	13.237	2	1736.7853	1736.7853	K	H	1339	1353
PSM	NSFREQLEEEEEAK	1097	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13968	14.447	2	1736.7853	1736.7853	K	H	1339	1353
PSM	NSNQLGGNTESSESSETCSSK	1098	sp|Q9H9A5-2|CNO10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	18-UNIMOD:4	ms_run[2]:scan=2777	3.9862	2	2201.8979	2201.8979	K	S	486	507
PSM	PCCAVDPIENEEDR	1099	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,3-UNIMOD:4	ms_run[2]:scan=9877	10.577	2	1702.6927	1702.6927	K	K	3695	3709
PSM	PGEQEKEEDIAVLAEEK	1100	sp|Q8TAF3-5|WDR48_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13071	13.602	3	1912.9266	1912.9266	K	I	347	364
PSM	QEEEEEEELLPVNGSQEEAK	1101	sp|Q9NZ53-2|PDXL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15401	15.851	3	2315.0289	2315.0289	K	P	181	201
PSM	QHLENDPGSNEDTDIPK	1102	sp|O43396|TXNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5499	6.4848	3	1907.8497	1907.8497	K	G	105	122
PSM	QMEEEGEEFTEGEHPETLSR	1103	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11848	12.345	2	2362.9859	2362.9859	K	L	1056	1076
PSM	REFLNEDDPEEK	1104	sp|Q9BWU1-2|CDK19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6080	7.0679	2	1519.6791	1519.6791	K	G	296	308
PSM	RGHTASESDEQQWPEEK	1105	sp|Q9NTI5|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3079	4.24	3	2012.8824	2012.8824	K	R	1252	1269
PSM	RPAEDMEEEQAFK	1106	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:35	ms_run[2]:scan=6087	7.0751	2	1594.6933	1594.6933	K	R	22	35
PSM	RPLEDGDQPDAK	1107	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=2482	3.7414	2	1339.6368	1339.6368	K	K	65	77
PSM	RQLEEAEEEATR	1108	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3516	4.5992	2	1459.6903	1459.6903	K	A	1884	1896
PSM	RQPQEEVVHEDQGK	1109	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=2357	3.6433	2	1677.8071	1677.8071	R	K	989	1003
PSM	SDKTEEIAEEEETVFPK	1110	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16662	17.163	3	1979.9211	1979.9211	K	A	38	55
PSM	SEDEDSLEEAGSPAPGPCPR	1111	sp|Q8TBB5-2|KLDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	18-UNIMOD:4	ms_run[2]:scan=10311	10.959	3	2098.8749	2098.8749	R	S	356	376
PSM	SEPQSPTEELSEAETESKPQTEGK	1112	sp|Q92543-2|SNX19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11731	12.241	3	2617.1879	2617.1879	R	K	695	719
PSM	SGERPVTAGEEDEQVPDSIDAR	1113	sp|Q9Y3D0|CIA2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10301	10.95	4	2356.0779	2356.0779	R	E	23	45
PSM	SLDGALYDDEDDDDIER	1114	sp|Q6P3S1|DEN1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15825	16.306	2	1954.7916	1954.7916	K	A	514	531
PSM	SNHYDPEEDEEYYRK	1115	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5003	5.9343	2	1972.8075	1972.8075	R	Q	1263	1278
PSM	SPDEEDYDYESYEK	1116	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10163	10.828	2	1767.6635	1767.6635	R	T	1881	1895
PSM	SQESQEADEQLVAEVVEK	1117	sp|O75410-7|TACC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19935	21.427	3	2016.9488	2016.9488	K	C	46	64
PSM	STSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAK	1118	sp|Q12797-9|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17417	17.988	3	3937.7865	3937.7865	R	E	99	135
PSM	SVQEGENPDDGVRGSPPEDYR	1119	sp|P42696-2|RBM34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6720	7.6923	3	2302.0098	2302.0098	R	L	14	35
PSM	TATDSDERIDDEIDTEVEETQEEK	1120	sp|Q8N5P1|ZC3H8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16953	17.47	3	2796.1945	2796.1945	K	I	18	42
PSM	TDKVDFDSAEDTR	1121	sp|Q5VZ89-5|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5675	6.6825	2	1497.6583	1497.6583	K	L	661	674
PSM	TENEAPIEISSDDSK	1122	sp|Q96QE3-2|ATAD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9739	10.457	2	1633.7319	1633.7319	K	E	128	143
PSM	TLEEDVDDRAPSK	1123	sp|Q13823|NOG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5277	6.1787	2	1473.6947	1473.6947	K	K	642	655
PSM	TLGETSANAETEQNK	1124	sp|Q5UIP0-2|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3359	4.4714	2	1591.7326	1591.7326	K	K	1489	1504
PSM	TTGEENGVEAEEWGK	1125	sp|O00429-4|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8637	9.4254	2	1634.706	1634.7060	K	F	78	93
PSM	TVNEDVEEMEIDEQTK	1126	sp|Q9NRL2-2|BAZ1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:35	ms_run[2]:scan=9605	10.338	2	1923.8255	1923.8255	K	V	998	1014
PSM	VAGESAEPEPEPEADYYAK	1127	sp|P01137|TGFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11054	11.622	3	2050.9007	2050.9007	R	E	88	107
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	1128	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17281	17.83	4	3368.4764	3368.4764	K	E	312	341
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	1129	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19445	20.625	4	3368.4764	3368.4764	K	E	312	341
PSM	VEEDDYPSEELLEDENAINAK	1130	sp|Q5JRA6|TGO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20062	21.642	3	2421.0707	2421.0707	K	R	720	741
PSM	VELSEDSPNSEQDLEK	1131	sp|Q5T5P2-4|SKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9431	10.182	2	1817.8167	1817.8167	K	L	707	723
PSM	VGLSESEVEPSEENSK	1132	sp|Q99675|CGRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8872	9.6389	2	1718.7847	1718.7847	K	D	257	273
PSM	WSLEDDDDDEDDPAEAEK	1133	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14843	15.27	3	2092.7869	2092.7869	K	E	198	216
PSM	YTEEDPSGETLSSENK	1134	sp|Q2NKX8|ERC6L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6036	7.033	2	1784.7588	1784.7588	K	S	1141	1157
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	1135	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=15370	15.821286	4	3774.618927	3773.619463	K	A	735	771
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	1136	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=7889	8.7584702	4	2982.370147	2981.385017	K	G	56	88
PSM	SIDGTADDEDEGVPTDQAIR	1137	sp|Q9NTI5|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=12235	12.772593	3	2102.929176	2102.924001	K	A	628	648
PSM	EAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEER	1138	sp|O60936|NOL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=21650	24.668884	4	4477.920575	4477.913288	K	D	164	203
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	1139	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	10-UNIMOD:35	ms_run[1]:scan=14325	14.780644	4	3915.655646	3915.650095	K	G	307	347
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	1140	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	10-UNIMOD:35	ms_run[1]:scan=15089	15.527251	5	3916.683801	3915.650095	K	G	307	347
PSM	GQEADLEAGGEEVPEANGSAGK	1141	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=10380	11.022658	2	2114.926698	2113.939986	K	R	226	248
PSM	AEEPPSQLDQDTQVQDMDEGSDDEEEGQK	1142	sp|Q15459|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=13000	13.53607	3	3250.310824	3248.305900	K	V	339	368
PSM	VYDPKNEEDDMVEMEEER	1143	sp|P80303|NUCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=14114	14.586925	3	2256.937198	2255.919844	K	L	277	295
PSM	KGHEENGDVVTEPQVAEK	1144	sp|Q9UG63|ABCF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=4766	5.7305709	2	1965.930193	1964.943949	R	N	25	43
PSM	QVVEQDEEEDEELTLK	1145	sp|P49768|PSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=13617	14.119531	2	1932.896193	1931.884762	R	Y	61	77
PSM	DLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNK	1146	sp|Q6NXS1|IPP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:35	ms_run[1]:scan=11798	12.299716	4	4283.665306	4283.662252	K	L	164	202
PSM	CHAEHTPEEEIDHTGAK	1147	sp|O95757|HS74L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=4256	5.2831416	4	1942.8117	1942.8110	K	T	540	557
PSM	SSDDTTDAQMDEQDLNEPLAK	1148	sp|Q14BN4|SLMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	10-UNIMOD:35	ms_run[1]:scan=11371	11.907844	2	2337.994724	2337.975445	K	V	458	479
PSM	ATEMVEVGADDDEGGAERGEAGDLR	1149	sp|Q6NZI2|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=13294	13.813877	3	2548.100009	2548.098354	K	R	338	363
PSM	NSTPSEPGSGRGPPQEEEEEEDEEEEATK	1150	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=6469	7.4441547	3	3174.308346	3172.307614	K	E	198	227
PSM	EIESEIDSEEELINK	1151	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=18932	19.875459	2	1775.830853	1775.831270	K	K	755	770
PSM	EIESEIDSEEELINK	1152	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=19009	19.987269	2	1776.831592	1775.831270	K	K	755	770
PSM	QPCPSESDIITEEDK	1153	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,3-UNIMOD:4	ms_run[1]:scan=16094	16.586355	2	1729.7355	1729.7347	K	S	202	217
PSM	DYEEVGVDSVEGEGEEEGEEY	1154	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=18966	19.927818	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	1155	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=19329	20.432162	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	1156	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=22896	27.488959	2	2347.901016	2347.897571	K	-	431	452
PSM	EGVIEPDTDAPQEMGDENAEITEEMMDQANDK	1157	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	14-UNIMOD:35	ms_run[1]:scan=20361	22.116143	3	3568.423735	3566.449470	K	K	86	118
PSM	SHGKDEECVLEAENK	1158	sp|Q9UHQ4|BAP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	8-UNIMOD:4	ms_run[1]:scan=3366	4.4759972	2	1743.774375	1743.773378	K	K	164	179
PSM	ELQDGAESNGGGGGGGAGSGGGPGAEPDLK	1159	sp|O14497|ARI1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=8945	9.7032579	3	2555.102541	2554.116781	K	N	72	102
PSM	AGPGADNGEEGEIEEEMENPEMVDLPEK	1160	sp|Q13330|MTA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	17-UNIMOD:35	ms_run[1]:scan=18099	18.804237	3	3031.256753	3030.259407	K	L	71	99
PSM	LSEEATEEPDAEEPATEEPTAQEATAPEEVTK	1161	sp|Q5JQC4|CT47A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=14176	14.639925	3	3428.522840	3427.516210	K	S	220	252
PSM	QADIGNLDDFEEDNEDDDENRVNQEEK	1162	sp|Q8NDI1|EHBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28	ms_run[1]:scan=19294	20.390852	3	3177.2818	3177.2761	K	A	180	207
PSM	EQSELDQDLDDVEEVEEEETGEETK	1163	sp|P55209|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:27	ms_run[1]:scan=21187	23.685626	3	2905.1980	2905.1991	K	L	8	33
PSM	EDSQPGEQNDQGETGSLPGQQEK	1164	sp|Q9NUA8|ZBT40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=5881	6.8873691	2	2458.057224	2457.052784	K	E	701	724
PSM	SGNGNAAATAEENSPK	1165	sp|P08397|HEM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1	ms_run[1]:scan=4915	5.8595042	2	1558.6855	1558.6854	M	M	2	18
PSM	SNGYEDHMAEDCR	1166	sp|Q15717|ELAV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=5778	6.7758546	2	1624.5872	1624.5877	M	G	2	15
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	1167	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0		ms_run[1]:scan=20937	23.184175	4	5140.8992	5140.9086	K	R	36	81
PSM	MEEEGLECPNSSSEK	1168	sp|Q7L7V1|DHX32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=12700	13.24617	2	1766.6977	1766.6970	-	R	1	16
PSM	SGSMATAEASGSDGK	1169	sp|O43169|CYB5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1	ms_run[1]:scan=5652	6.6635107	2	1396.5780	1396.5771	M	G	2	17
PSM	SETDHIASTSSDK	1170	sp|Q7Z3E2|CC186_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1	ms_run[1]:scan=3747	4.8136057	2	1419.6172	1418.6152	M	N	2	15
PSM	MQDAENVAVPEAAEER	1171	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=13844	14.335585	2	1815.7953	1815.7940	-	A	1	17
PSM	AAAPAPEEEMDECEQALAAEPK	1172	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=13310	13.83	2	2372.0148	2372.0148	K	A	254	276
PSM	AADEEAFEDNSEEYIR	1173	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14879	15.309	2	1886.7806	1886.7806	R	R	356	372
PSM	AADEEAFEDNSEEYIR	1174	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14894	15.322	3	1886.7806	1886.7806	R	R	356	372
PSM	AAELTATQVEEEEEEEDFRK	1175	sp|O75717-2|WDHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=16087	16.579	3	2352.0605	2352.0605	K	K	697	717
PSM	AAVATTRGDQESAEANK	1176	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2164	3.4898	3	1717.8231	1717.8231	R	F	179	196
PSM	AEAGPEGVAPAPEGEK	1177	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6074	7.0638	2	1507.7155	1507.7155	K	K	670	686
PSM	AEERAELSEGQVR	1178	sp|P09493-2|TPM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3698	4.7684	2	1472.7219	1472.7219	R	Q	123	136
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	1179	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=15426	15.876	5	3773.6195	3773.6195	K	A	735	771
PSM	ALEVEESNSEDEASFK	1180	sp|Q03111|ENL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11396	11.93	2	1782.7796	1782.7796	K	S	353	369
PSM	AQENYEGSEEVSPPQTK	1181	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6570	7.5511	2	1891.8436	1891.8436	R	D	2536	2553
PSM	AQEPESGLSEETQVK	1182	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7266	8.191	2	1630.7686	1630.7686	R	C	4060	4075
PSM	ARQSMAQAEEETR	1183	sp|P55199|ELL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2321	3.6143	2	1505.6893	1505.6893	K	S	130	143
PSM	ASSESSYPTAESQAEAER	1184	sp|Q53GS7-2|GLE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5291	6.1909	2	1898.813	1898.8130	R	A	296	314
PSM	ATEMVEVGADDDEGGAER	1185	sp|Q6NZI2|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9536	10.276	2	1849.7636	1849.7636	K	G	338	356
PSM	AVGDTVAEDEVVCEIETDK	1186	sp|P36957|ODO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:4	ms_run[2]:scan=20182	21.819	3	2077.9361	2077.9361	K	T	92	111
PSM	CDLEDERVVPAEDGR	1187	sp|O95716|RAB3D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:4	ms_run[2]:scan=9433	10.184	3	1758.7843	1758.7843	K	R	137	152
PSM	DDQGLSSDSSSSLGEK	1188	sp|P16383-3|GCFC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6013	7.0153	2	1610.6908	1610.6908	K	E	111	127
PSM	DEAQNEGPATESEAPLK	1189	sp|Q8N163-2|CCAR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7940	8.8023	3	1784.8065	1784.8065	K	E	600	617
PSM	DHQLREAPDTAEK	1190	sp|Q96CT7|CC124_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2466	3.7281	2	1508.7219	1508.7219	R	A	107	120
PSM	DITAEEEEEEVESLK	1191	sp|Q9BZ23-3|PANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=18282	19.025	2	1748.784	1748.7840	K	S	109	124
PSM	DQDEEDRELIMK	1192	sp|O60524-2|NEMF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8999	9.7532	2	1519.6824	1519.6824	K	L	85	97
PSM	DSAIPVESDTDDEGAPR	1193	sp|Q96D46|NMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10582	11.201	2	1772.7701	1772.7701	R	I	461	478
PSM	DSGKDQEEEEIEDTLMDTEEQEEFK	1194	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=21939	25.304	3	3002.2346	3002.2346	K	A	5176	5201
PSM	EAISDEDEDEALYQK	1195	sp|Q9C0B7|TNG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10697	11.305	2	1753.753	1753.7530	K	V	553	568
PSM	EAQGNSSAGVEAAEQRPVEDGER	1196	sp|Q6NYC8-2|PPR18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5207	6.1173	3	2385.0793	2385.0793	R	G	302	325
PSM	EDENAEPVGTTYQK	1197	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4942	5.8827	2	1579.7002	1579.7002	R	T	152	166
PSM	EDIESQEIEAQEGEDDTFLTAQDGEEEENEK	1198	sp|Q9NWH9|SLTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=20180	21.816	3	3555.4656	3555.4656	K	D	166	197
PSM	EDLEDLEEEEVSDMGNDDPEMGER	1199	sp|O00566|MPP10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=21269	23.866	3	2781.0753	2781.0753	K	A	128	152
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	1200	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=21730	24.868	3	3657.4246	3657.4246	K	R	176	207
PSM	EENAVHSTEPVVQENGDEAGEGR	1201	sp|Q00341-2|VIGLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5811	6.8081	3	2452.0739	2452.0739	R	E	880	903
PSM	EENNHLQEELER	1202	sp|Q15643-2|TRIPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6072	7.0625	2	1538.6961	1538.6961	K	L	831	843
PSM	EEQELMEEINEDEPVK	1203	sp|O14776-2|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=18400	19.167	2	1959.8619	1959.8619	K	A	588	604
PSM	EESLQQNVGQEEAEIK	1204	sp|Q8IXJ9-2|ASXL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12387	12.939	2	1829.8643	1829.8643	K	S	368	384
PSM	EETNEIQVVNEEPQRDR	1205	sp|Q8NBJ4-2|GOLM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8271	9.0976	2	2083.977	2083.9770	K	L	243	260
PSM	EEVQSLREEAEK	1206	sp|Q14980-4|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4628	5.6113	2	1445.6998	1445.6998	R	Q	1292	1304
PSM	EHLLDDEEEDEEIMR	1207	sp|Q9Y4E6-2|WDR7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:35	ms_run[2]:scan=10568	11.188	3	1916.7946	1916.7946	K	Q	756	771
PSM	EIDDTYIEDAADVDAR	1208	sp|Q99459|CDC5L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=18335	19.086	2	1809.7905	1809.7905	R	K	506	522
PSM	ELDQDMVTEDEDDPGSHK	1209	sp|Q9NRL2-2|BAZ1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8739	9.5221	2	2058.8324	2058.8324	K	R	692	710
PSM	ELGGLEGDPSPEEDEGIQK	1210	sp|Q9BT09|CNPY3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13560	14.064	3	1997.9066	1997.9066	K	A	248	267
PSM	ERLGMSADPDNEDATDK	1211	sp|O75152|ZC11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5595	6.5947	3	1862.7952	1862.7952	K	V	333	350
PSM	ERVQESADELQK	1212	sp|P84085|ARF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3327	4.4455	2	1430.7001	1430.7001	R	M	98	110
PSM	ESPGSQQCCQESEVLER	1213	sp|Q9H930-2|SP14L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=7535	8.4359	2	2021.8419	2021.8419	K	Q	415	432
PSM	ESQRNLEEEENLGK	1214	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4719	5.6885	2	1673.7857	1673.7857	K	G	912	926
PSM	GDVEEDETIPDSEQDIRPR	1215	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11461	11.99	4	2198.9927	2198.9927	K	F	278	297
PSM	GEFKDEEETVTTK	1216	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4595	5.5844	2	1511.6991	1511.6991	K	H	248	261
PSM	GGTVADLDEQDEETVTAGGK	1217	sp|Q92922|SMRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11544	12.062	3	1990.8967	1990.8967	K	E	402	422
PSM	GHEENGDVVTEPQVAEK	1218	sp|Q9UG63|ABCF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5679	6.6855	3	1836.849	1836.8490	K	N	26	43
PSM	HEEEATDITPAADK	1219	sp|O15015-1|ZN646_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4207	5.2377	2	1525.6896	1525.6896	K	T	558	572
PSM	HEEQSNEDIPIAEQSSK	1220	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6203	7.1752	3	1939.8759	1939.8759	K	D	218	235
PSM	HNGPNDASDGTVR	1221	sp|P31942-2|HNRH3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1973	3.3439	2	1338.5913	1338.5913	K	L	7	20
PSM	KDPEPEDEVPDVK	1222	sp|P82675|RT05_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7567	8.4653	2	1495.7042	1495.7042	R	L	393	406
PSM	KGAVAEDGDELR	1223	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3101	4.2574	2	1258.6153	1258.6153	K	T	7	19
PSM	KLETEETVPETDVETK	1224	sp|Q03701|CEBPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8090	8.9438	3	1846.9048	1846.9048	K	K	659	675
PSM	KVEEVLEEEEEEYVVEK	1225	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17399	17.967	3	2108.0049	2108.0049	K	V	9	26
PSM	KVEEVLEEEEEEYVVEK	1226	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=19596	20.846	2	2108.0049	2108.0049	K	V	9	26
PSM	KVEEVLEEEEEEYVVEK	1227	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=20829	23.012	3	2108.0049	2108.0049	K	V	9	26
PSM	KVEEVLEEEEEEYVVEK	1228	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=19507	20.715	3	2108.0049	2108.0049	K	V	9	26
PSM	LDQEVEGGRGDEQYK	1229	sp|Q9H7D0|DOCK5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3621	4.6922	2	1721.7857	1721.7857	K	V	1155	1170
PSM	LEPANEEHNVETAEDSEIR	1230	sp|Q15361|TTF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9445	10.192	3	2180.9822	2180.9822	R	Y	457	476
PSM	LLEDSEESSEETVSR	1231	sp|O60231|DHX16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7758	8.6435	2	1708.7639	1708.7639	R	A	99	114
PSM	LSEGSQPAEEEEDQETPSRNLR	1232	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6356	7.3072	3	2500.1314	2500.1314	K	V	239	261
PSM	LSSSSEPYEEDEFNDDQSIK	1233	sp|Q9H4L7|SMRCD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13813	14.306	2	2317.971	2317.9710	K	K	210	230
PSM	MEEEERLAEQQR	1234	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4176	5.2112	2	1546.7046	1546.7046	R	A	1312	1324
PSM	MPEEEDEAPVLDVR	1235	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=14372	14.824	2	1643.7349	1643.7349	K	Y	467	481
PSM	MQVDQEEPHVEEQQQQTPAENK	1236	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6860	7.8259	4	2621.1664	2621.1664	K	A	522	544
PSM	MREDYDSVEQDGDEPGPQR	1237	sp|Q9Y5S9-2|RBM8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6540	7.5227	3	2221.9182	2221.9182	R	S	49	68
PSM	NDFTEEEEAQVRK	1238	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6649	7.6267	2	1593.7271	1593.7271	K	E	143	156
PSM	NDIHLDADDPNSADK	1239	sp|Q99590-2|SCAFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6027	7.0271	3	1638.7122	1638.7122	K	H	686	701
PSM	NEDEEEEEEEKDEAEDLLGR	1240	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=16646	17.146	3	2405.983	2405.9830	K	G	434	454
PSM	NENGAPEDEENFEEAIK	1241	sp|Q13564-3|ULA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14466	14.91	2	1933.8177	1933.8177	K	N	165	182
PSM	NGPLNESQEDEEDSEHGTSLNR	1242	sp|Q9H2K8|TAOK3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6367	7.3176	3	2456.0324	2456.0324	R	E	318	340
PSM	NIEEHASADVEK	1243	sp|P61006-2|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3198	4.3432	2	1340.6208	1340.6208	R	M	105	117
PSM	NIEEHASADVEK	1244	sp|P61006-2|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3987	5.0357	2	1340.6208	1340.6208	R	M	105	117
PSM	NSFREQLEEEEEAK	1245	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9506	10.246	3	1736.7853	1736.7853	K	H	1339	1353
PSM	NSFREQLEEEEEAK	1246	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11164	11.72	2	1736.7853	1736.7853	K	H	1339	1353
PSM	NSFREQLEEEEEAK	1247	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13235	13.759	2	1736.7853	1736.7853	K	H	1339	1353
PSM	NVPQEESLEDSDVDADFK	1248	sp|O00505|IMA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=16295	16.779	2	2035.8858	2035.8858	R	A	50	68
PSM	PKIEDVGSDEEDDSGK	1249	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4336	5.3505	3	1718.7483	1718.7483	K	D	248	264
PSM	PKVDDEPMDVDK	1250	sp|Q13123|RED_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5312	6.2122	2	1386.6337	1386.6337	K	G	387	399
PSM	QDENDDDDDWNPCK	1251	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:4	ms_run[2]:scan=8183	9.0223	2	1764.6169	1764.6169	K	A	188	202
PSM	QQEAEELEADIREEK	1252	sp|Q9C035-6|TRIM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12477	13.034	2	1815.8487	1815.8487	K	A	153	168
PSM	QQNQEITDQLEEEK	1253	sp|Q08379|GOGA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9753	10.469	2	1730.7959	1730.7959	K	K	189	203
PSM	QQNQEITDQLEEEKK	1254	sp|Q08379|GOGA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6660	7.6365	2	1858.8909	1858.8908	K	E	189	204
PSM	QTESSSDGGDGVFSEK	1255	sp|Q8TD26|CHD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5971	6.9769	2	1628.6802	1628.6802	K	K	1355	1371
PSM	REESEAVEAGDPPEELR	1256	sp|Q9H3S7|PTN23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8135	8.9825	3	1911.881	1911.8810	R	S	730	747
PSM	RGAEEEDLGEEEEEGQAHLEDWR	1257	sp|Q6ZU35|CRACD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=15701	16.172	4	2712.1536	2712.1536	R	G	394	417
PSM	RLSEGQEEENLENEMK	1258	sp|Q15276-2|RABE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10410	11.051	3	1933.8687	1933.8687	R	K	160	176
PSM	RQLEEAEEEAQR	1259	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3108	4.2626	2	1486.7012	1486.7012	K	A	1877	1889
PSM	RTEQEEDEELLTESSK	1260	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8287	9.113	3	1921.8753	1921.8753	R	A	145	161
PSM	SEDFGVNEDLADSDAR	1261	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14522	14.966	2	1738.7282	1738.7282	R	A	189	205
PSM	SEDFGVNEDLADSDAR	1262	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=15042	15.471	2	1738.7282	1738.7282	R	A	189	205
PSM	SGGGTGEEPGSQGLNGEAGPEDSTR	1263	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6589	7.5692	3	2345.0004	2345.0004	K	E	173	198
PSM	SKSEVIEDSDVETVSEK	1264	sp|Q56NI9|ESCO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7781	8.663	2	1879.8898	1879.8898	K	K	236	253
PSM	SMGSQEDDSGNKPSSYS	1265	sp|Q9UNS2-2|CSN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3236	4.3731	2	1774.6952	1774.6952	K	-	387	404
PSM	SPQSDPADTPTNTK	1266	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2590	3.8287	2	1457.6634	1457.6634	K	Q	1861	1875
PSM	SPSEAADEVCALEEK	1267	sp|Q9H6Z4-3|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:4	ms_run[2]:scan=13520	14.026	2	1633.7141	1633.7141	R	E	151	166
PSM	TPSPAAEDAREPEAK	1268	sp|Q92797|SYMPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3049	4.2151	3	1567.7478	1567.7478	K	G	1257	1272
PSM	TRDDGDEEGLLTHSEEELEHSQDTDADDGALQ	1269	sp|Q9UKM9-2|RALY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=18428	19.2	4	3526.4728	3526.4728	R	-	259	291
PSM	TRQEPTSESSMEDSPTTER	1270	sp|O14981|BTAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3565	4.6449	3	2166.9335	2166.9335	R	L	82	101
PSM	TSQVVEQDVPEEVDR	1271	sp|Q9Y6X8|ZHX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10825	11.42	2	1728.8166	1728.8166	R	A	15	30
PSM	TVEEEDQIFLDGQENK	1272	sp|Q6PJE2-5|POZP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=16531	17.015	2	1892.864	1892.8640	R	R	59	75
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	1273	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14789	15.216	3	3368.4764	3368.4764	K	E	312	341
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	1274	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=16228	16.714	4	3368.4764	3368.4764	K	E	312	341
PSM	VDDEPMDVDKGPGSTK	1275	sp|Q13123|RED_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5801	6.7987	2	1688.7563	1688.7563	K	E	389	405
PSM	VEEEEERNQILQNEK	1276	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5628	6.6398	3	1885.9017	1885.9017	R	K	931	946
PSM	VEEPGMGAEEAVDCR	1277	sp|Q9UM47|NOTC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:4	ms_run[2]:scan=9937	10.628	2	1647.6869	1647.6869	K	Q	1734	1749
PSM	LSVEESEAAGDGVDTK	1278	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=11208	11.759109	2	1605.740526	1605.736976	K	V	427	443
PSM	NRPDYVSEEEEDDEDFETAVK	1279	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=17606	18.222373	3	2516.047337	2515.051052	K	K	2662	2683
PSM	ASNGNARPETVTNDDEEALDEETK	1280	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=9198	9.9508903	3	2605.129400	2604.142327	K	R	178	202
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	1281	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	10-UNIMOD:35	ms_run[1]:scan=13406	13.915845	5	3915.651178	3915.650095	K	G	307	347
PSM	KFVEEEDDDEEEEEENLDDQDEQGNLK	1282	sp|Q7KZ85|SPT6H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=12421	12.972845	3	3268.353066	3268.317510	K	G	29	56
PSM	IEELDQENEAALENGIKNEENTEPGAESSENADDPNK	1283	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=16482	16.962647	4	4042.755026	4041.768296	K	D	720	757
PSM	AAEINGEVDDDDAGGEWR	1284	sp|Q92614|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=13124	13.657662	2	1919.804873	1917.797678	R	L	1355	1373
PSM	DIDDDLEGEVTEECGK	1285	sp|Q9UHX1|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	14-UNIMOD:4	ms_run[1]:scan=17693	18.328864	2	1822.728087	1822.741469	K	F	474	490
PSM	AAELTATQVEEEEEEEDFRK	1286	sp|O75717|WDHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=14971	15.396542	3	2353.065159	2352.060495	K	K	820	840
PSM	LEGALGADTTEDGDEK	1287	sp|Q9NZM1|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=8412	9.228504	2	1620.725466	1619.716240	K	S	1094	1110
PSM	HLYECTEEENDNSLEK	1288	sp|Q9NXC5|MIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:4	ms_run[1]:scan=5879	6.8858219	2	2010.855520	2008.832015	R	D	373	389
PSM	DYEEVGVDSVEGEGEEEGEEY	1289	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=20554	22.453715	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	1290	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=20267	21.946369	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	1291	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=23833	30.006472	2	2347.901016	2347.897571	K	-	431	452
PSM	QKAPAPEAEDEEVAR	1292	sp|Q8NBN7|RDH13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28	ms_run[1]:scan=6937	7.8948406	2	1621.7646	1621.7579	K	R	293	308
PSM	LQGEHSQNGEEEPETEPVGEESISDAEK	1293	sp|Q5EBL4|RIPL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=9785	10.495404	3	3055.329776	3053.322142	R	V	254	282
PSM	ASGEHSPGSGAAR	1294	sp|Q9H4A4|AMPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1	ms_run[1]:scan=2122	3.4570697	2	1224.5481	1224.5478	M	R	2	15
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	1295	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0		ms_run[1]:scan=22793	27.216135	4	5140.9065	5140.9086	K	R	36	81
PSM	QLQQAQAAGAEQEVEK	1296	sp|P39748|FEN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=6744	7.7160031	2	1727.833750	1726.848592	K	F	110	126
PSM	ADFDEIYEEEEDEER	1297	sp|Q9UKJ5|CHIC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1	ms_run[1]:scan=21623	24.612757	2	1958.7531	1958.7536	M	A	2	17
PSM	CSQEDHCLTSDLEDDRK	1298	sp|Q9NZU5|LMCD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=10918	11.499669	3	2089.8306	2089.8312	K	I	52	69
PSM	AADEEAFEDNSEEYIR	1299	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13657	14.158	2	1886.7806	1886.7806	R	R	356	372
PSM	AADEEAFEDNSEEYIR	1300	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14011	14.49	2	1886.7806	1886.7806	R	R	356	372
PSM	AAEAAAAPAESAAPAAGEEPSKEEGEPK	1301	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7264	8.1896	3	2635.2249	2635.2249	K	K	122	150
PSM	AEDEALLSEEDDPIDR	1302	sp|Q04721|NOTC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=16925	17.44	2	1815.801	1815.8010	K	R	1771	1787
PSM	AEDGATPSPSNETPKK	1303	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2346	3.6338	3	1627.7689	1627.7689	K	K	138	154
PSM	AKAEASSGDHPTDTEMK	1304	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2030	3.3856	2	1773.7839	1773.7839	K	E	425	442
PSM	ATEMVEVGADDDEGGAERGEAGDLR	1305	sp|Q6NZI2|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12760	13.304	3	2548.0984	2548.0984	K	R	338	363
PSM	ATEMVEVGADDDEGGAERGEAGDLR	1306	sp|Q6NZI2|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11855	12.351	4	2548.0984	2548.0984	K	R	338	363
PSM	AVGDTVAEDEVVCEIETDK	1307	sp|P36957|ODO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=20483	22.32	3	2077.9361	2077.9361	K	T	92	111
PSM	AVTEQGAELSNEER	1308	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5126	6.0456	2	1531.7114	1531.7114	K	N	28	42
PSM	CDGFLDCSDESDEK	1309	sp|Q92673|SORL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=10165	10.829	2	1675.5978	1675.5978	R	A	1534	1548
PSM	CGEDDETIPSEYR	1310	sp|P20810-3|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4	ms_run[2]:scan=9311	10.063	2	1569.6253	1569.6253	K	L	210	223
PSM	DAINQGMDEELERDEK	1311	sp|P11177-3|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35	ms_run[2]:scan=5960	6.9667	3	1906.8214	1906.8215	R	V	37	53
PSM	DCDLQEDEACYNCGR	1312	sp|P62633-8|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8451	9.2638	2	1903.6771	1903.6771	K	G	59	74
PSM	DDGQADSEVLGECAR	1313	sp|Q8NCN4|RN169_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=9130	9.8741	2	1620.6686	1620.6686	R	R	120	135
PSM	DDMHDVEDELAK	1314	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13278	13.8	2	1415.5875	1415.5875	K	R	601	613
PSM	DEENHEESESLQEDMLGNR	1315	sp|Q8IX12-2|CCAR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13003	13.538	3	2259.9186	2259.9186	K	L	970	989
PSM	DGDAEEVRELGTVEEN	1316	sp|Q14699|RFTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13531	14.036	2	1760.7701	1760.7701	R	-	563	579
PSM	DGETSLVTGEADEGR	1317	sp|Q96JK2-2|DCAF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9555	10.294	2	1534.6747	1534.6747	K	A	597	612
PSM	DGTAPPPQSPGSPGTGQDEEWSDEESPRK	1318	sp|Q9UKS6|PACN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9567	10.303	3	3037.3173	3037.3173	R	A	333	362
PSM	DLIHDQDEDEEEEEGQR	1319	sp|Q9UNZ2-4|NSF1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7203	8.1348	3	2084.8407	2084.8407	R	F	77	94
PSM	DQPPFGDSDDSVEADK	1320	sp|Q14676-3|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10628	11.243	2	1720.7064	1720.7064	K	S	488	504
PSM	DSAIPVESDTDDEGAPR	1321	sp|Q96D46|NMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10573	11.192	3	1772.7701	1772.7701	R	I	461	478
PSM	DSALVEESNGTLEEK	1322	sp|Q9UJA5-3|TRM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10940	11.522	2	1619.7526	1619.7526	K	Q	281	296
PSM	DSDGVDGFEAEGKK	1323	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5777	6.7751	2	1452.6369	1452.6369	R	D	1053	1067
PSM	DTHDQLSEPSEVR	1324	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5242	6.1471	2	1511.6852	1511.6852	K	S	3800	3813
PSM	DVQGTDASLDEELDR	1325	sp|Q9UJZ1|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14104	14.577	2	1661.738	1661.7380	R	V	338	353
PSM	EAEEPGPDSENSQENPPLR	1326	sp|Q8WXG6-6|MADD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7692	8.5839	3	2093.9138	2093.9138	K	S	681	700
PSM	EAGTDNRNIVDDGK	1327	sp|Q9UJA5-3|TRM6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2973	4.1529	2	1502.6961	1502.6961	K	S	89	103
PSM	EDAGDNDDTEGAIGVR	1328	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7196	8.1297	2	1632.6863	1632.6863	R	N	377	393
PSM	EDENAEPVGTTYQK	1329	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4949	5.8897	2	1579.7002	1579.7002	R	T	152	166
PSM	EDQEAAELLSEPEEESER	1330	sp|Q63HN8|RN213_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=16256	16.741	3	2088.8971	2088.8971	K	H	1249	1267
PSM	EEAGGGISEEEAAQYDR	1331	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9346	10.102	3	1809.7653	1809.7653	K	Q	5	22
PSM	EEAGGGISEEEAAQYDR	1332	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13319	13.837	2	1809.7653	1809.7653	K	Q	5	22
PSM	EEAGGGISEEEAAQYDR	1333	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14447	14.891	2	1809.7653	1809.7653	K	Q	5	22
PSM	EEAGGGISEEEAAQYDR	1334	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14984	15.406	2	1809.7653	1809.7653	K	Q	5	22
PSM	EEAGGGISEEEAAQYDR	1335	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12152	12.687	2	1809.7653	1809.7653	K	Q	5	22
PSM	EEEDIEDIEENTRPK	1336	sp|Q641Q2-2|WAC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11281	11.824	3	1844.8276	1844.8276	K	R	268	283
PSM	EEEMGEEEEVEREIIK	1337	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:35	ms_run[2]:scan=14530	14.974	2	1992.8834	1992.8834	R	Q	1289	1305
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	1338	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=21034	23.353	3	3657.4246	3657.4246	K	R	176	207
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	1339	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=21265	23.857	3	3657.4246	3657.4246	K	R	176	207
PSM	EEQELMEEINEDEPVK	1340	sp|O14776-2|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35	ms_run[2]:scan=14280	14.74	2	1975.8568	1975.8568	K	A	588	604
PSM	EGGGVHAVPPDPEDEGLEETGSK	1341	sp|Q7L1V2|MON1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10998	11.57	3	2305.0346	2305.0346	R	D	30	53
PSM	EIESEIDSEEELINK	1342	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=18231	18.967	3	1775.8313	1775.8313	K	K	755	770
PSM	EIVEVKEENIEDATEK	1343	sp|P82970|HMGN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13705	14.204	3	1873.9157	1873.9157	K	G	96	112
PSM	ELAQAEDELDEAHNQAR	1344	sp|Q96A19|C102A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9416	10.169	3	1937.8715	1937.8715	K	K	466	483
PSM	ELRDEEQTAESIK	1345	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5714	6.715	2	1546.7475	1546.7475	K	N	314	327
PSM	ENALDRAEQAEADK	1346	sp|P09493-9|TPM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6745	7.7167	3	1558.7223	1558.7223	K	K	16	30
PSM	EPSQAAAIHPDNCEESEVSER	1347	sp|Q9BZQ8|NIBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=6880	7.843	3	2354.0081	2354.0081	K	E	751	772
PSM	ERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAK	1348	sp|Q12797-9|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15569	16.036	5	4222.9302	4222.9302	K	E	97	135
PSM	ESEQESEEEILAQKK	1349	sp|Q9BW71|HIRP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7185	8.1175	3	1775.8425	1775.8425	K	E	222	237
PSM	ETPDTLSDPQTVPEEER	1350	sp|O94822-2|LTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11014	11.586	2	1941.8803	1941.8803	K	E	201	218
PSM	EVAEAATGEDASSPPPK	1351	sp|Q99536-3|VAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4442	5.437	2	1654.7686	1654.7686	R	T	6	23
PSM	EYINECDSDYHEER	1352	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4	ms_run[2]:scan=5286	6.1874	2	1857.7112	1857.7112	R	T	859	873
PSM	GDAEKPEEELEEDDDEELDETLSER	1353	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=21617	24.603	3	2920.2105	2920.2105	K	L	23	48
PSM	GDVEEDETIPDSEQDIRPR	1354	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11484	12.011	3	2198.9927	2198.9927	K	F	278	297
PSM	GEDNAIEMSEDFDGK	1355	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15409	15.859	2	1655.6621	1655.6621	K	M	4722	4737
PSM	GESHWVDDDCEEIK	1356	sp|Q13822|ENPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:4	ms_run[2]:scan=8426	9.239	2	1717.689	1717.6890	K	A	140	154
PSM	GTCVSSAEEEAENAPR	1357	sp|Q15375-4|EPHA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4	ms_run[2]:scan=8159	9.0024	3	1705.7213	1705.7213	R	M	232	248
PSM	HEDLQTDESSMDDRHPR	1358	sp|Q6VN20-2|RBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2972	4.1521	4	2066.8712	2066.8712	K	R	394	411
PSM	HQAEAQPEDLSLEEEAR	1359	sp|O60304-2|ZN500_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9846	10.547	3	1950.8919	1950.8919	K	F	159	176
PSM	IAECSSQLAEEEEK	1360	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4	ms_run[2]:scan=7152	8.0893	2	1621.7141	1621.7141	R	A	1008	1022
PSM	IGEEEIQKPEEK	1361	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4433	5.4286	2	1427.7144	1427.7144	K	V	423	435
PSM	ILGENEEEEDLAESGR	1362	sp|Q9Y4C8|RBM19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12619	13.169	2	1788.8014	1788.8014	R	L	388	404
PSM	KGQGTAATGNQATPK	1363	sp|Q5T1M5|FKB15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=892	1.6389	2	1428.7321	1428.7321	K	T	49	64
PSM	KMDPAEEDTNVYTEK	1364	sp|P34741|SDC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6144	7.1217	3	1768.7825	1768.7825	R	H	120	135
PSM	KVEEVLEEEEEEYVVEK	1365	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=21583	24.529	3	2108.0049	2108.0049	K	V	9	26
PSM	LADLEEESESWDNSEAEEEEK	1366	sp|Q8NFG4|FLCN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=16796	17.294	3	2467.0034	2467.0034	K	A	289	310
PSM	LAGEELAGEEAPQEK	1367	sp|Q7Z4V5-2|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8901	9.6665	3	1569.7522	1569.7522	K	A	575	590
PSM	LDADKYENDPELEK	1368	sp|Q9BV57|MTND_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8089	8.9431	3	1677.7734	1677.7734	K	I	41	55
PSM	LEDGDIEEAPGAGGR	1369	sp|Q9Y613|FHOD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7994	8.8521	2	1484.6743	1484.6743	K	R	336	351
PSM	LEGALGADTTEDGDEK	1370	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7842	8.718	2	1619.7162	1619.7162	K	S	1052	1068
PSM	LEGEHERDLESTSR	1371	sp|Q5T200-2|ZC3HD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2664	3.8938	2	1656.7703	1656.7703	K	D	1394	1408
PSM	LETEETVPETDVETK	1372	sp|Q03701|CEBPZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10299	10.948	2	1718.8098	1718.8098	K	K	660	675
PSM	LEVAEAEEEETSIK	1373	sp|O15213|WDR46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13222	13.748	2	1575.7516	1575.7516	R	A	132	146
PSM	LGEASDSELADADK	1374	sp|Q5SW79-2|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7312	8.2271	2	1419.6365	1419.6365	R	A	1010	1024
PSM	LGHGEEELETEK	1375	sp|O60306|AQR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3672	4.7451	2	1369.6361	1369.6361	R	D	879	891
PSM	LWGDDDEEEDEEEEDNKTEETGPGMDEEDSELVAK	1376	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=17621	18.244	3	4012.5811	4012.5811	R	D	4778	4813
PSM	MNEAAEEDRQLNNQK	1377	sp|Q96ST2-2|IWS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2948	4.1339	3	1788.8061	1788.8061	K	K	242	257
PSM	NDELNHLEEEGR	1378	sp|Q63HN8|RN213_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7358	8.2643	2	1453.6433	1453.6433	R	F	4192	4204
PSM	NDMDEPPPLDYGSGEDDGK	1379	sp|Q12873|CHD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14699	15.132	2	2049.8109	2049.8109	K	S	585	604
PSM	NSFREQLEEEEEAK	1380	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10080	10.753	3	1736.7853	1736.7853	K	H	1339	1353
PSM	NSFREQLEEEEEAK	1381	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10661	11.272	3	1736.7853	1736.7853	K	H	1339	1353
PSM	NSFREQLEEEEEAK	1382	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11238	11.786	3	1736.7853	1736.7853	K	H	1339	1353
PSM	NSFREQLEEEEEAK	1383	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13426	13.937	2	1736.7853	1736.7853	K	H	1339	1353
PSM	NSFREQLEEEEEAK	1384	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15397	15.848	3	1736.7853	1736.7853	K	H	1339	1353
PSM	NSFREQLEEEEEAK	1385	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12774	13.316	3	1736.7853	1736.7853	K	H	1339	1353
PSM	NSFREQLEEEEEAK	1386	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=16959	17.479	3	1736.7853	1736.7853	K	H	1339	1353
PSM	NSTPSEPGSGRGPPQEEEEEEDEEEEATK	1387	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6499	7.4791	3	3172.3076	3172.3076	K	E	198	227
PSM	NTNEEDDEVREAMTR	1388	sp|P49959-2|MRE11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7268	8.1923	3	1807.7643	1807.7643	K	A	511	526
PSM	PGEELSPTDENGK	1389	sp|P42330-2|AK1C3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4429	5.4256	2	1371.6154	1371.6154	K	V	5	18
PSM	PQTALEENETQK	1390	sp|Q9Y3D9|RT23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3426	4.5228	2	1386.6627	1386.6627	R	E	158	170
PSM	QEEQEPTGEEPAVLGGDK	1391	sp|Q6NS38-2|ALKB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14861	15.286	2	1911.8698	1911.8698	K	E	17	35
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	1392	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=19542	20.762	3	3574.4874	3574.4874	K	A	737	771
PSM	QQMAEEMVEAAGEDER	1393	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14945	15.371	2	1821.7509	1821.7509	K	E	817	833
PSM	QSQQEAEEEEREEEEEAQIIQR	1394	sp|Q9NQZ2|SAS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12815	13.353	4	2716.206	2716.2060	R	R	149	171
PSM	SADSDRDVFNEK	1395	sp|Q96BP3-2|PPWD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4258	5.2847	2	1381.611	1381.6110	K	P	305	317
PSM	SEDDESGAGELTREELR	1396	sp|P33993-2|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9623	10.356	3	1891.8395	1891.8395	K	Q	309	326
PSM	SEDFGVNEDLADSDAR	1397	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14557	14.998	3	1738.7282	1738.7282	R	A	189	205
PSM	SKSEVIEDSDVETVSEK	1398	sp|Q56NI9|ESCO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7737	8.6217	3	1879.8898	1879.8898	K	K	236	253
PSM	SNNLEREQEQLDR	1399	sp|Q9NPI1|BRD7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4685	5.658	2	1629.7707	1629.7707	K	I	308	321
PSM	SPDHNGEDNFAR	1400	sp|Q05209|PTN12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2579	3.8189	2	1357.5647	1357.5647	K	D	19	31
PSM	SPYEAENSGEELDQR	1401	sp|Q9NPC7-3|MYNN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6904	7.8627	2	1722.7333	1722.7333	K	Y	282	297
PSM	SSDEENGPPSSPDLDR	1402	sp|Q96B36-2|AKTS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6610	7.5919	2	1700.7126	1700.7126	R	I	72	88
PSM	SSTGEASENGLEDIDR	1403	sp|Q9BQ70|TCF25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9519	10.26	2	1678.7282	1678.7282	K	I	137	153
PSM	TAEDDETPVDLNK	1404	sp|O00443|P3C2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8155	8.9995	2	1445.6522	1445.6522	R	H	520	533
PSM	TANLAEANASEEDK	1405	sp|Q7Z6E9|RBBP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4137	5.1771	2	1461.6583	1461.6583	K	I	117	131
PSM	TEDESLVENNDNIDEEAREELR	1406	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15987	16.477	3	2618.158	2618.1580	K	E	123	145
PSM	TEEIAEEEETVFPK	1407	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=17392	17.958	2	1649.7672	1649.7672	K	A	41	55
PSM	TGEEDEEEFFCNR	1408	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:4	ms_run[2]:scan=13830	14.321	2	1660.6311	1660.6311	K	A	1186	1199
PSM	THETFHEEEEDMDSYQDRDLER	1409	sp|Q9NQT8|KI13B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9630	10.361	4	2810.1362	2810.1362	R	L	1069	1091
PSM	TQLEELEDELQATEDAK	1410	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=16111	16.601	3	1960.9113	1960.9113	K	L	1539	1556
PSM	TSQVVEQDVPEEVDR	1411	sp|Q9Y6X8|ZHX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10788	11.386	2	1728.8166	1728.8166	R	A	15	30
PSM	TVEDADMELTSRDEGER	1412	sp|Q9UJX4-2|APC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8568	9.3637	3	1951.8429	1951.8429	K	K	48	65
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	1413	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14173	14.638	3	3368.4764	3368.4764	K	E	312	341
PSM	VCQGEREMAGDNK	1414	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4	ms_run[2]:scan=2033	3.3897	2	1492.6399	1492.6399	K	L	486	499
PSM	VETLKEEEEELK	1415	sp|Q9Y3L3-2|3BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8537	9.3374	2	1474.7403	1474.7403	K	R	188	200
PSM	VQPPPETPAEEEMETETEAEALQEK	1416	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:35	ms_run[2]:scan=17423	17.994	3	2827.2593	2827.2593	K	E	1076	1101
PSM	NSFREQLEEEEEAK	1417	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=13297	13.818065	3	1738.787269	1736.785323	K	H	1339	1353
PSM	NSFREQLEEEEEAK	1418	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=11801	12.303902	3	1737.777919	1736.785323	K	H	1339	1353
PSM	LSVEESEAAGDGVDTK	1419	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=13581	14.084314	2	1605.738048	1605.736976	K	V	427	443
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	1420	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=16829	17.332337	4	3774.600972	3773.619463	K	A	735	771
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	1421	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=17908	18.567215	4	3575.472033	3574.487386	K	A	737	771
PSM	AAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAK	1422	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	35-UNIMOD:35	ms_run[1]:scan=11662	12.179322	4	4462.584424	4461.548507	K	G	177	218
PSM	TSGRVAVEEVDEEGK	1423	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=4981	5.9146854	2	1605.774194	1603.768944	R	F	436	451
PSM	PAEDMEEEQAFK	1424	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=8886	9.6514832	2	1422.606009	1422.597311	R	R	23	35
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	1425	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:27	ms_run[1]:scan=17664	18.295958	3	3882.6412	3881.6442	K	G	307	347
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAK	1426	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1	ms_run[1]:scan=22683	26.953994	5	3263.3706	3263.3744	M	K	2	33
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAK	1427	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1	ms_run[1]:scan=21789	25.005618	3	3263.3725	3263.3744	M	K	2	33
PSM	THVNPMDEEENEVNHVNGEQENR	1428	sp|Q8TAF3|WDR48_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=8571	9.3659328	4	2720.134945	2719.152849	R	V	477	500
PSM	THVNPMDEEENEVNHVNGEQENR	1429	sp|Q8TAF3|WDR48_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=7731	8.6171452	4	2720.130020	2719.152849	R	V	477	500
PSM	SSDDTTDAQMDEQDLNEPLAK	1430	sp|Q14BN4|SLMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	10-UNIMOD:35	ms_run[1]:scan=13935	14.416448	3	2339.009618	2337.975445	K	V	458	479
PSM	TEQEEDEELLSESRK	1431	sp|P28370|SMCA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=7557	8.4560617	2	1821.828544	1820.827582	R	T	149	164
PSM	EEQELMEEINEDEPVK	1432	sp|O14776|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:27	ms_run[1]:scan=22330	26.235756	2	1941.8541	1941.8508	K	A	609	625
PSM	QEETAVLEEDSADWEK	1433	sp|Q96A49|SYAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28	ms_run[1]:scan=20581	22.495766	2	1860.7899	1860.7896	K	E	303	319
PSM	GDRSEDFGVNEDLADSDAR	1434	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=12508	13.066764	3	2067.862464	2066.877720	K	A	186	205
PSM	ADFDDRVSDEEK	1435	sp|P52907|CAZA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1	ms_run[1]:scan=9854	10.557449	2	1466.6162	1466.6156	M	V	2	14
PSM	AAELTATQVEEEEEEEDFRK	1436	sp|O75717|WDHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=15894	16.384086	3	2352.062608	2352.060495	K	K	820	840
PSM	MDGASAEQDGLQEDR	1437	sp|Q08378|GOGA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1	ms_run[1]:scan=12122	12.648164	2	1662.6782	1662.6786	-	S	1	16
PSM	EIESEIDSEEELINK	1438	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:27	ms_run[1]:scan=21719	24.844424	2	1757.8204	1757.8202	K	K	755	770
PSM	KVEEVLEEEEEEYVVEK	1439	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=18610	19.426043	2	2108.003756	2108.004877	K	V	9	26
PSM	DYEEVGVDSVEGEGEEEGEEY	1440	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=21551	24.470053	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	1441	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=24333	31.517898	2	2347.901016	2347.897571	K	-	431	452
PSM	EAEMEEHREHIK	1442	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=2000	3.3637507	2	1537.724583	1536.699091	K	V	1008	1020
PSM	KPEYDLEEDDQEVLK	1443	sp|Q13416|ORC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=13122	13.65611	3	1848.870983	1848.862904	K	D	52	67
PSM	NIEEHASADVEK	1444	sp|P61006|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=4447	5.4427276	2	1340.621771	1340.620824	R	M	105	117
PSM	AEPLKEEDGEDGSAEPPGPVK	1445	sp|Q13164|MK07_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1	ms_run[1]:scan=12688	13.233203	3	2192.0123	2192.0116	M	A	2	23
PSM	TFDECVAEGGSDCAPEK	1446	sp|Q7LGA3|HS2ST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=8723	9.5060872	2	1871.735703	1870.734944	K	L	197	214
PSM	LQGEHSQNGEEEPETEPVGEESISDAEK	1447	sp|Q5EBL4|RIPL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=9763	10.477054	3	3055.329776	3053.322142	R	V	254	282
PSM	DDMHDVEDELAK	1448	sp|Q9UEY8|ADDG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=13313	13.832104	2	1415.583184	1415.587475	K	R	633	645
PSM	ESELPPRAGNEEECPEEDMEGVEDGEEGDLK	1449	sp|O75164|KDM4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:4	ms_run[1]:scan=15748	16.217709	3	3475.432065	3474.419884	K	T	356	387
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	1450	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0		ms_run[1]:scan=19451	20.636001	4	5140.8972	5140.9082	K	R	36	81
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	1451	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0		ms_run[1]:scan=23593	29.299735	4	5140.9065	5140.9086	K	R	36	81
PSM	LSEVEEAQEASMETDPKP	1452	sp|Q6I9Y2|THOC7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:35	ms_run[1]:scan=11825	12.324068	2	2005.896921	2004.883382	K	-	187	205
PSM	AEEMDTEDRPEASGVDTEPR	1453	sp|Q8N3D4|EH1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=6697	7.6693907	3	2233.936481	2232.944085	K	S	378	398
PSM	AAAPAPEEEMDECEQALAAEPK	1454	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=13858	14.348	2	2372.0148	2372.0148	K	A	254	276
PSM	AAAPAPEEEMDECEQALAAEPK	1455	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=15228	15.681	2	2372.0148	2372.0148	K	A	254	276
PSM	AEERAELSEGQVR	1456	sp|P09493-2|TPM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3700	4.7698	3	1472.7219	1472.7219	R	Q	123	136
PSM	AGEAAELQDAEVESSAK	1457	sp|Q9NZT2-2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10157	10.823	2	1703.785	1703.7850	K	S	637	654
PSM	AQEPESGLSEETQVK	1458	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7822	8.6991	2	1630.7686	1630.7686	R	C	4060	4075
PSM	ATEMVEVGADDDEGGAERGEAGDLR	1459	sp|Q6NZI2|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:35	ms_run[2]:scan=9089	9.8336	3	2564.0933	2564.0933	K	R	338	363
PSM	AVDLVEEESGAPGEEQR	1460	sp|O60231|DHX16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11514	12.036	2	1813.833	1813.8330	R	R	311	328
PSM	AVTEQGAELSNEER	1461	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5563	6.5518	2	1531.7114	1531.7114	K	N	28	42
PSM	CDEKPEDLLEEPK	1462	sp|Q13029-5|PRDM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:4	ms_run[2]:scan=11896	12.387	3	1600.7291	1600.7291	R	T	111	124
PSM	DESANQEEPEARVPAQSESVR	1463	sp|P50552|VASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7181	8.1145	3	2327.0626	2327.0626	K	R	287	308
PSM	DGEDQTQDTELVETRPAGDR	1464	sp|P01889|HLAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8346	9.169	3	2230.9938	2230.9938	R	T	244	264
PSM	DIDDDLEGEVTEECGK	1465	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:4	ms_run[2]:scan=16588	17.082	3	1822.7415	1822.7415	K	F	414	430
PSM	DLSEVSETTESTDVK	1466	sp|P41227-2|NAA10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10749	11.352	2	1638.7472	1638.7472	K	D	196	211
PSM	DLSEVSETTESTDVK	1467	sp|P41227-2|NAA10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11324	11.863	2	1638.7472	1638.7472	K	D	196	211
PSM	DLSEVSETTESTDVK	1468	sp|P41227-2|NAA10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11882	12.375	2	1638.7472	1638.7472	K	D	196	211
PSM	DPESETDNDSQEIFK	1469	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12066	12.578	2	1752.7326	1752.7326	R	L	2486	2501
PSM	DSEIRQIECDSEDMK	1470	sp|Q96FV9|THOC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=12526	13.082	3	1853.7771	1853.7771	K	M	596	611
PSM	DSGRGDSVSDSGSDALR	1471	sp|Q53EL6-2|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3954	5.0064	3	1679.7347	1679.7347	R	S	59	76
PSM	DVPEEPSEKPEALDSSK	1472	sp|Q68DK2-3|ZFY26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7848	8.7222	3	1855.8687	1855.8687	K	S	65	82
PSM	DWEDDSDEDMSNFDR	1473	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16578	17.072	2	1874.6537	1874.6537	K	F	75	90
PSM	EAEESLQQQQQEQEEALK	1474	sp|Q4V328|GRAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8866	9.6344	3	2143.9869	2143.9869	K	Q	531	549
PSM	EAEGEQFVEEALEK	1475	sp|O14879|IFIT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=20146	21.76	2	1606.7362	1606.7362	K	S	223	237
PSM	EAELDVNEELDKK	1476	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9900	10.596	2	1530.7413	1530.7413	K	Y	34	47
PSM	EAGHGTQKEEIPEEELAEDVEEIDHAER	1477	sp|P20020-5|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=20111	21.704	5	3188.4382	3188.4382	K	E	1071	1099
PSM	EAGVEMGDEDDLSTPNEK	1478	sp|P14868-2|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12348	12.898	2	1934.8051	1934.8051	R	L	257	275
PSM	EAPGPNGATEEDGVPSK	1479	sp|P49585|PCY1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5168	6.0824	2	1653.7482	1653.7482	K	V	17	34
PSM	EEEMGEEEEVEREIIK	1480	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16777	17.276	3	1976.8885	1976.8885	R	Q	1289	1305
PSM	EEGLPEDELADPTER	1481	sp|Q5TA31|RN187_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14764	15.193	2	1698.7584	1698.7584	K	F	196	211
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	1482	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=21510	24.364	3	3657.4246	3657.4246	K	R	176	207
PSM	EEVAYDPEDETILEEAK	1483	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18826	19.704	3	1978.8895	1978.8895	R	V	1422	1439
PSM	EEVMEPPLEEESLEAK	1484	sp|P48681|NEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18199	18.922	3	1857.8554	1857.8554	R	R	1117	1133
PSM	EIESEIDSEEELINK	1485	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=17878	18.535	2	1775.8313	1775.8313	K	K	755	770
PSM	EIPVEGGQEQQTDSTK	1486	sp|Q9UJF2-2|NGAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5314	6.2137	2	1744.8115	1744.8115	K	G	110	126
PSM	EKEDNSSEEEEEIEPFPEER	1487	sp|Q4LE39-3|ARI4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13273	13.794	3	2450.0245	2450.0245	K	E	290	310
PSM	ELDDATEANEGLSR	1488	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7970	8.8304	2	1518.6798	1518.6798	R	E	1906	1920
PSM	ELDQDMVTEDEDDPGSHK	1489	sp|Q9NRL2-2|BAZ1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8719	9.503	3	2058.8324	2058.8324	K	R	692	710
PSM	ENALDRAEQAEADK	1490	sp|P09493-9|TPM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6186	7.1608	3	1558.7223	1558.7223	K	K	16	30
PSM	ENALDRAEQAEAEQK	1491	sp|P06753|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7201	8.1333	3	1700.7966	1700.7966	K	Q	17	32
PSM	ENSGDYISENEDPELQDYR	1492	sp|Q99996-5|AKAP9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=15428	15.877	2	2271.9404	2271.9404	K	Y	1240	1259
PSM	ENVEGHDLPASEK	1493	sp|Q96EN8|MOCOS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4168	5.2036	2	1423.6579	1423.6579	K	H	870	883
PSM	EPSEEPLPMETEEEDPKEEPIK	1494	sp|O14776-2|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:35	ms_run[2]:scan=11606	12.125	3	2597.1578	2597.1578	K	E	458	480
PSM	EQPPTEPGPQSASEVEK	1495	sp|Q9NZT2-2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6952	7.908	2	1808.8428	1808.8428	R	I	393	410
PSM	EQPPTEPGPQSASEVEK	1496	sp|Q9NZT2-2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6970	7.923	2	1808.8428	1808.8428	R	I	393	410
PSM	ESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEK	1497	sp|Q969G3-3|SMCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16544	17.034	4	4337.7885	4337.7885	K	K	298	340
PSM	ESLGSEEESGKDWDELEEEAR	1498	sp|Q9Y5B9|SP16H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16374	16.855	3	2423.0248	2423.0248	K	K	978	999
PSM	ETEVGDPAGNELAEPEAK	1499	sp|Q96G46-2|DUS3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11012	11.584	3	1854.8483	1854.8483	R	R	56	74
PSM	ETQTHENMSQLSEEEQNK	1500	sp|Q9BWU0|NADAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4586	5.5785	3	2160.923	2160.9230	K	D	701	719
PSM	EVLNEEDEVQPNGK	1501	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7290	8.2098	2	1598.7424	1598.7424	R	I	109	123
PSM	FEQEVEEWEEEQSCK	1502	sp|Q96RU2|UBP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:4	ms_run[2]:scan=15183	15.637	2	1984.7997	1984.7997	R	I	688	703
PSM	GDAEKPEEELEEDDDEELDETLSER	1503	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=21332	24.02	3	2920.2105	2920.2105	K	L	23	48
PSM	GEDPFTSETVDPEMEGDDNLGGEDKK	1504	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=17278	17.825	4	2810.1712	2810.1712	K	E	542	568
PSM	GEVDVTHDSEPK	1505	sp|Q9NV35|NUD15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3046	4.213	2	1311.5943	1311.5943	K	N	99	111
PSM	GGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	1506	sp|P08621-2|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:35	ms_run[2]:scan=13799	14.291	3	3388.3797	3388.3797	R	G	302	338
PSM	GGTVADLDEQDEETVTAGGKEDEDPAK	1507	sp|Q92922|SMRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13785	14.279	3	2775.2206	2775.2206	K	G	402	429
PSM	GMVAEEIEEEPAAGDDEELEEEAVPQDESSQK	1508	sp|O75691|UTP20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=19234	20.312	3	3488.4784	3488.4784	K	K	873	905
PSM	HCDDSFTPQEK	1509	sp|P36551|HEM6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=3287	4.4134	2	1362.551	1362.5510	K	L	372	383
PSM	HNLCGETEEEK	1510	sp|Q03013-2|GSTM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4	ms_run[2]:scan=2130	3.4624	2	1344.5616	1344.5616	K	I	84	95
PSM	IEYNDQNDGSCDVK	1511	sp|O75369-8|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:4	ms_run[2]:scan=4442	5.437	2	1655.6733	1655.6733	K	Y	594	608
PSM	KPVEELTEEEK	1512	sp|Q9Y2R9|RT07_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3864	4.9218	2	1329.6664	1329.6664	R	Y	53	64
PSM	KYDDDISPSEDK	1513	sp|Q07866-8|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3761	4.8271	2	1410.6151	1410.6151	K	D	156	168
PSM	LAEGEEEKPEPDISSEESVSTVEEQENETPPATSSEAEQPK	1514	sp|Q5SSJ5-5|HP1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14683	15.118	6	4441.978	4441.9780	K	G	57	98
PSM	LEGALGADTTEDGDEK	1515	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9714	10.436	2	1619.7162	1619.7162	K	S	1052	1068
PSM	LSVEESEAAGDGVDTK	1516	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11412	11.945	2	1605.737	1605.7370	K	V	427	443
PSM	LSVEESEAAGDGVDTK	1517	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13318	13.836	2	1605.737	1605.7370	K	V	427	443
PSM	MDLNSEQAEQLER	1518	sp|Q52LJ0-1|FA98B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=8184	9.023	2	1577.6991	1577.6992	K	I	197	210
PSM	MNVEEDVQEEQSK	1519	sp|P78316-2|NOP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7741	8.6267	2	1563.6723	1563.6723	K	E	338	351
PSM	NDFTEEEEAQVRK	1520	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7215	8.1458	2	1593.7271	1593.7271	K	E	143	156
PSM	NDFTEEEEAQVRK	1521	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7769	8.6538	2	1593.7271	1593.7271	K	E	143	156
PSM	PEPVLEETAPEDAQK	1522	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10630	11.245	2	1651.7941	1651.7941	K	S	215	230
PSM	PGSGGSSPGATSGSGR	1523	sp|Q9UEE5|ST17A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1378	2.3893	2	1317.5909	1317.5909	K	A	7	23
PSM	QPCPSESDIITEEDK	1524	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:4	ms_run[2]:scan=10741	11.344	2	1746.7618	1746.7618	K	S	202	217
PSM	QQMAEEMVEAAGEDER	1525	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:35	ms_run[2]:scan=10755	11.356	2	1837.7458	1837.7458	K	E	817	833
PSM	RCVMDDDNEVR	1526	sp|Q9Y678|COPG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=3466	4.5552	2	1407.5871	1407.5871	K	D	515	526
PSM	RDIQENDEEAVQVK	1527	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5756	6.7512	2	1671.8064	1671.8064	K	E	33	47
PSM	REESEAVEAGDPPEELR	1528	sp|Q9H3S7|PTN23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8192	9.0289	3	1911.881	1911.8810	R	S	730	747
PSM	RLDEELEDAEK	1529	sp|Q15008-3|PSMD6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7837	8.7124	2	1345.6361	1345.6361	K	N	44	55
PSM	RLEEGTEETSETLEK	1530	sp|Q08378-4|GOGA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4935	5.8775	3	1749.8269	1749.8269	R	L	798	813
PSM	RLEEQEEDTFR	1531	sp|Q6PL18|ATAD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4950	5.8904	2	1450.6688	1450.6688	K	E	977	988
PSM	RNHDGECTAAPTNR	1532	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=1109	1.9769	3	1597.7015	1597.7016	K	Q	1160	1174
PSM	SAEAAAAQAEEDLR	1533	sp|Q9NXH8|TOR4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11288	11.829	2	1430.6638	1430.6638	R	A	328	342
PSM	SEQDQAENEGEDSAVLMER	1534	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12523	13.08	3	2135.8913	2135.8913	K	L	522	541
PSM	SIDGTADDEDEGVPTDQAIR	1535	sp|Q9NTI5|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12099	12.622	2	2102.924	2102.9240	K	A	628	648
PSM	SLAEQRQHEEANK	1536	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1325	2.3223	2	1538.7437	1538.7437	K	T	443	456
PSM	SRDLGTQQDSSGK	1537	sp|Q9Y2F5|ICE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1074	1.94	2	1377.6484	1377.6484	K	R	1822	1835
PSM	SRDSLAPGPEPQDEDQK	1538	sp|O15013-7|ARHGA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4587	5.5791	3	1867.8548	1867.8548	K	D	1166	1183
PSM	TAEDDETPVDLNK	1539	sp|O00443|P3C2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8114	8.9631	2	1445.6522	1445.6522	R	H	520	533
PSM	TATDSDERIDDEIDTEVEETQEEK	1540	sp|Q8N5P1|ZC3H8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16719	17.214	3	2796.1945	2796.1945	K	I	18	42
PSM	TEDESLVENNDNIDEEAREELR	1541	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16499	16.982	3	2618.158	2618.1580	K	E	123	145
PSM	TGISEEAAIEENK	1542	sp|Q5UIP0-2|RIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8674	9.4611	2	1389.6624	1389.6624	K	R	1935	1948
PSM	TLEEDEEELFK	1543	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18418	19.19	1	1380.6297	1380.6297	K	M	40	51
PSM	TQDPVPPETPSDSDHK	1544	sp|A0JLT2|MED19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4558	5.5522	3	1748.7853	1748.7853	R	K	184	200
PSM	TSEQTGEPAEDTSGVIK	1545	sp|Q9NX74|DUS2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7189	8.1206	3	1747.8112	1747.8112	K	M	338	355
PSM	TSGRVAVEEVDEEGK	1546	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5503	6.4877	3	1603.7689	1603.7689	R	F	436	451
PSM	TSGRVAVEEVDEEGK	1547	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5849	6.8474	3	1603.7689	1603.7689	R	F	436	451
PSM	TSGRVAVEEVDEEGK	1548	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5770	6.765	2	1603.7689	1603.7689	R	F	436	451
PSM	TTGLEEAAEAETAK	1549	sp|P78362|SRPK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9644	10.373	3	1419.6729	1419.6729	K	D	327	341
PSM	VAEQCEPAESQPEALSEK	1550	sp|P82094|TMF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4	ms_run[2]:scan=7633	8.5315	3	2000.8997	2000.8997	K	E	427	445
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	1551	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=20379	22.148	4	3368.4764	3368.4764	K	E	312	341
PSM	VDDEPMDVDKGPGSTK	1552	sp|Q13123|RED_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5759	6.7546	3	1688.7563	1688.7563	K	E	389	405
PSM	VDENFDCVEADDVEGK	1553	sp|O14929-2|HAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=13364	13.878	3	1839.7469	1839.7469	K	I	10	26
PSM	VDENFDCVEADDVEGK	1554	sp|O14929-2|HAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=13898	14.383	2	1839.7469	1839.7469	K	I	10	26
PSM	VPGPAEGPAEPAAEASDEAER	1555	sp|Q24JP5-4|T132A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9767	10.482	3	2048.9287	2048.9287	R	R	265	286
PSM	VPLTSNDDEDEDK	1556	sp|Q562F6|SGO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4408	5.409	2	1475.6264	1475.6264	R	E	159	172
PSM	VTSPSSSSSSSSSDSESDDEADVSEVTPR	1557	sp|P56181-2|NDUV3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9722	10.442	3	2917.2068	2917.2068	K	V	148	177
PSM	YNLDASEEEDSNKK	1558	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4009	5.0537	2	1640.7166	1640.7166	K	K	183	197
PSM	HMGDLNGEEADKLDER	1559	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=8149	8.9930471	2	1828.789239	1827.805741	K	L	4762	4778
PSM	MQQNIQELEEQLEEEESAR	1560	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:35	ms_run[1]:scan=20903	23.133131	3	2348.041688	2348.043799	K	Q	941	960
PSM	LSVEESEAAGDGVDTK	1561	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=10615	11.231332	2	1605.740526	1605.736976	K	V	427	443
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	1562	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	25-UNIMOD:35	ms_run[1]:scan=15904	16.393653	4	3791.628005	3789.614378	K	A	735	771
PSM	AAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAK	1563	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	35-UNIMOD:35	ms_run[1]:scan=11653	12.170407	4	4462.584424	4461.548507	K	G	177	218
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	1564	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=7714	8.6022595	5	2982.370275	2981.385017	K	G	56	88
PSM	SQSSIVPEEEQAANKGEEK	1565	sp|Q969G3|SMCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=5247	6.1528525	3	2060.977018	2058.970558	R	K	314	333
PSM	QEAIPDLEDSPPVSDSEEQQESAR	1566	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=17147	17.676269	3	2656.195628	2655.178378	R	A	796	820
PSM	GMVAEEIEEEPAAGDDEELEEEAVPQDESSQK	1567	sp|O75691|UTP20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	2-UNIMOD:35	ms_run[1]:scan=17763	18.410989	4	3504.469707	3504.473359	K	K	873	905
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	1568	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	27-UNIMOD:35	ms_run[1]:scan=20943	23.190754	4	3773.461623	3772.433739	K	A	469	503
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	1569	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:35	ms_run[1]:scan=14423	14.871086	4	3915.655646	3915.650095	K	G	307	347
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAK	1570	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1	ms_run[1]:scan=22526	26.646285	3	3264.3612	3263.3742	M	K	2	33
PSM	GFINDDDDEDEGEEDEGSDSGDSEDDVGHK	1571	sp|Q7KZ85|SPT6H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=9422	10.173754	3	3228.160910	3227.156652	K	K	56	86
PSM	QQMAEEMVEAAGEDER	1572	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=20923	23.164603	2	1804.7227	1804.7239	K	E	817	833
PSM	QQMAEEMVEAAGEDER	1573	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:35	ms_run[1]:scan=14997	15.42014	3	1838.778132	1837.745843	K	E	817	833
PSM	GQEADLEAGGEEVPEANGSAGK	1574	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=10445	11.081691	3	2114.927572	2113.939986	K	R	226	248
PSM	TVNEDVEEMEIDEQTK	1575	sp|Q9NRL2|BAZ1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	9-UNIMOD:35	ms_run[1]:scan=14167	14.632975	3	1924.856038	1923.825533	K	V	1030	1046
PSM	QQHQEEEDILDVR	1576	sp|Q5T3I0|GPTC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=15227	15.679946	2	1620.7404	1620.7375	R	D	383	396
PSM	ELGPDGEEAEGPGAGDGPPR	1577	sp|P18615|NELFE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=8902	9.6671082	3	1906.837053	1905.834064	R	S	145	165
PSM	IEEEEEEENGDSVVQNNNTSQMSHK	1578	sp|Q5T5P2|SKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=6435	7.4076779	3	2877.200991	2875.205004	K	K	1480	1505
PSM	DELTDLDQSNVTEETPEGEEHHPVADTENKENEVEEVK	1579	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=14354	14.808713	5	4334.896907	4333.910603	K	E	229	267
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	1580	sp|Q9BTT0|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:27	ms_run[1]:scan=18843	19.727553	3	3639.4161	3639.4135	K	R	224	255
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	1581	sp|Q9BTT0|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=18162	18.875438	3	3657.430374	3657.424554	K	R	224	255
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	1582	sp|Q9BTT0|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:27	ms_run[1]:scan=16367	16.84937	3	3639.4135	3639.4135	K	R	224	255
PSM	ESSEEEYDSGVEEEGWPR	1583	sp|O76031|CLPX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=15231	15.683049	2	2112.846296	2112.839603	K	Q	609	627
PSM	ATEMVEVGADDDEGGAER	1584	sp|Q6NZI2|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=10122	10.79059	2	1849.765608	1849.763601	K	G	338	356
PSM	EEEEENDDDNSLEGETFPLER	1585	sp|Q5VSL9|STRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=18490	19.269172	2	2496.014255	2495.009581	R	D	380	401
PSM	SEDFGVNEDLADSDAR	1586	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=14511	14.95562	2	1738.728411	1738.728202	R	A	189	205
PSM	NQTAEKEEFEHQQK	1587	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=2160	3.4871475	3	1745.805563	1744.801642	K	E	584	598
PSM	GDDLEEGVTSEEFDK	1588	sp|Q6ZVM7|TM1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=14185	14.648704	2	1668.703081	1668.700256	K	F	448	463
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	1589	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=16820	17.321612	4	3370.482596	3368.476411	K	E	312	341
PSM	DYEEVGVDSVEGEGEEEGEEY	1590	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=22007	25.476097	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	1591	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=21307	23.96554	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	1592	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=21775	24.972422	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	1593	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=23997	30.509031	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	1594	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=19644	20.936137	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	1595	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=22698	26.987607	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	1596	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=23667	29.50188	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	1597	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=19945	21.440005	2	2347.901016	2347.897571	K	-	431	452
PSM	ELPTSQKGDDGPDIADEESR	1598	sp|O14686|KMT2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=8430	9.2421308	2	2158.974949	2157.966200	K	G	1816	1836
PSM	AEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPR	1599	sp|Q8IYN2|TCAL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=13771	14.266012	4	3690.657988	3688.636099	K	G	18	52
PSM	QQEAEELEADIREEK	1600	sp|Q9C035|TRIM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=18469	19.244265	2	1798.8220	1798.8216	K	A	153	168
PSM	TTGLEEAAEAETAKDNGEAEDQEEK	1601	sp|P78362|SRPK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=10967	11.544142	3	2665.137710	2664.152223	K	E	327	352
PSM	QTGQIIEDDLEEEDIK	1602	sp|Q8N4S0|CCD82_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=21661	24.69526	2	1856.8523	1856.8522	K	R	163	179
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	1603	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0		ms_run[1]:scan=21456	24.254642	4	5140.9021	5140.9086	K	R	36	81
PSM	YSEEANNLIEECEQAER	1604	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:4	ms_run[1]:scan=13489	13.998521	2	2083.865514	2082.880028	K	L	120	137
PSM	MGDEDDDESCAVELR	1605	sp|O75676|KS6A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,10-UNIMOD:4	ms_run[1]:scan=16788	17.286189	2	1781.6706	1781.6715	-	I	1	16
PSM	ALDGPEQMELEEGK	1606	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,8-UNIMOD:35	ms_run[1]:scan=16050	16.544955	2	1602.7106	1602.7078	M	A	2	16
PSM	ASEEEEDPTFCEVCGR	1607	sp|Q9P1Y6|PHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	11-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=11253	11.797115	2	1914.745014	1913.740758	K	S	176	192
PSM	AADISESSGADCK	1608	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=7330	8.2419179	2	1351.5528	1351.5557	M	G	2	15
PSM	GREEEDMEEEENDDDDDDDDEEDGVFDDEDEEEENIESK	1609	sp|Q9NW13|RBM28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=15727	16.197734	4	4652.621465	4652.617983	K	V	222	261
PSM	AAAPAPEEEMDECEQALAAEPK	1610	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=14412	14.861	2	2372.0148	2372.0148	K	A	254	276
PSM	AAAPAPEEEMDECEQALAAEPK	1611	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=15033	15.462	3	2372.0148	2372.0148	K	A	254	276
PSM	AACSSSEEDDCVSLSK	1612	sp|Q9H019-3|MFR1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=5594	6.594	2	1743.6927	1743.6927	K	A	208	224
PSM	AATEQEPLEGTEQTLDAEEEQEESEEAACGSKK	1613	sp|Q9ULW3|ABT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	29-UNIMOD:4	ms_run[2]:scan=16283	16.766	4	3622.5588	3622.5588	K	R	9	42
PSM	AAVEDINPADDPNNQGEDEFEEAEQVREENLPDENEEQK	1614	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=19102	20.14	4	4454.9018	4454.9018	R	Q	543	582
PSM	ADPPPEESQAPQAQTAAAEAP	1615	sp|O95785-2|WIZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10797	11.392	2	2074.9443	2074.9443	K	-	774	795
PSM	AKAEASSGDHPTDTEMK	1616	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:35	ms_run[2]:scan=1552	2.6238	3	1789.7789	1789.7789	K	E	425	442
PSM	AKAEASSGDHPTDTEMK	1617	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:35	ms_run[2]:scan=1556	2.6288	2	1789.7789	1789.7789	K	E	425	442
PSM	ALEEEEDDRPYDPEEEYDPER	1618	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12871	13.404	3	2624.0674	2624.0674	K	A	1375	1396
PSM	APIDTSDVEEK	1619	sp|Q06265-3|EXOS9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6039	7.035	2	1202.5667	1202.5667	K	A	217	228
PSM	AQEPESGLSEETQVK	1620	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7270	8.1936	3	1630.7686	1630.7686	R	C	4060	4075
PSM	AQGEPVAGHESPK	1621	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2087	3.4294	2	1305.6313	1305.6313	R	I	522	535
PSM	ATCCPDVQPEEAEDHL	1622	sp|Q9P107-2|GMIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=12697	13.244	2	1869.7509	1869.7509	R	-	929	945
PSM	AVTEQGAELSNEER	1623	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6066	7.0586	2	1531.7114	1531.7114	K	N	28	42
PSM	DAVAHCHEAER	1624	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4	ms_run[2]:scan=80	0.07141	2	1293.552	1293.5520	K	N	183	194
PSM	DCDLQEDACYNCGR	1625	sp|P62633-7|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=7825	8.7013	2	1774.6345	1774.6345	K	G	49	63
PSM	DCDLQEDEACYNCGR	1626	sp|P62633-8|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8415	9.2307	3	1903.6771	1903.6771	K	G	59	74
PSM	DDCDETGIEEANELTK	1627	sp|O60503|ADCY9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4	ms_run[2]:scan=14166	14.632	3	1837.7524	1837.7524	K	L	1331	1347
PSM	DEEERYFDEEEPEDAPSPELDGD	1628	sp|Q96F63|CCD97_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=18587	19.394	3	2711.0518	2711.0518	R	-	321	344
PSM	DELNLADSEVDNQK	1629	sp|Q96SB8|SMC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12690	13.237	2	1588.7217	1588.7217	K	R	799	813
PSM	DIDDDLEGEVTEECGK	1630	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:4	ms_run[2]:scan=17068	17.593	3	1822.7415	1822.7415	K	F	414	430
PSM	DLDEDANGITDEGK	1631	sp|Q5QJE6|TDIF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9662	10.389	2	1490.6373	1490.6373	K	E	298	312
PSM	DLGSTEDGDGTDDFLTDKEDEK	1632	sp|Q15527|SURF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14406	14.854	3	2400.9929	2400.9929	K	A	180	202
PSM	DLSEVSETTESTDVK	1633	sp|P41227-2|NAA10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12993	13.529	2	1638.7472	1638.7472	K	D	196	211
PSM	DLSEVSETTESTDVK	1634	sp|P41227-2|NAA10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13537	14.043	2	1638.7472	1638.7472	K	D	196	211
PSM	DLSEVSETTESTDVK	1635	sp|P41227-2|NAA10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14090	14.565	2	1638.7472	1638.7472	K	D	196	211
PSM	DREAAEGLGSHDR	1636	sp|P17655|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2229	3.5401	3	1411.644	1411.6440	K	A	11	24
PSM	DRVAGESAEPEPEPEADYYAK	1637	sp|P01137|TGFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10258	10.911	3	2322.0288	2322.0288	R	E	86	107
PSM	DSGSDQDLDGAGVR	1638	sp|Q86VM9-2|ZCH18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5690	6.6959	2	1390.5961	1390.5961	R	A	31	45
PSM	DTDMDGVGDQCDNCPLEHNPDQLDSDSDR	1639	sp|P07996-2|TSP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:35,11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=12145	12.678	3	3335.2521	3335.2521	R	I	738	767
PSM	DVRDMDDAYDR	1640	sp|P07686|HEXB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6033	7.031	2	1369.5568	1369.5568	K	L	518	529
PSM	EAAGSVRTEEVESR	1641	sp|Q5T3I0|GPTC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2913	4.104	3	1518.7274	1518.7274	K	A	314	328
PSM	EATEAQSLEATCEK	1642	sp|Q96PC5|MIA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:4	ms_run[2]:scan=5696	6.7	2	1565.6879	1565.6879	K	L	728	742
PSM	EEEAIKEEVVK	1643	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5269	6.1732	2	1301.6715	1301.6715	K	E	586	597
PSM	EEEGVPDEEGWVK	1644	sp|Q9NSQ0|RRP7B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13821	14.314	2	1501.6573	1501.6573	K	V	17	30
PSM	EEIKEEVFQEPAEEER	1645	sp|Q9P2N5|RBM27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11888	12.381	3	1989.9167	1989.9167	K	D	96	112
PSM	EEVMEPPLEEESLEAK	1646	sp|P48681|NEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=18221	18.954	2	1857.8554	1857.8554	R	R	1117	1133
PSM	EEVQSLREEAEK	1647	sp|Q14980-4|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4624	5.6064	3	1445.6998	1445.6998	R	Q	1292	1304
PSM	EFGDGSDENEMEEHELK	1648	sp|Q5F1R6|DJC21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10083	10.757	3	1993.7847	1993.7847	K	D	278	295
PSM	EFLEDYDDDRDDPK	1649	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11092	11.654	2	1770.7221	1770.7221	K	Y	498	512
PSM	EIESEIDSEEELINK	1650	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=19470	20.667	2	1775.8313	1775.8313	K	K	755	770
PSM	EIVEVKEENIEDATEK	1651	sp|P82970|HMGN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12085	12.602	3	1873.9157	1873.9157	K	G	96	112
PSM	EIVEVKEENIEDATEK	1652	sp|P82970|HMGN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14563	15.003	3	1873.9157	1873.9157	K	G	96	112
PSM	ENSSSVTVSDPEMENK	1653	sp|C9J7I0|UMAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7271	8.1943	2	1751.752	1751.7520	K	A	56	72
PSM	ERIMNEEDPEK	1654	sp|Q96A33-2|CCD47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3481	4.5678	2	1388.6242	1388.6242	K	Q	442	453
PSM	ERQITEEDLEGK	1655	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5573	6.5644	2	1445.6998	1445.6998	K	T	85	97
PSM	ESSEEEYDSGVEEEGWPR	1656	sp|O76031|CLPX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14666	15.101	3	2112.8396	2112.8396	K	Q	609	627
PSM	FDYDDEPEAVEESK	1657	sp|O95104-2|SCAF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12366	12.917	2	1671.6788	1671.6788	R	K	265	279
PSM	FEQEVEEWEEEQSCK	1658	sp|Q96RU2|UBP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:4	ms_run[2]:scan=15190	15.644	3	1984.7997	1984.7997	R	I	688	703
PSM	FVDEEDGGDGQAGPDEGEVDSCLR	1659	sp|O15511|ARPC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	22-UNIMOD:4	ms_run[2]:scan=12502	13.06	2	2552.0245	2552.0245	K	Q	24	48
PSM	GDAEKPEEELEEDDDEELDETLSER	1660	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17826	18.483	4	2920.2105	2920.2105	K	L	23	48
PSM	GTGEAEEEYVGPR	1661	sp|Q13895|BYST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6263	7.2273	2	1392.6157	1392.6157	R	L	41	54
PSM	HEDLQTDESSMDDRHPR	1662	sp|Q6VN20-2|RBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2981	4.1589	3	2066.8712	2066.8712	K	R	394	411
PSM	HLYECTEEENDNSLEK	1663	sp|Q9NXC5-2|MIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4	ms_run[2]:scan=5841	6.8394	3	2008.832	2008.8320	R	D	373	389
PSM	KETEGDVTSVK	1664	sp|P50990-3|TCPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2314	3.6095	2	1191.5983	1191.5983	K	D	152	163
PSM	KGENSVSVDGK	1665	sp|O14617-3|AP3D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1558	2.6301	2	1118.5568	1118.5568	K	C	953	964
PSM	KTIQGDEEDLR	1666	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3405	4.5065	2	1302.6416	1302.6416	K	-	285	296
PSM	KVEEVLEEEEEEYVVEK	1667	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17848	18.507	2	2108.0049	2108.0049	K	V	9	26
PSM	LAEGEEEKPEPDISSEESVSTVEEQENETPPATSSEAEQPK	1668	sp|Q5SSJ5-5|HP1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=15607	16.077	4	4441.978	4441.9780	K	G	57	98
PSM	LPPNTNDEVDEDPTGNK	1669	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7222	8.1525	3	1853.8279	1853.8279	R	A	1058	1075
PSM	LSEGQEEENLENEMK	1670	sp|Q15276-2|RABE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:35	ms_run[2]:scan=7173	8.1086	2	1793.7625	1793.7625	R	K	161	176
PSM	MLADDAEAGAEDEK	1671	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6458	7.4338	2	1463.6086	1463.6086	K	E	481	495
PSM	MLGEDSDEEEEMDTSERK	1672	sp|Q9BWU0|NADAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7685	8.5766	3	2128.8413	2128.8413	K	I	307	325
PSM	NDMDEPPSGDFGGDEEK	1673	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9896	10.593	2	1837.6949	1837.6949	K	S	578	595
PSM	NEEPSEEEIDAPKPK	1674	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5550	6.5327	3	1710.7948	1710.7948	K	K	117	132
PSM	NIEEHASSDVER	1675	sp|Q92930|RAB8B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2853	4.0531	2	1384.6219	1384.6219	R	M	105	117
PSM	NRPDYVSEEEEDDEDFETAVK	1676	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17708	18.347	3	2515.0511	2515.0511	K	K	2662	2683
PSM	PANKQEDEVMR	1677	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2376	3.6585	2	1315.619	1315.6190	K	A	120	131
PSM	PSWADQVEEEGEDDK	1678	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13141	13.672	3	1732.7064	1732.7064	K	C	10	25
PSM	QDNLEIDEIEDENIK	1679	sp|Q96PY6-4|NEK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=18219	18.953	2	1815.8374	1815.8374	R	E	1005	1020
PSM	QHCTEEDEEEDEEEEEESFMTSR	1680	sp|Q9NY27-3|PP4R2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4	ms_run[2]:scan=13251	13.773	3	2903.0505	2903.0505	R	E	238	261
PSM	QLHQSCQTDDGEDDLK	1681	sp|P61201|CSN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4	ms_run[2]:scan=3160	4.3127	3	1887.7905	1887.7905	R	K	174	190
PSM	QLQDEREAVQK	1682	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2644	3.8772	2	1342.6841	1342.6841	K	K	34	45
PSM	QPCPSESDIITEEDK	1683	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4	ms_run[2]:scan=10747	11.351	3	1746.7618	1746.7618	K	S	202	217
PSM	QQNQEITDQLEEEKK	1684	sp|Q08379|GOGA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6511	7.4901	3	1858.8909	1858.8908	K	E	189	204
PSM	QTGQIIEDDLEEEDIK	1685	sp|Q8N4S0|CCD82_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17858	18.516	3	1873.8793	1873.8793	K	R	163	179
PSM	RAGELTEDEVER	1686	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4045	5.0894	2	1402.6688	1402.6688	K	V	55	67
PSM	RCEEEAQEIVR	1687	sp|Q5TKA1-3|LIN9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4	ms_run[2]:scan=4073	5.1179	2	1417.662	1417.6620	R	H	399	410
PSM	RDIQENDEEAVQVK	1688	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5100	6.0223	3	1671.8064	1671.8064	K	E	33	47
PSM	RDIQENDEEAVQVK	1689	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6771	7.742	2	1671.8064	1671.8064	K	E	33	47
PSM	RDQALTEEHAR	1690	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1957	3.3312	2	1324.6484	1324.6484	R	Q	614	625
PSM	RGHTASESDEQQWPEEK	1691	sp|Q9NTI5|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3088	4.2464	2	2012.8824	2012.8824	K	R	1252	1269
PSM	RPAEDMEEEQAFK	1692	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6158	7.1361	3	1578.6984	1578.6984	K	R	22	35
PSM	RSEEEEAPPDGAVAEYR	1693	sp|Q6UX04-2|CWC27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7060	8.0029	3	1903.8548	1903.8548	K	R	345	362
PSM	RSYEDDDDMDLQPNK	1694	sp|Q9BTE3-2|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7221	8.1518	3	1839.7581	1839.7581	K	Q	166	181
PSM	SDEVDEQVACQEVK	1695	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4	ms_run[2]:scan=7816	8.695	2	1634.7094	1634.7094	K	V	1407	1421
PSM	SEDCRESEIETNTELK	1696	sp|Q5VUA4|ZN318_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4	ms_run[2]:scan=6849	7.8158	2	1938.8477	1938.8477	K	E	1767	1783
PSM	SETRENGVTDDLDAPK	1697	sp|Q9BQ39|DDX50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6008	7.0118	3	1745.8068	1745.8068	K	A	45	61
PSM	SNGALSTEEREEEMK	1698	sp|Q8IUD2-4|RB6I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4157	5.1935	3	1708.7574	1708.7574	K	Q	410	425
PSM	SQAEEEIDEIRK	1699	sp|Q5T1M5|FKB15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7326	8.2391	2	1445.6998	1445.6998	R	S	755	767
PSM	SSGREEDDEELLR	1700	sp|O14639-4|ABLM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5918	6.9255	3	1533.6907	1533.6907	R	R	209	222
PSM	STTQELMEDDRVK	1701	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:35	ms_run[2]:scan=4028	5.069	2	1566.7196	1566.7196	R	R	2205	2218
PSM	SVQEGENPDDGVRGSPPEDYR	1702	sp|P42696-2|RBM34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6738	7.7116	2	2302.0098	2302.0098	R	L	14	35
PSM	TAEDYSVDENGQR	1703	sp|O60488-2|ACSL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4098	5.1403	2	1482.6223	1482.6223	K	W	496	509
PSM	TAFYNEDDSEEEQR	1704	sp|Q8WWQ0|PHIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7035	7.9783	2	1731.686	1731.6860	R	Q	1775	1789
PSM	TEEIAEEEETVFPK	1705	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16892	17.407	2	1649.7672	1649.7672	K	A	41	55
PSM	TEEQIAAEEAWNETEK	1706	sp|Q92614-2|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=15818	16.299	3	1876.8327	1876.8327	K	V	5	21
PSM	TEQEEDEELLSESRK	1707	sp|P28370-2|SMCA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7549	8.4501	3	1820.8276	1820.8276	R	T	149	164
PSM	TGISEEAAIEENK	1708	sp|Q5UIP0-2|RIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9218	9.9698	2	1389.6624	1389.6624	K	R	1935	1948
PSM	TKDEIVDIDDPETK	1709	sp|Q96QT4|TRPM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10809	11.404	2	1616.7781	1616.7781	R	R	603	617
PSM	TKGDSDEEVIQDGVR	1710	sp|Q9BUE6|ISCA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6049	7.0439	3	1646.7748	1646.7748	K	V	69	84
PSM	TPPLEEQAEDKK	1711	sp|O75167-5|PHAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3480	4.567	3	1383.6882	1383.6882	K	A	129	141
PSM	TQEPVLPEDTTTEEK	1712	sp|Q15772-1|SPEG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10149	10.815	2	1715.8101	1715.8101	R	R	339	354
PSM	TSPDEDEDDLLPPEQK	1713	sp|P15923|TFE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13284	13.804	2	1826.8058	1826.8058	R	A	528	544
PSM	TTCMSSQGSDDEQIK	1714	sp|Q9P0V9|SEP10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4	ms_run[2]:scan=3803	4.8651	2	1685.6873	1685.6873	K	R	20	35
PSM	TVEEEDQIFLDGQENK	1715	sp|Q6PJE2-5|POZP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16282	16.765	3	1892.864	1892.8640	R	R	59	75
PSM	VELSEDSPNSEQDLEK	1716	sp|Q5T5P2-4|SKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9453	10.2	3	1817.8167	1817.8167	K	L	707	723
PSM	VQVVDEEGDQQHQEGK	1717	sp|Q02447-4|SP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3264	4.3949	3	1823.8286	1823.8286	R	R	276	292
PSM	VREEEIEVDSR	1718	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4647	5.6248	2	1359.663	1359.6630	R	V	628	639
PSM	YNLDASEEEDSNK	1719	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5831	6.8271	2	1512.6216	1512.6216	K	K	183	196
PSM	YQGDGIVEDEEETMENNEEK	1720	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=15621	16.091	3	2356.9489	2356.9489	K	K	841	861
PSM	QEEEMMAKEEELVK	1721	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=11836	12.334147	3	1706.7652	1704.7582	R	V	843	857
PSM	LSVEESEAAGDGVDTK	1722	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=9998	10.683138	2	1605.737521	1605.736976	K	V	427	443
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	1723	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	23-UNIMOD:35	ms_run[1]:scan=17796	18.450148	3	3592.498811	3590.482301	K	A	737	771
PSM	TGEEDEEEFFCNR	1724	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:4	ms_run[1]:scan=14042	14.518721	2	1660.632231	1660.631131	K	A	1186	1199
PSM	LEDTENWLYEDGEDQPK	1725	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=17652	18.284829	2	2080.871895	2079.890910	K	Q	652	669
PSM	EGLELPEDEEEKK	1726	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=9026	9.7766372	2	1543.726534	1543.725348	K	K	412	425
PSM	NEDEEEEEEEKDEAEDLLGR	1727	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=18329	19.074959	3	2406.966241	2405.983032	K	G	434	454
PSM	KFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	1728	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	28-UNIMOD:35	ms_run[1]:scan=19672	20.983135	4	3901.559454	3900.528702	K	A	468	503
PSM	EGNEMEGEELDPLDAYMEEVK	1729	sp|Q7L014|DDX46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:35,17-UNIMOD:35	ms_run[1]:scan=20719	22.808175	3	2458.011065	2458.003968	K	E	216	237
PSM	QREDQEQLQEEIK	1730	sp|Q99996|AKAP9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=9959	10.646084	2	1654.7806	1654.7793	R	R	1619	1632
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	1731	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:35	ms_run[1]:scan=14979	15.402538	4	3916.677264	3915.650095	K	G	307	347
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAKK	1732	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1	ms_run[1]:scan=20067	21.647464	4	3391.4689	3391.4694	M	D	2	34
PSM	MPEEEDEAPVLDVR	1733	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:35	ms_run[1]:scan=14309	14.766638	2	1643.736174	1643.734868	K	Y	467	481
PSM	AAAPAPEEEMDECEQALAAEPK	1734	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[1]:scan=17638	18.263796	2	2373.007664	2372.014808	K	A	254	276
PSM	QMEEEGEEFTEGEHPETLSR	1735	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=16622	17.123927	3	2345.9624	2345.9589	K	L	1056	1076
PSM	CDGERDCPDGSDEAPEICPQSK	1736	sp|Q07954|LRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=10637	11.250034	3	2503.9552	2503.9521	R	A	47	69
PSM	DIDDDLEGEVTEECGK	1737	sp|Q9UHX1|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:4	ms_run[1]:scan=17716	18.358166	2	1822.728087	1822.741469	K	F	474	490
PSM	GDRSEDFGVNEDLADSDAR	1738	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=13237	13.760872	3	2067.859127	2066.877720	K	A	186	205
PSM	MEDEEVAESWEEAADSGEIDR	1739	sp|Q7Z422|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=22310	26.185614	3	2453.9629	2453.9647	-	R	1	22
PSM	QELQEEEEQTKPPR	1740	sp|P18858|DNLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=7808	8.6868325	2	1722.8078	1722.8055	K	R	209	223
PSM	AALSASEGEEVPQDK	1741	sp|O95831|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=7703	8.5921535	2	1530.708243	1529.720932	K	A	113	128
PSM	ELRDEEQTAESIK	1742	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:27	ms_run[1]:scan=10469	11.103475	2	1528.7379	1528.7364	K	N	314	327
PSM	QQHQQQLAEDAK	1743	sp|Q8N3F8|MILK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=3186	4.3327535	2	1405.6581	1405.6581	K	D	239	251
PSM	SVTNGQSNQPSNEGDAIK	1744	sp|Q9NS87|KIF15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=4308	5.3269329	2	1846.855960	1844.850048	R	V	11	29
PSM	FDYDDEPEAVEESK	1745	sp|O95104|SCAF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=12475	13.032549	2	1671.677558	1671.678792	R	K	265	279
PSM	DAINQGMDEELERDEK	1746	sp|P11177|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=11704	12.216851	2	1890.824334	1890.826536	R	V	37	53
PSM	KVEEVLEEEEEEYVVEK	1747	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=21335	24.024072	3	2109.006777	2108.004877	K	V	9	26
PSM	DYEEVGVDSVEGEGEEEGEEY	1748	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=22444	26.484886	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	1749	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=20796	22.95968	2	2347.901016	2347.897571	K	-	431	452
PSM	QDAQDRLDEMDQQK	1750	sp|Q9UBC2|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=9934	10.625527	2	1701.7223	1701.7259	K	A	443	457
PSM	ALEEPAEEEVLEVEAACEK	1751	sp|Q8N1W2|ZN710_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	17-UNIMOD:4	ms_run[1]:scan=20561	22.464512	3	2145.985993	2143.983096	R	H	75	94
PSM	CECDDGFTGADCGELK	1752	sp|P24821|TENA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=16417	16.895451	2	1815.6376	1815.6381	R	C	392	408
PSM	AEGGAADLDTQR	1753	sp|Q9Y4E8|UBP15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1	ms_run[1]:scan=8475	9.2853434	2	1244.5641	1244.5628	M	S	2	14
PSM	AGPGADNGEEGEIEEEMENPEMVDLPEK	1754	sp|Q13330|MTA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	17-UNIMOD:35,22-UNIMOD:35	ms_run[1]:scan=20230	21.891418	3	3049.288064	3046.254322	K	L	71	99
PSM	SVTEQGAELSNEER	1755	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=7177	8.1115323	2	1548.698151	1547.706344	K	N	28	42
PSM	AELGEADEAELQR	1756	sp|Q9Y5J9|TIM8B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1	ms_run[1]:scan=16686	17.184593	2	1471.6775	1471.6785	M	L	2	15
PSM	AELGEADEAELQR	1757	sp|Q9Y5J9|TIM8B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1	ms_run[1]:scan=17163	17.693642	2	1471.6775	1471.6785	M	L	2	15
PSM	DTSDVEPTAPMEEPTVVEESQGTPEEESPAK	1758	sp|Q5JVS0|HABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:35	ms_run[1]:scan=18009	18.701733	3	3331.478224	3330.445688	K	V	246	277
PSM	TFDECVAEGGSDCAPEK	1759	sp|Q7LGA3|HS2ST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=8706	9.4893328	2	1870.735163	1870.734944	K	L	197	214
PSM	SSRLEEDDGDVAMSDAQDGPR	1760	sp|Q9UBU9|NXF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:35	ms_run[1]:scan=3813	4.8745879	3	2264.968204	2264.945148	R	V	49	70
PSM	TEPEEVSIEDSAQSDLK	1761	sp|Q16666|IF16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=14676	15.110398	2	1876.866832	1875.858547	K	E	562	579
PSM	DLSEVSETTESTDVK	1762	sp|P41227|NAA10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=14271	14.731492	2	1638.753367	1638.747206	K	D	211	226
PSM	VQPPPETPAEEEMETETEAEALQEK	1763	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=19507	20.715099	4	2812.265205	2811.264416	K	E	1076	1101
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	1764	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0		ms_run[1]:scan=20393	22.172556	4	5141.9002	5140.9082	K	R	36	81
PSM	EGEEQLQTQHQK	1765	sp|P30876|RPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=2109	3.4458926	2	1454.685822	1453.679735	K	T	135	147
PSM	QLSESESSLEMDDER	1766	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=16928	17.441864	2	1736.7051	1736.7042	R	Y	321	336
PSM	MGDEDDDESCAVELR	1767	sp|O75676|KS6A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,10-UNIMOD:4	ms_run[1]:scan=16688	17.186126	2	1781.6706	1781.6715	-	I	1	16
PSM	MESGSTAASEEAR	1768	sp|P10644|KAP0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1	ms_run[1]:scan=6639	7.6173738	2	1366.5652	1366.5665	-	S	1	14
PSM	NENGAPEDEENFEEAIK	1769	sp|Q13564|ULA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=15487	15.946024	2	1934.804115	1933.817745	K	N	254	271
PSM	NENGAPEDEENFEEAIK	1770	sp|Q13564|ULA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=17081	17.60516	2	1934.800408	1933.817745	K	N	254	271
PSM	QDENDDDDDWNPCK	1771	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,13-UNIMOD:4	ms_run[1]:scan=12287	12.832541	2	1747.5898	1747.5899	K	A	333	347
PSM	NGEEPLPSEEEHCSVVEVTEEEVK	1772	sp|Q8N5S9|KKCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:4	ms_run[1]:scan=18553	19.360465	3	2755.201981	2754.217800	K	N	412	436
PSM	ADLEEQLSDEEK	1773	sp|P47755|CAZA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1	ms_run[1]:scan=18898	19.819756	2	1446.6362	1446.6357	M	V	2	14
PSM	AADISESSGADCK	1774	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=7884	8.75285	2	1351.5552	1351.5557	M	G	2	15
PSM	CDEKPEDLLEEPK	1775	sp|Q13029|PRDM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=17127	17.651268	2	1583.7033	1583.7020	R	T	312	325
PSM	GDLSDVEEEEEEEMDVDEATGAVK	1776	sp|Q96ST3|SIN3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=19977	21.491493	3	2625.085887	2624.080698	R	K	829	853
PSM	NENGIDAEPAEEAVIQK	1777	sp|Q96Q45|TM237_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=14082	14.558949	2	1826.852269	1825.869387	R	P	110	127
PSM	MEQEPQNGEPAEIK	1778	sp|Q8N0X7|SPART_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1	ms_run[1]:scan=12331	12.880747	2	1640.7363	1640.7347	-	I	1	15
PSM	AAAPAPEEEMDECEQALAAEPK	1779	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=14515	14.959	3	2372.0148	2372.0148	K	A	254	276
PSM	AADEEAFEDNSEEYIR	1780	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15381	15.832	3	1886.7806	1886.7806	R	R	356	372
PSM	AADEEAFEDNSEEYIR	1781	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13682	14.182	3	1886.7806	1886.7806	R	R	356	372
PSM	AALSASEGEEVPQDK	1782	sp|O95831-3|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6477	7.4519	2	1529.7209	1529.7209	K	A	109	124
PSM	AAQVAQDEEIAR	1783	sp|Q8IVM0-2|CCD50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4977	5.9118	2	1299.6419	1299.6419	R	L	372	384
PSM	ADAEENLEDAMEEVR	1784	sp|Q68DH5|LMBD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=19994	21.526	2	1719.7258	1719.7258	K	K	238	253
PSM	AEERAEVSELK	1785	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3733	4.8031	2	1259.6357	1259.6357	R	C	143	154
PSM	APPHELTEEEK	1786	sp|Q13409-6|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2949	4.1346	2	1278.6092	1278.6092	K	Q	177	188
PSM	AQEAMMDETPDSSK	1787	sp|P29375-2|KDM5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5701	6.7035	2	1538.6229	1538.6229	R	L	860	874
PSM	AQGEPVAGHESPK	1788	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2056	3.4071	2	1305.6313	1305.6313	R	I	522	535
PSM	ATEGSGSMRGGGGGNAR	1789	sp|O94874-3|UFL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=78	0.069897	3	1520.675	1520.6750	K	E	425	442
PSM	AVGDTVAEDEVVCEIETDK	1790	sp|P36957|ODO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:4	ms_run[2]:scan=20487	22.325	2	2077.9361	2077.9361	K	T	92	111
PSM	AVTEQGHELSNEER	1791	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2836	4.0388	3	1597.7332	1597.7332	K	N	28	42
PSM	DAINQGMDEELERDEK	1792	sp|P11177-3|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11374	11.912	3	1890.8265	1890.8265	R	V	37	53
PSM	DELTDLDQSNVTEETPEGEEHHPVADTENK	1793	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12879	13.412	3	3377.4655	3377.4655	K	E	223	253
PSM	DGDGEGAGGAPEEMPVDR	1794	sp|P28702|RXRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9357	10.112	2	1757.7163	1757.7163	K	I	286	304
PSM	DGPGETDAFGNSEGK	1795	sp|O94925-2|GLSK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5865	6.8663	2	1479.6114	1479.6114	K	E	107	122
PSM	DGQVINETSQHHDDLE	1796	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6508	7.4878	2	1835.7922	1835.7922	R	-	451	467
PSM	DLDDTSVVEDGRK	1797	sp|Q9Y4D7-2|PLXD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6892	7.8537	2	1447.6791	1447.6791	R	K	1622	1635
PSM	DSDAGSSTPTTSTR	1798	sp|P51532-5|SMCA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2404	3.6792	2	1381.5957	1381.5957	R	S	1383	1397
PSM	DSLTSPEDELGAEVGDEAGDKK	1799	sp|A8MVW0|F1712_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=16157	16.642	3	2261.0183	2261.0183	R	S	788	810
PSM	DSSSTNLESMDTS	1800	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10128	10.797	1	1372.53	1372.5300	K	-	1218	1231
PSM	DVDSEISDLENEVENK	1801	sp|Q96SB8|SMC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=22461	26.529	3	1833.8116	1833.8116	R	T	663	679
PSM	DVENDGPEPSDWDR	1802	sp|Q06190-3|P2R3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11755	12.263	2	1629.6543	1629.6543	K	F	339	353
PSM	DVPEEPSEKPEALDSSK	1803	sp|Q68DK2-3|ZFY26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7854	8.7268	2	1855.8687	1855.8687	K	S	65	82
PSM	EAEGEQFVEEALEK	1804	sp|O14879|IFIT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20151	21.768	3	1606.7362	1606.7362	K	S	223	237
PSM	EDDIEDTMEESGWK	1805	sp|Q92544|TM9S4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=17685	18.321	2	1682.6618	1682.6618	K	L	315	329
PSM	EDINAIEMEEDKR	1806	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:35	ms_run[2]:scan=7602	8.5022	2	1606.7145	1606.7145	K	D	262	275
PSM	EDLSSNCPGPTSADHD	1807	sp|Q8N954-2|GPT11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4	ms_run[2]:scan=5370	6.2641	2	1700.6584	1700.6584	K	-	141	157
PSM	EDQTEYLEERR	1808	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5133	6.0528	2	1466.6638	1466.6638	K	I	192	203
PSM	EEAEAPVEDGSQPPPPEPK	1809	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8064	8.9184	2	2001.9167	2001.9167	K	G	624	643
PSM	EEAGGGISEEEAAQYDR	1810	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15455	15.911	2	1809.7653	1809.7653	K	Q	5	22
PSM	EEEEDTFIEEQQLEEEK	1811	sp|Q15696|U2AFM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=16433	16.912	3	2152.9172	2152.9172	K	L	46	63
PSM	EEEEENVQSEWR	1812	sp|O95425-2|SVIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8591	9.3846	2	1562.6485	1562.6485	R	L	1445	1457
PSM	EEIPEEELAEDVEEIDHAER	1813	sp|P20020-5|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20514	22.379	3	2380.0554	2380.0554	K	E	1079	1099
PSM	EEIPEEELAEDVEEIDHAER	1814	sp|P20020-5|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=22320	26.209	3	2380.0554	2380.0554	K	E	1079	1099
PSM	EEPAAAGSGAASPSAAEK	1815	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3412	4.5111	3	1599.7376	1599.7376	K	G	70	88
PSM	EEQELMEEINEDEPVK	1816	sp|O14776-2|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=18805	19.679	2	1959.8619	1959.8619	K	A	588	604
PSM	EEVMEPPLEEESLEAK	1817	sp|P48681|NEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=18283	19.027	2	1857.8554	1857.8554	R	R	1117	1133
PSM	EKADEVVAPGQEK	1818	sp|Q8IY37|DHX37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3251	4.3836	2	1398.6991	1398.6991	K	I	130	143
PSM	ELEEREIDDTYIEDAADVDAR	1819	sp|Q99459|CDC5L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=18660	19.485	3	2466.1034	2466.1034	K	K	501	522
PSM	ENTPSEANLQEEEVR	1820	sp|Q93062-4|RBPMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8766	9.5463	3	1743.7911	1743.7911	K	T	10	25
PSM	EPSQAAAIHPDNCEESEVSER	1821	sp|Q9BZQ8|NIBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:4	ms_run[2]:scan=6988	7.9377	3	2354.0081	2354.0081	K	E	751	772
PSM	EQPPTEPGPQSASEVEK	1822	sp|Q9NZT2-2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6955	7.9099	3	1808.8428	1808.8428	R	I	393	410
PSM	EQTEGEYSSLEHESAR	1823	sp|O43837-2|IDH3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5694	6.6987	3	1850.7919	1850.7919	R	G	165	181
PSM	ERDSELSDTDSGCCLGQSESDK	1824	sp|Q96T88|UHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=6026	7.0265	3	2473.9809	2473.9809	K	S	85	107
PSM	ESEPESPMDVDNSK	1825	sp|Q86W56-3|PARG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7184	8.1168	2	1562.6406	1562.6406	K	N	189	203
PSM	ETVEEQVSTTER	1826	sp|Q13619-2|CUL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5673	6.6811	2	1406.6525	1406.6525	K	V	576	588
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	1827	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=21035	23.354	4	3756.4388	3756.4388	K	A	469	503
PSM	GAVAEDGDELRTEPEAK	1828	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5844	6.8417	3	1785.8381	1785.8381	K	K	8	25
PSM	GEDLTEEEDGGIIR	1829	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13409	13.92	2	1531.7002	1531.7002	K	R	139	153
PSM	GGTVADLDEQDEETVTAGGKEDEDPAK	1830	sp|Q92922|SMRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11169	11.726	4	2775.2206	2775.2206	K	G	402	429
PSM	GPGDTSNFDDYEEEEIR	1831	sp|P17612-2|KAPCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14906	15.333	3	1971.797	1971.7970	K	V	313	330
PSM	HRAEEPEEEEEVVEAEEETWAR	1832	sp|Q9P2Y4|ZN219_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=18140	18.845	4	2682.1681	2682.1681	R	G	421	443
PSM	IAECSSQLAEEEEK	1833	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:4	ms_run[2]:scan=6237	7.2039	3	1621.7141	1621.7141	R	A	1008	1022
PSM	IEADSESQEDIIR	1834	sp|P55957|BID_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9972	10.66	2	1503.7053	1503.7053	R	N	72	85
PSM	IHSNSSSEEVSQELESDDG	1835	sp|Q7Z2X4-3|PCLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9122	9.8661	2	2047.8454	2047.8454	R	-	150	169
PSM	IKEEPLDDEYDK	1836	sp|Q5VZL5-2|ZMYM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6285	7.2454	3	1492.6933	1492.6933	R	A	249	261
PSM	ILGENEEEEDLAESGR	1837	sp|Q9Y4C8|RBM19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12645	13.192	3	1788.8014	1788.8014	R	L	388	404
PSM	KEAVAPVQEESDLEK	1838	sp|Q13409-6|DC1I2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6534	7.5162	3	1670.8363	1670.8363	K	K	41	56
PSM	KETSAVAEAQK	1839	sp|Q5VZE5-2|NAA35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1083	1.9486	2	1160.6037	1160.6037	K	L	253	264
PSM	KGQEADLEAGGEEVPEANGSAGK	1840	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7250	8.1772	3	2242.0349	2242.0349	K	R	225	248
PSM	KNTNSNVAMDEEDPA	1841	sp|O75575-4|RPC9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5139	6.0569	2	1633.689	1633.6890	K	-	57	72
PSM	KVEEVLEEEEEEYVVEK	1842	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=21801	25.033	3	2108.0049	2108.0049	K	V	9	26
PSM	LEVAEAEEEETSIK	1843	sp|O15213|WDR46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14057	14.534	2	1575.7516	1575.7516	R	A	132	146
PSM	LGNAPAEVDEEGK	1844	sp|O95391|SLU7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5223	6.1312	2	1327.6256	1327.6256	K	D	45	58
PSM	LSVEESEAAGDGVDTK	1845	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8569	9.3644	3	1605.737	1605.7370	K	V	427	443
PSM	LSVEESEAAGDGVDTK	1846	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10221	10.879	2	1605.737	1605.7370	K	V	427	443
PSM	MDLEENPDEQSEIR	1847	sp|Q9Y2K1-2|ZBTB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11617	12.137	2	1703.7308	1703.7308	K	D	488	502
PSM	MESEGGADDSAEEGDLLDDDDNEDRGDDQLELIK	1848	sp|P07910-3|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20217	21.872	5	3709.5181	3709.5181	K	D	171	205
PSM	MQVDEAASREDK	1849	sp|Q9BW71|HIRP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2814	4.0185	2	1377.6194	1377.6194	K	L	61	73
PSM	NEEMEVMEVEDEGR	1850	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14877	15.307	2	1694.6764	1694.6764	K	S	161	175
PSM	NGEEPLPSEEEHCSVVEVTEEEVK	1851	sp|Q8N5S9|KKCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:4	ms_run[2]:scan=16787	17.285	3	2754.2178	2754.2178	K	N	412	436
PSM	NIEEHASADVEK	1852	sp|P61006-2|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4645	5.6233	2	1340.6208	1340.6208	R	M	105	117
PSM	NIEEHASADVEK	1853	sp|P61006-2|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5240	6.1456	2	1340.6208	1340.6208	R	M	105	117
PSM	NMVETSDGLEASENEK	1854	sp|Q93073-2|SBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8597	9.3892	2	1751.752	1751.7520	R	E	835	851
PSM	NRPDYVSEEEEDDEDFETAVK	1855	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14446	14.891	4	2515.0511	2515.0511	K	K	2662	2683
PSM	NRPDYVSEEEEDDEDFETAVK	1856	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=18220	18.953	3	2515.0511	2515.0511	K	K	2662	2683
PSM	NSFREQLEEEEEAK	1857	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13832	14.324	3	1736.7853	1736.7853	K	H	1339	1353
PSM	NSFREQLEEEEEAK	1858	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14380	14.832	3	1736.7853	1736.7853	K	H	1339	1353
PSM	NSFREQLEEEEEAK	1859	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14910	15.338	3	1736.7853	1736.7853	K	H	1339	1353
PSM	NSFREQLEEEEEAK	1860	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15977	16.467	3	1736.7853	1736.7853	K	H	1339	1353
PSM	NSFREQLEEEEEAK	1861	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15909	16.399	2	1736.7853	1736.7853	K	H	1339	1353
PSM	NSGQNLEEDMGQSEQK	1862	sp|Q9HAV7|GRPE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6142	7.1203	3	1792.7534	1792.7534	K	A	35	51
PSM	NTAGAQPQDDSIGGR	1863	sp|Q14669|TRIPC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3589	4.6647	2	1485.6808	1485.6808	R	S	19	34
PSM	NTCPPKDDPQVMEDK	1864	sp|P79522-2|PRR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4	ms_run[2]:scan=4397	5.3987	3	1772.7709	1772.7709	K	S	120	135
PSM	QDWVDGEPTEAEK	1865	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9531	10.273	2	1502.6525	1502.6525	K	D	2979	2992
PSM	QEEEMMAKEEELVK	1866	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11787	12.291	3	1721.7852	1721.7852	R	V	843	857
PSM	QEIDMEDEEADLR	1867	sp|P54252-5|ATX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13877	14.365	2	1591.6672	1591.6672	R	R	59	72
PSM	QFSSASSQQGQEEKEEDLK	1868	sp|Q9NR50-3|EI2BG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4106	5.1482	3	2153.9713	2153.9713	K	K	236	255
PSM	QLEVEPEEPEAENK	1869	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9210	9.9619	2	1639.7577	1639.7577	R	H	23	37
PSM	QQAAQGDDAGLQR	1870	sp|P46939-2|UTRO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2751	3.9662	2	1356.6382	1356.6382	K	Q	1047	1060
PSM	QQHQEEEDILDVRDEK	1871	sp|Q5T3I0|GPTC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8439	9.2528	3	2009.929	2009.9290	R	D	383	399
PSM	QQQEELEAEHGTGDKPAAPR	1872	sp|Q13895|BYST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3420	4.5188	4	2190.0301	2190.0301	R	E	64	84
PSM	QREMLMEDVGSEEEQEEEDEAPFQEK	1873	sp|Q9H1E3-2|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:35	ms_run[2]:scan=16586	17.08	3	3156.3023	3156.3023	K	D	63	89
PSM	QSDLVDDTSEELK	1874	sp|Q96QT4|TRPM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12051	12.558	2	1477.6784	1477.6784	K	Q	668	681
PSM	RDIQENDEEAVQVK	1875	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6044	7.0406	3	1671.8064	1671.8064	K	E	33	47
PSM	RDIQENDEEAVQVK	1876	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8255	9.0837	2	1671.8064	1671.8064	K	E	33	47
PSM	RPAEDMEEEQAFK	1877	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:35	ms_run[2]:scan=3739	4.8076	3	1594.6933	1594.6933	K	R	22	35
PSM	RPLEDGDQPDAK	1878	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2488	3.7456	3	1339.6368	1339.6368	K	K	65	77
PSM	RQLEEAEEEAQR	1879	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3127	4.2793	3	1486.7012	1486.7012	K	A	1877	1889
PSM	RSYEDDDDMDLQPNK	1880	sp|Q9BTE3-2|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:35	ms_run[2]:scan=4280	5.3028	2	1855.753	1855.7530	K	Q	166	181
PSM	RVQSEEMLEDK	1881	sp|Q8IY37|DHX37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4115	5.1588	2	1362.6449	1362.6449	R	W	940	951
PSM	SDMSECENDDPLLR	1882	sp|Q15058|KIF14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4	ms_run[2]:scan=13726	14.226	2	1679.6767	1679.6767	K	S	42	56
PSM	SEDDESGAGELTREELR	1883	sp|P33993-2|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9473	10.217	4	1891.8395	1891.8395	K	Q	309	326
PSM	SEEEIEIIEGQEESNQSNK	1884	sp|O14967-2|CLGN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15027	15.456	3	2190.9764	2190.9764	K	S	355	374
PSM	SEQSVAQLEEEKK	1885	sp|Q07866-8|KLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4368	5.3743	2	1503.7417	1503.7417	K	H	134	147
PSM	SIVEEEEDDDYVELK	1886	sp|P50851-2|LRBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=16817	17.319	2	1810.7996	1810.7996	K	V	1100	1115
PSM	SIVEEEEDDDYVELK	1887	sp|P50851-2|LRBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=17280	17.829	2	1810.7996	1810.7996	K	V	1100	1115
PSM	SPEAVGPELEAEEK	1888	sp|Q96N64-3|PWP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10512	11.14	2	1483.7042	1483.7042	R	L	81	95
PSM	SQQQDDIEELETK	1889	sp|Q9H4A3-2|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10298	10.947	2	1561.7108	1561.7108	R	A	198	211
PSM	STSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAK	1890	sp|Q12797-9|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=16960	17.48	3	3937.7865	3937.7865	R	E	99	135
PSM	SVPVTVDDDDDDNDPENR	1891	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8827	9.5991	3	2015.8192	2015.8192	K	I	1185	1203
PSM	SVTEQGAELSNEER	1892	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6297	7.2562	2	1547.7063	1547.7063	K	N	28	42
PSM	TEELEEESFPER	1893	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11443	11.974	2	1493.6522	1493.6522	K	S	487	499
PSM	TEEQEFCDLNDSK	1894	sp|Q8N5C7-2|DTWD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4	ms_run[2]:scan=9222	9.9728	2	1613.6515	1613.6515	R	C	94	107
PSM	TEEQIAAEEAWNETEK	1895	sp|Q92614-2|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=16535	17.02	3	1876.8327	1876.8327	K	V	5	21
PSM	TENPGDASDLQGR	1896	sp|O60437|PEPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4257	5.2839	2	1358.6062	1358.6062	K	Q	493	506
PSM	TLEEDEEELFK	1897	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=18298	19.045	2	1380.6297	1380.6297	K	M	40	51
PSM	TLSQPEASETEEQR	1898	sp|Q9P209|CEP72_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4321	5.3377	2	1603.7326	1603.7326	R	S	380	394
PSM	TLTAEEAEEEWER	1899	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15433	15.883	2	1591.7002	1591.7002	R	R	154	167
PSM	VAEDEAEAAAAAK	1900	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4439	5.4349	2	1244.5885	1244.5885	K	F	47	60
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	1901	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=19773	21.133	4	3368.4764	3368.4764	K	E	312	341
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	1902	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20653	22.652	4	3368.4764	3368.4764	K	E	312	341
PSM	VASRVDEDEDDLEEEHITK	1903	sp|Q96FC9-4|DDX11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8201	9.0392	4	2228.0081	2228.0081	K	I	210	229
PSM	VGGTSDVEVNEK	1904	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7539	8.4407	2	1232.5885	1232.5885	K	K	406	418
PSM	VMDVTEDEEEEIK	1905	sp|O95819-4|M4K4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11852	12.348	2	1564.6814	1564.6814	K	L	55	68
PSM	VQPPPETPAEEEMETETEAEALQEK	1906	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=19309	20.409	3	2811.2644	2811.2644	K	E	1076	1101
PSM	VVSSTSEEEEAFTEK	1907	sp|Q8N573-2|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9256	10.005	2	1670.7523	1670.7523	R	F	191	206
PSM	YDYEEVEAEGANK	1908	sp|P36871-3|PGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9114	9.8581	2	1515.6365	1515.6365	R	M	231	244
PSM	YEDFKEEGSENAVK	1909	sp|Q9NTK5-2|OLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4975	5.9104	3	1643.7315	1643.7315	K	A	192	206
PSM	YEEDYYEDDEEDDPDALK	1910	sp|Q96P70|IPO9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13529	14.035	3	2251.8441	2251.8441	K	D	979	997
PSM	YKLDEDEDEDDADLSK	1911	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8096	8.9478	3	1898.7905	1898.7905	K	Y	167	183
PSM	YQGDGIVEDEEETMENNEEKK	1912	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13336	13.853	3	2485.0439	2485.0439	K	D	841	862
PSM	YSDASDDSFSEPR	1913	sp|Q9NRF8|PYRG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6755	7.726	2	1474.5848	1474.5848	R	I	567	580
PSM	TSGRVAVEEVDEEGK	1914	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=6642	7.6195967	2	1603.766349	1603.768944	R	F	436	451
PSM	EIVEVKEENIEDATEK	1915	sp|P82970|HMGN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=12519	13.077137	2	1874.907335	1873.915668	K	G	96	112
PSM	DTSENADGQSDENKDDYTIPDEYR	1916	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=12335	12.883793	3	2778.109792	2776.121986	K	I	757	781
PSM	QQNQEITDQLEEEK	1917	sp|Q08379|GOGA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=14687	15.120682	2	1713.7700	1713.7688	K	K	189	203
PSM	TEEQIAAEEAWNETEK	1918	sp|Q92614|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=15733	16.204249	2	1876.840350	1876.832667	K	V	336	352
PSM	AAEINGEVDDDDAGGEWR	1919	sp|Q92614|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=14180	14.644937	2	1918.780082	1917.797678	R	L	1355	1373
PSM	AAEINGEVDDDDAGGEWR	1920	sp|Q92614|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=12706	13.252764	3	1917.804119	1917.797678	R	L	1355	1373
PSM	AAEINGEVDDDDAGGEWR	1921	sp|Q92614|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=14189	14.651727	2	1918.780082	1917.797678	R	L	1355	1373
PSM	AQEPESGLSEETQVK	1922	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=8420	9.2344684	2	1630.768912	1630.768610	R	C	4091	4106
PSM	KAAAPAPEEEMDECEQALAAEPK	1923	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	14-UNIMOD:4	ms_run[1]:scan=15570	16.036872	3	2485.103238	2484.114856	K	A	253	276
PSM	EEQELMEEINEDEPVK	1924	sp|O14776|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=18867	19.768405	2	1959.863029	1959.861918	K	A	609	625
PSM	CDGERDCPDGSDEAPEICPQSK	1925	sp|Q07954|LRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=10642	11.255887	2	2503.9541	2503.9521	R	A	47	69
PSM	KQEETAVLEEDSADWEK	1926	sp|Q96A49|SYAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=14459	14.90454	3	2006.914454	2005.911646	K	E	302	319
PSM	DIDDDLEGEVTEECGK	1927	sp|Q9UHX1|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	14-UNIMOD:4	ms_run[1]:scan=17561	18.158288	2	1822.742156	1822.741469	K	F	474	490
PSM	NDFTEEEEAQVRK	1928	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=8334	9.1579271	2	1594.719032	1593.727080	K	E	143	156
PSM	DGQVINETSQHHDDLE	1929	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=7609	8.5094751	2	1835.783206	1835.792199	R	-	451	467
PSM	DYEEVGVDSVEGEGEEEGEEY	1930	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=24502	32.021596	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	1931	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=23291	28.496305	2	2347.901016	2347.897571	K	-	431	452
PSM	ISGDTCSGGDVEAR	1932	sp|Q92673|SORL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:4	ms_run[1]:scan=3244	4.3785764	2	1423.590641	1422.604522	K	L	731	745
PSM	FVDEEDGGDGQAGPDEGEVDSCLR	1933	sp|O15511|ARPC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	22-UNIMOD:4	ms_run[1]:scan=14766	15.194211	3	2552.014549	2552.024520	K	Q	24	48
PSM	CGQEEHDVLLSNEEDRK	1934	sp|Q9UGI8|TES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=10827	11.420997	3	2040.8752	2039.8852	K	V	46	63
PSM	KTEESESQVEPEIK	1935	sp|Q9GZR1|SENP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=4561	5.5564041	2	1631.790545	1631.789011	K	R	189	203
PSM	DNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSR	1936	sp|P49747|COMP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=7930	8.7931077	4	3904.439924	3903.421234	R	D	446	482
PSM	DTSDVEPTAPMEEPTVVEESQGTPEEESPAK	1937	sp|Q5JVS0|HABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:35	ms_run[1]:scan=12788	13.32881	3	3331.487053	3330.445688	K	V	246	277
PSM	DTSDVEPTAPMEEPTVVEESQGTPEEESPAK	1938	sp|Q5JVS0|HABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:35	ms_run[1]:scan=17997	18.687381	3	3331.475589	3330.445688	K	V	246	277
PSM	QRLAQEEESEAK	1939	sp|O00541|PESC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=4563	5.5578622	2	1399.6577	1399.6574	K	R	522	534
PSM	VGGTSDVEVNEK	1940	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=12061	12.572518	2	1232.580655	1232.588461	K	K	406	418
PSM	VQPPPETPAEEEMETETEAEALQEK	1941	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:35	ms_run[1]:scan=18694	19.526019	3	2827.266590	2827.259331	K	E	1076	1101
PSM	VQPPPETPAEEEMETETEAEALQEK	1942	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:35	ms_run[1]:scan=19380	20.510119	3	2828.287734	2827.259331	K	E	1076	1101
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	1943	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0		ms_run[1]:scan=20083	21.665647	4	5140.9046	5140.9086	K	R	36	81
PSM	SANEDQEMELEALR	1944	sp|Q6NW29|RWDD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,8-UNIMOD:35	ms_run[1]:scan=17327	17.879866	2	1691.7333	1691.7303	M	S	2	16
PSM	PDASKPEDWDER	1945	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0		ms_run[1]:scan=5005	5.9357584	2	1443.6301	1443.6261	D	A	211	223
PSM	AADISESSGADCK	1946	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=8534	9.3350788	2	1351.5586	1351.5557	M	G	2	15
PSM	HCGLGFSEVEDHDGEGDVAGDDDDDDDDSPDPESPDDSESDSESEK	1947	sp|O00193|SMAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:4	ms_run[1]:scan=14402	14.851013	4	4923.780173	4923.772527	R	E	99	145
PSM	QEEDEDYREFPQK	1948	sp|Q96ME7|ZN512_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=10113	10.781856	2	1694.7069	1694.7055	R	K	107	120
PSM	MEVDQPEPADTQPEDISESK	1949	sp|Q09472|EP300_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=11806	12.307557	3	2245.979866	2243.973988	K	V	982	1002
PSM	ADEEEDPTFEEENEEIGGGAEGGQGK	1950	sp|Q15543|TAF13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1	ms_run[1]:scan=16783	17.282327	3	2764.1072	2764.1102	M	R	2	28
PSM	NRNEQESAVHPR	1951	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=823	1.5076919	2	1435.693717	1435.691637	R	E	247	259
PSM	MQVDQEEPHVEEQQQQTPAENKAESEEMETSQAGSK	1952	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	28-UNIMOD:35	ms_run[1]:scan=6894	7.855076	4	4102.775005	4101.765142	K	D	522	558
PSM	AAAPAPEEEMDECEQALAAEPK	1953	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:4	ms_run[2]:scan=18712	19.548	3	2356.0199	2356.0199	K	A	254	276
PSM	AAPPPVDEEPESSEVDAAGR	1954	sp|Q5M775-4|CYTSB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10603	11.22	3	2021.9178	2021.9178	R	W	700	720
PSM	AEDGATPSPSNETPK	1955	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3338	4.4552	2	1499.674	1499.6740	K	K	138	153
PSM	AEEYTEETEEREESTTGFDK	1956	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8506	9.3124	3	2378.9874	2378.9874	K	S	792	812
PSM	AIEDGNLEEMEEEVR	1957	sp|P51531-2|SMCA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=18175	18.887	2	1761.7727	1761.7727	R	L	1328	1343
PSM	ALEEEEGGTEVLSK	1958	sp|Q6P1R4|DUS1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9580	10.317	2	1489.7148	1489.7148	R	N	357	371
PSM	ATGEEEGMDIQK	1959	sp|Q96GA3|LTV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4990	5.9253	2	1306.5711	1306.5711	K	S	170	182
PSM	ATNPFEDDEEEEPAVPEVEEEK	1960	sp|Q8IYI6|EXOC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=18488	19.266	2	2531.0711	2531.0711	K	V	308	330
PSM	DAINQGMDEELERDEK	1961	sp|P11177-3|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:35	ms_run[2]:scan=11431	11.961	3	1906.8214	1906.8215	R	V	37	53
PSM	DDAEIHVPEEQAAR	1962	sp|Q5VZ89-5|DEN4C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8784	9.5617	3	1578.7274	1578.7274	K	E	928	942
PSM	DHTVSGDEDYCPR	1963	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4	ms_run[2]:scan=3891	4.9487	2	1549.6103	1549.6103	K	S	939	952
PSM	DILEEPGEDELTER	1964	sp|Q8NHX9|TPC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=17038	17.564	2	1643.7526	1643.7526	R	L	728	742
PSM	DPEDSDVFEEDTHL	1965	sp|Q9NZ53-2|PDXL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=19101	20.14	2	1646.6584	1646.6584	R	-	516	530
PSM	DRDFTAEDYEK	1966	sp|O43314-2|VIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5896	6.9053	2	1387.5892	1387.5892	K	L	630	641
PSM	DSGQESESIPEYTAEEEREDNR	1967	sp|Q8WUY3-4|PRUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10371	11.014	3	2569.0688	2569.0688	K	L	2860	2882
PSM	DTEAQDTAMEQAR	1968	sp|O94927-2|HAUS5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4803	5.7611	2	1464.6151	1464.6151	R	Q	104	117
PSM	DVASTAGEEGDTSLR	1969	sp|Q8ND24|RN214_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7356	8.2628	2	1506.6798	1506.6798	K	E	111	126
PSM	DVLETEDEEPPPRR	1970	sp|Q9ULV3-5|CIZ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6829	7.7969	2	1680.7955	1680.7955	R	W	540	554
PSM	EAEGAPQVEAGK	1971	sp|Q05682-6|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3421	4.5195	2	1184.5673	1184.5673	K	R	294	306
PSM	EAVAPVQEESDLEK	1972	sp|Q13409-6|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10088	10.761	2	1542.7413	1542.7413	K	K	42	56
PSM	EAVAPVQEESDLEK	1973	sp|Q13409-6|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10121	10.79	3	1542.7413	1542.7413	K	K	42	56
PSM	ECMAGTSGSEEVK	1974	sp|Q86UP2-2|KTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=3363	4.474	2	1383.5646	1383.5646	K	V	1075	1088
PSM	EDEEEDEPVVIK	1975	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10464	11.098	2	1429.646	1429.6460	K	A	501	513
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	1976	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=20472	22.302	3	3657.4246	3657.4246	K	R	176	207
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	1977	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=21965	25.371	3	3657.4246	3657.4246	K	R	176	207
PSM	EELEQREAELQK	1978	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5031	5.9582	3	1500.742	1500.7420	K	V	558	570
PSM	EELEQREAELQK	1979	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5076	6.0009	2	1500.742	1500.7420	K	V	558	570
PSM	EELQANGSAPAADK	1980	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3755	4.8232	2	1399.6579	1399.6579	K	E	56	70
PSM	EENNDHLDDFK	1981	sp|P40818|UBP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5166	6.0808	2	1374.5688	1374.5688	K	A	895	906
PSM	EEQELMEEINEDEPVK	1982	sp|O14776-2|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:35	ms_run[2]:scan=13919	14.404	3	1975.8568	1975.8568	K	A	588	604
PSM	EEQELMEEINEDEPVK	1983	sp|O14776-2|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=18844	19.728	3	1959.8619	1959.8619	K	A	588	604
PSM	EGAMCEEDFIEEAK	1984	sp|P42680|TEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4	ms_run[2]:scan=16402	16.882	2	1656.6647	1656.6647	R	V	402	416
PSM	EIEADLERQEK	1985	sp|Q8NBT2|SPC24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5533	6.5142	2	1358.6678	1358.6678	K	E	113	124
PSM	EIVEVKEENIEDATEK	1986	sp|P82970|HMGN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11513	12.035	3	1873.9157	1873.9157	K	G	96	112
PSM	EKEPVVVETVEEK	1987	sp|Q8N5N7-2|RM50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8626	9.4151	2	1513.7876	1513.7876	K	K	33	46
PSM	ELNEDVSADVEER	1988	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10448	11.084	2	1503.6689	1503.6689	R	F	878	891
PSM	ELNEDVSADVEER	1989	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11025	11.596	2	1503.6689	1503.6689	R	F	878	891
PSM	ELNPEEGEMVEEK	1990	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10106	10.777	2	1531.6712	1531.6712	K	Y	3761	3774
PSM	ELRDEEQTAESIK	1991	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5713	6.7144	3	1546.7475	1546.7475	K	N	314	327
PSM	ENSGDYISENEDPELQDYR	1992	sp|Q99996-5|AKAP9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15408	15.858	3	2271.9404	2271.9404	K	Y	1240	1259
PSM	ENTPSEANLQEEEVR	1993	sp|Q93062-4|RBPMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8717	9.5015	2	1743.7911	1743.7911	K	T	10	25
PSM	EPLDPDPSHSPSDK	1994	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4575	5.5665	3	1519.6791	1519.6791	K	V	111	125
PSM	EQERPPEAVSK	1995	sp|Q9H0G5|NSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2454	3.72	2	1268.6361	1268.6361	K	F	512	523
PSM	EQVEPTPEDEDDDIELR	1996	sp|Q86TG7-2|PEG10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14414	14.864	3	2027.8807	2027.8807	R	G	46	63
PSM	ESENLASGDQPR	1997	sp|Q9NXH9-2|TRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3342	4.4578	2	1301.5848	1301.5848	K	T	131	143
PSM	ETQRLLEEEDSK	1998	sp|Q96CT7|CC124_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4632	5.6141	2	1475.7104	1475.7104	K	L	69	81
PSM	EVEEDSEDEEMSEDEEDDSSGEEVVIPQK	1999	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:35	ms_run[2]:scan=12881	13.413	3	3328.2944	3328.2944	K	K	23	52
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	2000	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13159	13.688	3	3624.5459	3624.5459	K	-	158	196
PSM	GDDLEEGVTSEEFDK	2001	sp|Q6ZVM7-4|TM1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14217	14.679	3	1668.7003	1668.7003	K	F	181	196
PSM	GEDLTEEEDGGIIR	2002	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13359	13.875	3	1531.7002	1531.7002	K	R	139	153
PSM	GEFKDEEETVTTK	2003	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4597	5.5856	3	1511.6991	1511.6991	K	H	248	261
PSM	GLEETRDLEEK	2004	sp|P53804-3|TTC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4941	5.882	2	1317.6412	1317.6412	K	L	1210	1221
PSM	GPAGDATVASEK	2005	sp|Q15758-3|AAAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2637	3.8702	2	1101.5302	1101.5302	R	E	298	310
PSM	GQPDVVVKEDEEYK	2006	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6907	7.8669	2	1633.7835	1633.7835	K	R	244	258
PSM	HDSGAADLER	2007	sp|Q9NX55-3|HYPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2354	3.6414	2	1069.4789	1069.4789	K	V	36	46
PSM	KAEGEPQEESPLK	2008	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3710	4.7793	3	1440.7096	1440.7096	K	S	166	179
PSM	KDPEPEDEVPDVK	2009	sp|P82675|RT05_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7519	8.42	3	1495.7042	1495.7042	R	L	393	406
PSM	KGQGTAATGNQATPK	2010	sp|Q5T1M5|FKB15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=993	1.8218	3	1428.7321	1428.7321	K	T	49	64
PSM	KIYEDGDDDMK	2011	sp|Q9HB71|CYBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3495	4.5797	2	1327.5602	1327.5602	K	R	197	208
PSM	KNDLVDADNK	2012	sp|P41214|EIF2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2551	3.7953	2	1130.5568	1130.5568	K	N	421	431
PSM	KVEEVLEEEEEEYVVEK	2013	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=22044	25.546	3	2108.0049	2108.0049	K	V	9	26
PSM	LEGALGADTTEDGDEK	2014	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10338	10.981	2	1619.7162	1619.7162	K	S	1052	1068
PSM	LESIDGNEEESMK	2015	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:35	ms_run[2]:scan=4827	5.7844	2	1495.6348	1495.6348	K	E	755	768
PSM	LEVAEAEEEETSIK	2016	sp|O15213|WDR46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14603	15.043	2	1575.7516	1575.7516	R	A	132	146
PSM	LLDEEEATDNDLR	2017	sp|Q8WUM4-2|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11955	12.438	2	1531.7002	1531.7002	R	A	462	475
PSM	LSEGQEEENLENEMKK	2018	sp|Q15276-2|RABE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11283	11.825	3	1905.8626	1905.8626	R	A	161	177
PSM	MAGQEIPEEGREVEEFSEDDDEDDSDDSEAEK	2019	sp|Q9Y2W2|WBP11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=15015	15.44	3	3646.402	3646.4020	R	Q	337	369
PSM	MDPAEEDTNVYTEK	2020	sp|P34741|SDC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=6518	7.4973	2	1656.6825	1656.6825	K	H	121	135
PSM	MDSTANEVEAVK	2021	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=4928	5.8727	2	1308.5867	1308.5867	K	V	425	437
PSM	MQMLEDEDDLAYAETEK	2022	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,3-UNIMOD:35	ms_run[2]:scan=13759	14.255	3	2061.8395	2061.8395	K	K	4346	4363
PSM	MQMLEDEDDLAYAETEK	2023	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:35	ms_run[2]:scan=15580	16.048	3	2045.8446	2045.8446	K	K	4346	4363
PSM	MQMLEDEDDLAYAETEK	2024	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=16470	16.95	3	2045.8446	2045.8446	K	K	4346	4363
PSM	MREDYDSVEQDGDEPGPQR	2025	sp|Q9Y5S9-2|RBM8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6742	7.7144	4	2221.9182	2221.9182	R	S	49	68
PSM	NASDGALMDDNQNEWGDEDLETK	2026	sp|P46531|NOTC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=17549	18.142	3	2566.0402	2566.0402	K	K	1799	1822
PSM	NDFTEEEEAQVR	2027	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9299	10.052	2	1465.6321	1465.6321	K	K	143	155
PSM	NEDEEEEEEEKDEAEDLLGR	2028	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=16177	16.663	4	2405.983	2405.9830	K	G	434	454
PSM	NEEDDMVEMEEERLR	2029	sp|P80303-2|NUCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=16384	16.864	3	1922.7986	1922.7986	K	M	282	297
PSM	NEEPSEEEIDAPKPK	2030	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5565	6.5533	2	1710.7948	1710.7948	K	K	117	132
PSM	NSAEEEVLSSEK	2031	sp|O94880|PHF14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7288	8.2084	2	1320.6045	1320.6045	K	Q	83	95
PSM	NSFREQLEEEEEAK	2032	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=16492	16.974	3	1736.7853	1736.7853	K	H	1339	1353
PSM	PANKQEDEVMR	2033	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2373	3.6566	3	1315.619	1315.6190	K	A	120	131
PSM	QALVGSDSAEDEK	2034	sp|O43159|RRP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4411	5.4111	2	1347.6154	1347.6154	K	R	119	132
PSM	QDAQDRLDEMDQQK	2035	sp|Q9UBC2-4|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5807	6.8031	3	1718.753	1718.7530	K	A	443	457
PSM	QDNCLLTPNSGQEDADNDGVGDQCDDDADGDGIK	2036	sp|P49746-2|TSP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=15186	15.641	3	3622.418	3622.4180	K	N	360	394
PSM	QEEEMMAKEEELVK	2037	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:35	ms_run[2]:scan=8085	8.9382	3	1737.7801	1737.7801	R	V	843	857
PSM	QEEEMMAKEEELVK	2038	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12256	12.8	3	1721.7852	1721.7852	R	V	843	857
PSM	QEEEMMAKEEELVK	2039	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12889	13.421	3	1721.7852	1721.7852	R	V	843	857
PSM	QEENVDPDYWEK	2040	sp|Q12873|CHD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12276	12.822	2	1550.6525	1550.6525	K	L	1309	1321
PSM	QEEQEPTGEEPAVLGGDK	2041	sp|Q6NS38-2|ALKB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10631	11.245	3	1911.8698	1911.8698	K	E	17	35
PSM	QELLEEEGEGQEPPLEAER	2042	sp|Q6ZU35|CRACD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15782	16.254	3	2181.0073	2181.0073	R	A	267	286
PSM	QGEEEDAEIIVK	2043	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11037	11.607	2	1358.6565	1358.6565	K	I	443	455
PSM	QGEEEDAEIIVK	2044	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11593	12.113	2	1358.6565	1358.6565	K	I	443	455
PSM	QGEEEDAEIIVK	2045	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12096	12.617	2	1358.6565	1358.6565	K	I	443	455
PSM	QGEEEDAEIIVK	2046	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14194	14.657	2	1358.6565	1358.6565	K	I	443	455
PSM	QGEEEDAEIIVK	2047	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13103	13.634	2	1358.6565	1358.6565	K	I	443	455
PSM	QLQDEYDQQQTEK	2048	sp|Q9H1K0|RBNS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4568	5.5612	2	1651.7326	1651.7326	R	A	491	504
PSM	QQEAEELEADIREEK	2049	sp|Q9C035-6|TRIM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12471	13.029	3	1815.8487	1815.8487	K	A	153	168
PSM	QQEELLAEENQR	2050	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7410	8.3109	2	1485.7059	1485.7059	R	L	2550	2562
PSM	QQSEEAFPQEQQK	2051	sp|O94923|GLCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4677	5.6499	2	1575.7165	1575.7165	K	A	71	84
PSM	RDIQENDEEAVQVK	2052	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5546	6.5277	3	1671.8064	1671.8064	K	E	33	47
PSM	RDIQENDEEAVQVK	2053	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9615	10.348	3	1671.8064	1671.8064	K	E	33	47
PSM	RGSIGENQGEEK	2054	sp|Q05682-6|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=209	0.24738	2	1302.6164	1302.6164	K	G	200	212
PSM	RPAEDMEEEQAFK	2055	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:35	ms_run[2]:scan=6083	7.0702	3	1594.6933	1594.6933	K	R	22	35
PSM	RQLEEAEEEATR	2056	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3520	4.6018	3	1459.6903	1459.6903	K	A	1884	1896
PSM	SAQASHSADTRPAGAEK	2057	sp|Q5SXM2|SNPC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1458	2.4867	3	1682.7972	1682.7972	R	Q	641	658
PSM	SDEVDEQVACQEVK	2058	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4	ms_run[2]:scan=7748	8.6339	3	1634.7094	1634.7094	K	V	1407	1421
PSM	SDGDPIVDPEK	2059	sp|Q8TAQ2-2|SMRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7313	8.2278	2	1170.5404	1170.5404	K	E	844	855
PSM	SEDCNETMEIENVDNNK	2060	sp|Q68DQ2|CRBG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4	ms_run[2]:scan=10391	11.033	2	2039.8048	2039.8048	R	T	1447	1464
PSM	SEDFGVNEDLADSDAR	2061	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15519	15.978	2	1738.7282	1738.7282	R	A	189	205
PSM	SEQDQAENEGEDSAVLMER	2062	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10804	11.4	3	2135.8913	2135.8913	K	L	522	541
PSM	SISADDDLQESSR	2063	sp|P18615-3|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6028	7.0278	2	1421.627	1421.6270	R	R	120	133
PSM	SSSDDEEQLTELDEEMENEICR	2064	sp|Q96ER3|SAAL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:35,21-UNIMOD:4	ms_run[2]:scan=16950	17.468	3	2673.0542	2673.0542	K	V	54	76
PSM	STEDAVDYSDINEVAEDESR	2065	sp|P21675-10|TAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=17026	17.551	3	2242.935	2242.9350	R	R	103	123
PSM	STWEEEDSGYGSSR	2066	sp|Q92620|PRP16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7049	7.9908	2	1588.6278	1588.6278	R	R	213	227
PSM	SVTEQGAELSNEER	2067	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5539	6.5205	3	1547.7063	1547.7063	K	N	28	42
PSM	SVTEQGAELSNEER	2068	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5588	6.5875	2	1547.7063	1547.7063	K	N	28	42
PSM	SVTEQGAELSNEER	2069	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8480	9.2891	2	1547.7063	1547.7063	K	N	28	42
PSM	SVTEQGAELSNEER	2070	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9654	10.381	2	1547.7063	1547.7063	K	N	28	42
PSM	TALETESQDSAEPSGSEEESDPVSLEREDK	2071	sp|P48681|NEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12219	12.754	3	3250.4121	3250.4121	K	V	1483	1513
PSM	TDKVDFDSAEDTR	2072	sp|Q5VZ89-5|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5680	6.6863	3	1497.6583	1497.6583	K	L	661	674
PSM	TEDESLVENNDNIDEEAREELR	2073	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=16077	16.57	2	2618.158	2618.1580	K	E	123	145
PSM	TEELEEESFPER	2074	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11490	12.015	3	1493.6522	1493.6522	K	S	487	499
PSM	TGEEDEEEFFCNR	2075	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4	ms_run[2]:scan=13953	14.434	2	1660.6311	1660.6311	K	A	1186	1199
PSM	TKDEIVDIDDPETK	2076	sp|Q96QT4|TRPM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10793	11.389	3	1616.7781	1616.7781	R	R	603	617
PSM	TLEEDEEELFK	2077	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=18716	19.554	2	1380.6297	1380.6297	K	M	40	51
PSM	TREPVTDNVEK	2078	sp|Q9Y6X9-2|MORC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2567	3.8106	2	1286.6466	1286.6466	R	F	92	103
PSM	TSGRVAVEEVDEEGK	2079	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6669	7.6452	3	1603.7689	1603.7689	R	F	436	451
PSM	TTEENQELVTR	2080	sp|Q676U5-3|A16L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4592	5.5824	2	1318.6365	1318.6365	K	W	183	194
PSM	VGGTSDVEVNEK	2081	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3753	4.8219	2	1232.5885	1232.5885	K	K	406	418
PSM	VGGTSDVEVNEK	2082	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4311	5.3311	2	1232.5885	1232.5885	K	K	406	418
PSM	VGGTSDVEVNEK	2083	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6795	7.7657	2	1232.5885	1232.5885	K	K	406	418
PSM	VGGTSDVEVNEK	2084	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9754	10.47	2	1232.5885	1232.5885	K	K	406	418
PSM	VGGTSDVEVNEK	2085	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10352	10.996	2	1232.5885	1232.5885	K	K	406	418
PSM	VGGTSDVEVNEK	2086	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11539	12.059	2	1232.5885	1232.5885	K	K	406	418
PSM	VGGTSDVEVNEK	2087	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13636	14.138	2	1232.5885	1232.5885	K	K	406	418
PSM	VGGTSDVEVNEK	2088	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5432	6.3359	2	1232.5885	1232.5885	K	K	406	418
PSM	VGGTSDVEVNEK	2089	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9107	9.8511	2	1232.5885	1232.5885	K	K	406	418
PSM	VLQSDEYEEVEDK	2090	sp|O15397-2|IPO8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9159	9.907	2	1581.7046	1581.7046	K	T	387	400
PSM	VMDVTEDEEEEIK	2091	sp|O95819-4|M4K4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12357	12.908	2	1564.6814	1564.6814	K	L	55	68
PSM	VQPPPETPAEEEMETETEAEALQEK	2092	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:35	ms_run[2]:scan=17501	18.091	4	2827.2593	2827.2593	K	E	1076	1101
PSM	VQPPPETPAEEEMETETEAEALQEK	2093	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:35	ms_run[2]:scan=17849	18.507	3	2827.2593	2827.2593	K	E	1076	1101
PSM	YTTPEDATPEPGEDPR	2094	sp|P63092-3|GNAS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8042	8.8978	2	1773.7693	1773.7693	R	V	303	319
PSM	NSFREQLEEEEEAK	2095	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=12266	12.811914	3	1737.777919	1736.785323	K	H	1339	1353
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	2096	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=16869	17.383225	3	3774.611134	3773.619463	K	A	735	771
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	2097	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=19859	21.271712	3	3575.474793	3574.487386	K	A	737	771
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	2098	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	23-UNIMOD:35	ms_run[1]:scan=17375	17.93885	3	3591.515893	3590.482301	K	A	737	771
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	2099	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=17896	18.552898	3	3575.472423	3574.487386	K	A	737	771
PSM	AQENYEGSEEVSPPQTK	2100	sp|Q93008|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=6959	7.9128553	2	1892.831366	1891.843566	R	D	2552	2569
PSM	DEPQEPSNKVPEQQR	2101	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=3270	4.399291	3	1780.842272	1779.838755	R	Q	1629	1644
PSM	EAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS	2102	sp|O60936|NOL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0		ms_run[1]:scan=21456	24.254642	4	5140.1322	5140.1162	K	-	164	209
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAK	2103	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1	ms_run[1]:scan=22660	26.904029	4	3263.3744	3263.3744	M	K	2	33
PSM	AAEAAAAPAESAAPAAGEEPSKEEGEPK	2104	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=8519	9.3243519	3	2636.236854	2635.224934	K	K	122	150
PSM	QQNQEITDQLEEEK	2105	sp|Q08379|GOGA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=14675	15.109641	2	1713.7700	1713.7688	K	K	189	203
PSM	KAEEELGELEAK	2106	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=6906	7.8661222	2	1344.677961	1344.677276	R	L	684	696
PSM	AAAPAPEEEMDECEQALAAEPK	2107	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[1]:scan=8567	9.3629849	3	2372.030379	2372.014808	K	A	254	276
PSM	AAAPAPEEEMDECEQALAAEPK	2108	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[1]:scan=18054	18.753063	3	2374.036180	2372.014808	K	A	254	276
PSM	MEVAEPSSPTEEEEEEEEHSAEPRPR	2109	sp|Q9NWV8|BABA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=13363	13.877648	4	3068.3082	3067.2832	-	T	1	27
PSM	TEELEEESFPER	2110	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=11607	12.125707	2	1493.651080	1493.652183	K	S	487	499
PSM	NSGQNLEEDMGQSEQK	2111	sp|Q9HAV7|GRPE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=9189	9.9402998	2	1793.738939	1792.753371	K	A	35	51
PSM	EEQELMEEINEDEPVK	2112	sp|O14776|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:27,6-UNIMOD:35	ms_run[1]:scan=19751	21.098436	2	1957.8475	1957.8457	K	A	609	625
PSM	SDEREVAEAATGEDASSPPPK	2113	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1	ms_run[1]:scan=12425	12.977821	3	2184.9842	2183.9812	M	T	2	23
PSM	MEDEEVAESWEEAADSGEIDRR	2114	sp|Q7Z422|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=21004	23.292224	3	2610.0662	2610.0659	-	L	1	23
PSM	GNGIEEQEVEANEENVK	2115	sp|Q92834|RPGR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=8743	9.5251248	2	1887.851658	1886.849380	K	V	803	820
PSM	NDFTEEEEAQVRK	2116	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=9427	10.179492	2	1594.726655	1593.727080	K	E	143	156
PSM	NDFTEEEEAQVRK	2117	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=7909	8.7752618	2	1593.725556	1593.727080	K	E	143	156
PSM	QPSKEEEEEEEEEQLNQTLAEMK	2118	sp|Q8IY81|SPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,22-UNIMOD:35	ms_run[1]:scan=16896	17.411672	3	2775.2012	2775.1912	K	A	354	377
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	2119	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=12433	12.985976	3	3370.481220	3368.476411	K	E	312	341
PSM	ERQITEEDLEGK	2120	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=5591	6.5897567	3	1446.702544	1445.699802	K	T	85	97
PSM	SGGSSCSQTPSR	2121	sp|Q13541|4EBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,6-UNIMOD:4	ms_run[1]:scan=2237	3.5452446	2	1251.5153	1251.5145	M	A	2	14
PSM	EEAGGGISEEEAAQYDR	2122	sp|Q9UBE0|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=9102	9.8454062	3	1810.767880	1809.765316	K	Q	5	22
PSM	AVTEQGAELSNEER	2123	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=6212	7.1816611	2	1532.701618	1531.711430	K	N	28	42
PSM	AELGEADEAELQR	2124	sp|Q9Y5J9|TIM8B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1	ms_run[1]:scan=17647	18.275996	2	1472.6612	1471.6782	M	L	2	15
PSM	RDIQENDEEAVQVK	2125	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=6534	7.51623	3	1671.816176	1671.806393	K	E	33	47
PSM	AAPPEPGEPEERK	2126	sp|Q5RI15|COX20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1	ms_run[1]:scan=5626	6.6383487	2	1448.6972	1447.6942	M	S	2	15
PSM	VGGTSDVEVNEK	2127	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=10583	11.201376	2	1232.586733	1232.588461	K	K	406	418
PSM	VGGTSDVEVNEK	2128	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=12515	13.074104	2	1232.580655	1232.588461	K	K	406	418
PSM	DVPEEPSEKPEALDSSK	2129	sp|Q68DK2|ZFY26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=7938	8.8009745	3	1855.874964	1855.868718	K	S	1874	1891
PSM	MESGSTAASEEAR	2130	sp|P10644|KAP0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1	ms_run[1]:scan=7721	8.6076054	2	1366.5640	1366.5665	-	S	1	14
PSM	MESGSTAASEEAR	2131	sp|P10644|KAP0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1	ms_run[1]:scan=7156	8.0921428	2	1366.5604	1366.5665	-	S	1	14
PSM	MESGSTAASEEAR	2132	sp|P10644|KAP0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1	ms_run[1]:scan=6619	7.6006364	2	1366.5652	1366.5665	-	S	1	14
PSM	YDYEEVEAEGANK	2133	sp|P36871|PGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=9918	10.611673	2	1516.617851	1515.636533	R	M	428	441
PSM	GEGGTDPELEGELDSR	2134	sp|Q9UJX6|ANC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=11742	12.25147	2	1659.724235	1659.722388	K	Y	191	207
PSM	PDASKPEDWDER	2135	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0		ms_run[1]:scan=4976	5.9110542	3	1443.6271	1443.6261	D	A	211	223
PSM	CDSSPDSAEDVRK	2136	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=4070	5.115687	2	1447.5877	1447.5880	K	V	132	145
PSM	AQEAMMDETPDSSK	2137	sp|P29375|KDM5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=5686	6.690888	2	1538.625428	1538.622874	R	L	860	874
PSM	NEELEEQCVQHGR	2138	sp|Q86SQ7|SDCG8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:4	ms_run[1]:scan=3355	4.4687288	2	1626.736912	1626.705633	R	V	642	655
PSM	ASSLNEDPEGSR	2139	sp|Q9Y530|OARD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1	ms_run[1]:scan=8242	9.0739371	2	1302.5675	1302.5683	M	I	2	14
PSM	SAEVPEAASAEEQK	2140	sp|P56211|ARP19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1	ms_run[1]:scan=10189	10.849536	3	1486.6789	1486.6782	M	E	2	16
PSM	IEADSESQEDIIR	2141	sp|P55957|BID_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=9939	10.629231	2	1503.706960	1503.705282	R	N	72	85
PSM	MDEVEQDQHEAR	2142	sp|Q8N4C6|NIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1	ms_run[1]:scan=8290	9.1153369	2	1527.6270	1527.6255	-	L	1	13
PSM	DSATSEGSPPGPDAPPSK	2143	sp|P49796|RGS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=4854	5.8101522	2	1696.778216	1695.758774	K	D	745	763
PSM	EADIDSSDESDIEEDIDQPSAHK	2144	sp|Q9P2I0|CPSF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=14171	14.636065	3	2544.049279	2544.062345	K	T	414	437
PSM	AAAPAPEEEMDECEQALAAEPK	2145	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=11058	11.625	3	2372.0148	2372.0148	K	A	254	276
PSM	AAEAAAAPAESAAPAAGEEPSKEEGEPK	2146	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7946	8.8069	3	2635.2249	2635.2249	K	K	122	150
PSM	ALEVEESNSEDEASFK	2147	sp|Q03111|ENL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11351	11.889	2	1782.7796	1782.7796	K	S	353	369
PSM	APQEVEEDDGRSGAGEDPPMPASR	2148	sp|Q9Y6A5|TACC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7498	8.4004	3	2496.0823	2496.0823	K	G	377	401
PSM	AQEAPGQAEPPAAAEVQGAGNENEPREADK	2149	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8684	9.4687	3	3030.3915	3030.3915	R	S	113	143
PSM	AQHEDQVEQYK	2150	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2397	3.6746	2	1373.6212	1373.6212	R	K	250	261
PSM	CDGFLDCSDESDEK	2151	sp|Q92673|SORL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=10185	10.846	2	1675.5978	1675.5978	R	A	1534	1548
PSM	DAINQGMDEELERDEK	2152	sp|P11177-3|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10808	11.403	3	1890.8265	1890.8265	R	V	37	53
PSM	DEQPSGSVETGFEDK	2153	sp|Q9NVV4|PAPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9313	10.064	2	1623.69	1623.6900	R	I	43	58
PSM	DGSPLDDKDER	2154	sp|Q9Y6N7-6|ROBO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3228	4.3656	2	1245.5473	1245.5473	K	I	168	179
PSM	DGTSPEEEIEIER	2155	sp|Q9H501|ESF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13263	13.786	2	1502.6736	1502.6736	K	Q	691	704
PSM	DLDDIEDENEQLK	2156	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14150	14.618	2	1574.6948	1574.6948	R	Q	313	326
PSM	DLDEDANGITDEGK	2157	sp|Q5QJE6|TDIF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8189	9.0267	2	1490.6373	1490.6373	K	E	298	312
PSM	DVQGTDASLDEELDR	2158	sp|Q9UJZ1|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14073	14.548	3	1661.738	1661.7380	R	V	338	353
PSM	DVTEAEQAEEQARQEEQVVR	2159	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14607	15.046	3	2343.0939	2343.0939	K	Q	634	654
PSM	DWEDDSDEDMSNFDR	2160	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=16589	17.083	3	1874.6537	1874.6537	K	F	75	90
PSM	DYDENEVDPYHGNQEK	2161	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6911	7.8717	3	1950.7868	1950.7868	R	V	4857	4873
PSM	EAAEPLSEPK	2162	sp|Q63HN8|RN213_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4987	5.9212	1	1069.5292	1069.5292	R	E	1239	1249
PSM	EAELDVNEELDK	2163	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12797	13.338	2	1402.6464	1402.6464	K	K	34	46
PSM	EAELDVNEELDK	2164	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13326	13.844	2	1402.6464	1402.6464	K	K	34	46
PSM	EAELDVNEELDK	2165	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13878	14.365	2	1402.6464	1402.6464	K	K	34	46
PSM	EAGVEMGDEDDLSTPNEK	2166	sp|P14868-2|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12964	13.5	2	1934.8051	1934.8051	R	L	257	275
PSM	EDILENEDEQNSPPKK	2167	sp|Q9NTI5|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5823	6.819	3	1883.8749	1883.8749	K	G	1272	1288
PSM	EEATEIEQTVQK	2168	sp|Q9UGP5-2|DPOLL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8118	8.966	2	1403.678	1403.6780	R	A	115	127
PSM	EEDGVDTIEEDLTR	2169	sp|Q86X53|ERIC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=19552	20.777	2	1619.7162	1619.7162	R	A	271	285
PSM	EEVEQCQQLAEAR	2170	sp|Q9BQS8|FYCO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4	ms_run[2]:scan=6251	7.2145	2	1588.7151	1588.7151	R	H	714	727
PSM	EFDEDSEDRLVNEK	2171	sp|Q9UHD8-4|SEPT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8865	9.6337	3	1723.7537	1723.7537	K	F	226	240
PSM	EGVIEPDTDAPQEMGDENAEITEEMMDQANDKK	2172	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	25-UNIMOD:35	ms_run[2]:scan=17479	18.057	4	3694.5444	3694.5444	K	V	86	119
PSM	EKDEMVEQEFNR	2173	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7537	8.4373	3	1552.6828	1552.6828	K	L	373	385
PSM	EKLEEEENLTR	2174	sp|Q86V48-2|LUZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4925	5.8706	3	1388.6783	1388.6783	K	E	94	105
PSM	EPLDPDPSHSPSDK	2175	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4617	5.6014	2	1519.6791	1519.6791	K	V	111	125
PSM	EQCEERIEEVTK	2176	sp|Q8NBJ4-2|GOLM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4	ms_run[2]:scan=4984	5.9169	2	1548.709	1548.7090	K	K	158	170
PSM	EQVEEDNEVSSGLK	2177	sp|Q14789-4|GOGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6912	7.8725	2	1561.7108	1561.7108	K	Q	872	886
PSM	ERLEQEQLER	2178	sp|Q8N8S7-3|ENAH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4006	5.0495	2	1328.6684	1328.6684	R	E	184	194
PSM	ERTSTSSSSVQAR	2179	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1057	1.9175	2	1394.675	1394.6750	K	R	695	708
PSM	ESEGFEEHVPSDNS	2180	sp|P62699|YPEL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8179	9.0193	2	1561.6169	1561.6169	R	-	108	122
PSM	EVEEDSEDEEMSEDEEDDSSGEEVVIPQKK	2181	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12870	13.403	3	3440.3944	3440.3944	K	G	23	53
PSM	EVMSDLEESK	2182	sp|Q01433-3|AMPD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7579	8.478	1	1165.5173	1165.5173	K	Y	405	415
PSM	EVNSQEEEEEELLRK	2183	sp|Q96RL1-5|UIMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10239	10.895	3	1859.8749	1859.8749	R	A	98	113
PSM	FASDDEHDEHDENGATGPVK	2184	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3294	4.4204	4	2168.8883	2168.8883	K	R	364	384
PSM	FEDEGAGFEESSETGDYEEK	2185	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12545	13.101	3	2253.871	2253.8710	K	A	926	946
PSM	FGEDNLEDDDVEMK	2186	sp|Q9UNH5|CC14A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14539	14.983	2	1654.6668	1654.6668	R	N	377	391
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	2187	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=20788	22.944	3	3756.4388	3756.4388	K	A	469	503
PSM	FSDEEEFMNEDEK	2188	sp|Q86UW6-2|N4BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12620	13.17	2	1647.6246	1647.6246	K	E	1324	1337
PSM	GAASGPAPGPGPAEEAGSEEAGPAGEPR	2189	sp|Q9UL51|HCN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9387	10.141	2	2472.1153	2472.1153	R	G	129	157
PSM	GAEEEEEEEEEEEEELQVVQVSEK	2190	sp|Q9UNS1-2|TIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=21567	24.502	3	2834.1989	2834.1989	R	E	663	687
PSM	GDAEKPEEELEEDDDEELDETLSER	2191	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18252	18.992	4	2920.2105	2920.2105	K	L	23	48
PSM	GDVEEDETIPDSEQDIRPR	2192	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12467	13.025	3	2198.9927	2198.9927	K	F	278	297
PSM	GQECEYPPTQDGR	2193	sp|P50579|MAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=3925	4.9793	2	1535.6311	1535.6311	K	T	132	145
PSM	GRSAEEVEEIK	2194	sp|Q8WUA2|PPIL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3465	4.5544	2	1245.6201	1245.6201	K	A	202	213
PSM	IAECSSQLAEEEEK	2195	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=6220	7.1894	3	1621.7141	1621.7141	R	A	1008	1022
PSM	IDDPIDEEEEFEELK	2196	sp|Q8WWQ0|PHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=20745	22.848	3	1848.8153	1848.8153	K	G	1746	1761
PSM	KAEEELGELEAK	2197	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6954	7.9093	3	1344.6773	1344.6773	R	L	684	696
PSM	KEETVEDEIDVR	2198	sp|Q14149|MORC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8855	9.6223	3	1460.6995	1460.6995	K	N	651	663
PSM	KHDIETIEEK	2199	sp|O00472-2|ELL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2669	3.8975	2	1240.6299	1240.6299	K	E	227	237
PSM	KHDSGAADLER	2200	sp|Q9NX55-3|HYPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=935	1.731	2	1197.5738	1197.5738	R	V	35	46
PSM	KTEELEEESFPER	2201	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8474	9.2847	3	1621.7471	1621.7471	R	S	486	499
PSM	KTIQGDEEDLR	2202	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3410	4.5098	3	1302.6416	1302.6416	K	-	285	296
PSM	KYEEIDNAPEER	2203	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4136	5.1764	3	1491.6842	1491.6842	K	A	91	103
PSM	LAEEESCREDVTR	2204	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4	ms_run[2]:scan=3142	4.2957	3	1592.71	1592.7100	K	V	112	125
PSM	LDTDDLDEIEK	2205	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14592	15.033	2	1304.5984	1304.5984	R	I	357	368
PSM	LEELDDFEEGSQK	2206	sp|Q7Z3J2-2|VP35L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14279	14.74	2	1537.6784	1537.6784	R	E	40	53
PSM	LEGALGADTTEDGDEK	2207	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8979	9.7348	2	1619.7162	1619.7162	K	S	1052	1068
PSM	LEQEEPLTDAER	2208	sp|Q5JTD0-3|TJAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8206	9.043	2	1428.6733	1428.6733	R	M	30	42
PSM	LESIDGNEEESMK	2209	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7820	8.6978	2	1479.6399	1479.6399	K	E	755	768
PSM	LEVAEAEEEETSIK	2210	sp|O15213|WDR46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12698	13.245	2	1575.7516	1575.7516	R	A	132	146
PSM	LGSTSGEESDLER	2211	sp|Q9BW71|HIRP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5054	5.9788	2	1378.6212	1378.6212	R	E	355	368
PSM	LSSDDGDSSTMR	2212	sp|Q6KC79-3|NIPBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2735	3.9532	2	1269.5143	1269.5143	R	N	254	266
PSM	LSVEESEAAGDGVDTK	2213	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12739	13.284	2	1605.737	1605.7370	K	V	427	443
PSM	LSVEESEAAGDGVDTK	2214	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13866	14.354	2	1605.737	1605.7370	K	V	427	443
PSM	LSVEESEAAGDGVDTK	2215	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14432	14.88	2	1605.737	1605.7370	K	V	427	443
PSM	MEDSVGCLETAEEVK	2216	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=12295	12.839	3	1711.7281	1711.7281	K	R	1373	1388
PSM	MPLDDLDREDEVR	2217	sp|P57740-3|NU107_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=11026	11.597	3	1617.7305	1617.7305	K	L	182	195
PSM	NADPERVENQIEK	2218	sp|Q8N442|GUF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5507	6.4908	2	1540.7481	1540.7481	K	V	200	213
PSM	NCGGDAIQEDLK	2219	sp|Q5VZK9-2|CARL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=7514	8.4162	2	1318.5823	1318.5823	R	S	707	719
PSM	NDDGDTVVVVEK	2220	sp|P32856-3|STX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8024	8.8804	2	1288.6147	1288.6147	K	D	14	26
PSM	NDFTEEEEAQVRK	2221	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7195	8.129	3	1593.7271	1593.7271	K	E	143	156
PSM	NDFTEEEEAQVRK	2222	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7788	8.6701	3	1593.7271	1593.7271	K	E	143	156
PSM	NDFTEEEEAQVRK	2223	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8954	9.712	3	1593.7271	1593.7271	K	E	143	156
PSM	NDWRDAEENK	2224	sp|Q05682-6|CALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3116	4.2722	2	1275.548	1275.5480	K	K	175	185
PSM	NESTPPSEELELDK	2225	sp|Q7L0Y3|TM10C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11553	12.071	2	1586.7312	1586.7312	K	W	52	66
PSM	NGQTEDVATGPR	2226	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2933	4.122	2	1243.5793	1243.5793	R	R	1499	1511
PSM	NSFREQLEEEEEAK	2227	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=19065	20.077	3	1736.7853	1736.7853	K	H	1339	1353
PSM	NVPQEESLEDSDVDADFK	2228	sp|O00505|IMA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=16313	16.795	3	2035.8858	2035.8858	R	A	50	68
PSM	QDAQDLYEAGEK	2229	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6983	7.9342	2	1365.6048	1365.6048	R	K	91	103
PSM	QEIDMEDEEADLRR	2230	sp|P54252-5|ATX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11427	11.958	3	1747.7683	1747.7683	R	A	59	73
PSM	QGEEEDAEIIVK	2231	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13649	14.15	2	1358.6565	1358.6565	K	I	443	455
PSM	QGEEEDAEIIVK	2232	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12575	13.13	2	1358.6565	1358.6565	K	I	443	455
PSM	QLEVEPEEPEAENK	2233	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9276	10.025	3	1639.7577	1639.7577	R	H	23	37
PSM	QQEELLAEENQR	2234	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7964	8.8243	2	1485.7059	1485.7059	R	L	2550	2562
PSM	QVCGDSIKPEETEQEVAADETR	2235	sp|Q96GM8-2|TOE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4	ms_run[2]:scan=10514	11.142	4	2490.118	2490.1180	K	N	289	311
PSM	RDIQENDEEAVQVK	2236	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11771	12.277	3	1671.8064	1671.8064	K	E	33	47
PSM	RDPGNTEPVK	2237	sp|Q2NL82|TSR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1977	3.3465	2	1111.5622	1111.5622	R	A	600	610
PSM	RDQALTEEHAR	2238	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1954	3.3292	3	1324.6484	1324.6484	R	Q	614	625
PSM	REGPVGGESDSEEMFEK	2239	sp|Q9Y4B5|MTCL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8747	9.5301	2	1881.8051	1881.8051	K	T	768	785
PSM	RSALENSEEHSAK	2240	sp|Q7Z7A4-3|PXK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1070	1.9371	3	1456.6906	1456.6906	K	Y	243	256
PSM	SAEAAAAQAEEDLR	2241	sp|Q9NXH8|TOR4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11308	11.846	3	1430.6638	1430.6638	R	A	328	342
PSM	SASTEVPGASEDAEK	2242	sp|O15169-2|AXIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4350	5.3599	2	1476.658	1476.6580	K	N	614	629
PSM	SAVEAQNEVTENPK	2243	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4456	5.4515	3	1514.7213	1514.7213	K	Q	562	576
PSM	SDEHVLEELETEGER	2244	sp|Q96IZ5-3|RBM41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=16125	16.614	3	1770.7908	1770.7908	K	Q	10	25
PSM	SEAPETPMEEEAELVLTEK	2245	sp|Q5JTH9-2|RRP12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:35	ms_run[2]:scan=19282	20.378	3	2146.9828	2146.9828	K	S	72	91
PSM	SEQDQAENEGEDSAVLMER	2246	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12873	13.407	2	2135.8913	2135.8913	K	L	522	541
PSM	SLDPENSETELER	2247	sp|A0MZ66-7|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10042	10.72	2	1517.6845	1517.6845	K	I	55	68
PSM	SNNLEREQEQLDR	2248	sp|Q9NPI1|BRD7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4690	5.6614	3	1629.7707	1629.7707	K	I	308	321
PSM	SQDQDSEVNELSR	2249	sp|Q86VM9-2|ZCH18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5904	6.9133	2	1505.6594	1505.6594	K	G	78	91
PSM	STTSVSEEDVSSR	2250	sp|Q96IZ0|PAWR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3699	4.7691	2	1382.6161	1382.6161	K	Y	228	241
PSM	SVTEQGAELSNEER	2251	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11363	11.902	2	1547.7063	1547.7063	K	N	28	42
PSM	TACENLTEPDQR	2252	sp|Q13472-3|TOP3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4	ms_run[2]:scan=4639	5.6188	2	1432.6253	1432.6253	R	V	93	105
PSM	TAEADTSSELAK	2253	sp|Q9BYW2|SETD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3446	4.5388	2	1221.5725	1221.5725	K	K	2457	2469
PSM	TALSEEEEEEREFR	2254	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9111	9.8559	3	1752.7802	1752.7802	R	K	3562	3576
PSM	TDEAFFDSENDPEK	2255	sp|Q9H583|HEAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12928	13.459	2	1642.6635	1642.6635	K	C	1974	1988
PSM	TLEEDEEELFK	2256	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=19055	20.061	2	1380.6297	1380.6297	K	M	40	51
PSM	TLEEDVDDRAPSK	2257	sp|Q13823|NOG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5275	6.1773	3	1473.6947	1473.6947	K	K	642	655
PSM	TLGMAEEDEEE	2258	sp|Q13505-3|MTX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9747	10.463	1	1251.4813	1251.4813	R	-	307	318
PSM	TNSGFEESDSGATK	2259	sp|Q8N8A2-4|ANR44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3136	4.2896	2	1428.6005	1428.6005	R	S	530	544
PSM	TQDDGEDENNTWNGNSTQQM	2260	sp|Q92575|UBXN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10619	11.234	3	2282.8618	2282.8618	R	-	489	509
PSM	VDNVEVLDHEEEK	2261	sp|O00443|P3C2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7296	8.2137	3	1553.7209	1553.7209	K	N	281	294
PSM	VGGTSDVEVNEK	2262	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14211	14.672	2	1232.5885	1232.5885	K	K	406	418
PSM	VGGTSDVEVNEK	2263	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6141	7.1196	2	1232.5885	1232.5885	K	K	406	418
PSM	VREEEIEVDSR	2264	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5232	6.1399	2	1359.663	1359.6630	R	V	628	639
PSM	VYDPKNEEDDMVEMEEER	2265	sp|P80303-2|NUCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14131	14.602	3	2255.9198	2255.9198	K	L	277	295
PSM	WSLEDDDDDEDDPAEAEK	2266	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14992	15.414	2	2092.7869	2092.7869	K	E	198	216
PSM	YDIEDGEAIDSR	2267	sp|Q13576-3|IQGA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11072	11.637	2	1381.5998	1381.5998	K	S	782	794
PSM	YDTGSDDWDTSEK	2268	sp|P32019-3|I5P2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7307	8.2237	2	1517.5794	1517.5794	K	C	340	353
PSM	YREEEMTVVEEADDDK	2269	sp|Q8WYA6-4|CTBL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10670	11.279	3	1956.8259	1956.8259	R	K	14	30
PSM	QRELAEQELEK	2270	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=10304	10.951811	2	1354.6726	1354.6723	R	Q	1823	1834
PSM	TQLEELEDELQATEDAK	2271	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=16261	16.745262	2	1960.911888	1960.911311	R	L	1546	1563
PSM	TQLEELEDELQATEDAK	2272	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=22303	26.170216	3	1961.893726	1960.911311	R	L	1546	1563
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	2273	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=17290	17.840364	4	3774.596347	3773.619463	K	A	735	771
PSM	EQVEEDNEVSSGLK	2274	sp|Q14789|GOGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7184	8.1167864	2	1561.713085	1561.710761	K	Q	947	961
PSM	QLQEAEQEMEEMK	2275	sp|Q14789|GOGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=22077	25.613626	2	1604.6684	1604.6693	K	E	1663	1676
PSM	EGEDSSVIHYDDK	2276	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:27	ms_run[1]:scan=9305	10.056165	2	1474.6236	1474.6207	K	A	1240	1253
PSM	EADPESEADRAAVEDINPADDPNNQGEDEFEEAEQVR	2277	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=18992	19.964257	3	4101.740375	4099.727493	R	E	533	570
PSM	EAVAPVQEESDLEK	2278	sp|Q13409|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=10985	11.559828	2	1543.729301	1542.741333	K	K	42	56
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	2279	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	27-UNIMOD:35	ms_run[1]:scan=21096	23.479105	3	3773.462477	3772.433739	K	A	469	503
PSM	PEDSDVFEEDTHL	2280	sp|Q9NZ53|PDXL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0		ms_run[1]:scan=17620	18.242977	2	1531.6354	1531.6309	D	-	593	606
PSM	LSEGQEEENLENEMKK	2281	sp|Q15276|RABE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=11347	11.885693	2	1906.865137	1905.862587	R	A	161	177
PSM	RTEQEEDEELLTESSK	2282	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=8246	9.0769057	3	1921.875542	1921.875260	R	A	145	161
PSM	QHCTEEDEEEDEEEEEESFMTSR	2283	sp|Q9NY27|PP4R2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,3-UNIMOD:4,20-UNIMOD:35	ms_run[1]:scan=9241	9.9912519	3	2903.0422	2902.0182	R	E	294	317
PSM	EELEQREAELQK	2284	sp|Q14152|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:27	ms_run[1]:scan=9331	10.084559	2	1482.7321	1482.7309	K	V	592	604
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAKK	2285	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1	ms_run[1]:scan=21300	23.948305	4	3392.4552	3391.4692	M	D	2	34
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAKK	2286	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1	ms_run[1]:scan=20597	22.526748	4	3391.4720	3391.4694	M	D	2	34
PSM	TTDTASVQNEAK	2287	sp|Q9ULV4|COR1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=2487	3.7449178	2	1264.597634	1263.594274	K	L	429	441
PSM	EMEEELVPTGSEPGDTR	2288	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:35	ms_run[1]:scan=11217	11.765938	2	1891.814816	1890.815303	R	A	19	36
PSM	QLQDEREAVQK	2289	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=6280	7.2421299	2	1325.6560	1325.6570	K	K	34	45
PSM	TTGEENGVEAEEWGK	2290	sp|O00429|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=9635	10.364515	2	1636.717428	1634.706010	K	F	78	93
PSM	DSAAFEDNEVQDEFLEK	2291	sp|Q9UIG0|BAZ1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=19472	20.668553	2	1985.839460	1984.853796	K	L	715	732
PSM	ATEMVEVGADDDEGGAERGEAGDLR	2292	sp|Q6NZI2|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=15469	15.928309	3	2549.102517	2548.098354	K	R	338	363
PSM	SDMSECENDDPLLR	2293	sp|Q15058|KIF14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:4	ms_run[1]:scan=13836	14.329441	2	1679.676057	1679.676701	K	S	42	56
PSM	QGEEEDAEIIVK	2294	sp|Q9UHX1|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=16850	17.355398	2	1341.6291	1341.6295	K	I	503	515
PSM	MEDEEVAESWEEAADSGEIDRR	2295	sp|Q7Z422|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=21029	23.346552	2	2610.0684	2610.0659	-	L	1	23
PSM	MEDEEVAESWEEAADSGEIDRR	2296	sp|Q7Z422|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1	ms_run[1]:scan=22151	25.806814	3	2594.0713	2594.0709	-	L	1	23
PSM	RGEGEDEVEEESTALQK	2297	sp|Q96T23|RSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7510	8.4131855	2	1906.864353	1904.859944	K	T	800	817
PSM	LEGALGADTTEDGDEK	2298	sp|Q9NZM1|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=8698	9.4831871	2	1619.718570	1619.716240	K	S	1094	1110
PSM	CGEDDETIPSEYR	2299	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4	ms_run[1]:scan=8781	9.5575474	2	1570.628269	1569.625317	K	L	328	341
PSM	DGQVINETSQHHDDLE	2300	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=8824	9.5969317	2	1836.790583	1835.792199	R	-	451	467
PSM	DYEEVGVDSVEGEGEEEGEEY	2301	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=24673	32.525424	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	2302	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=24167	31.014348	2	2347.901016	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	2303	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=23350	28.672203	3	2347.901054	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	2304	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=19088	20.120062	3	2347.901054	2347.897571	K	-	431	452
PSM	EAELDVNEELDKK	2305	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:27	ms_run[1]:scan=14594	15.034123	2	1512.7301	1512.7302	K	Y	34	47
PSM	EAELDVNEELDKK	2306	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=10106	10.776521	2	1530.743277	1530.741333	K	Y	34	47
PSM	DVQGTDASLDEELDR	2307	sp|Q9UJZ1|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=14886	15.313955	2	1661.739226	1661.738038	R	V	338	353
PSM	EKEPVVVETVEEK	2308	sp|Q8N5N7|RM50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:27	ms_run[1]:scan=13168	13.695052	2	1495.7776	1495.7765	K	K	33	46
PSM	MNGDQNSDVYAQEK	2309	sp|P14324-2|FPPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1	ms_run[1]:scan=10364	11.008644	2	1640.6622	1639.6782	-	Q	1	15
PSM	SGAQQLEEEGPMEEEEAQPMAAPEGK	2310	sp|Q9Y6B2|EID1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	20-UNIMOD:35	ms_run[1]:scan=12784	13.325689	3	2788.195224	2787.185120	R	R	47	73
PSM	QCADLPEEDEELRK	2311	sp|Q9P253|VPS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,2-UNIMOD:4	ms_run[1]:scan=12171	12.704826	2	1713.7486	1713.7511	K	K	740	754
PSM	SVTEQGAELSNEER	2312	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0		ms_run[1]:scan=4984	5.9169457	2	1548.7132	1547.7062	K	N	28	42
PSM	SVTEQGAELSNEER	2313	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=11293	11.83318	2	1547.708133	1547.706344	K	N	28	42
PSM	VMDVTEDEEEEIK	2314	sp|O95819|M4K4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:35	ms_run[1]:scan=8387	9.2054912	2	1581.679219	1580.676350	K	L	55	68
PSM	RDIQENDEEAVQVK	2315	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=11793	12.295853	3	1671.808304	1671.806393	K	E	33	47
PSM	MEGAGENAPESSSSAPGSEESARDPQVPPPEEESGDCAR	2316	sp|Q9BYX2|TBD2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,37-UNIMOD:4	ms_run[1]:scan=13146	13.676193	4	4041.6773	4041.6707	-	S	1	40
PSM	QVFESDEAPDGNSYQDDQDDLK	2317	sp|Q96N67|DOCK7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=18521	19.318532	3	2497.0055	2497.0036	K	R	156	178
PSM	SSDSSCQVLTDSESAEDQTK	2318	sp|Q4W5G0|TIGD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:4	ms_run[1]:scan=8449	9.2622958	3	2173.914871	2172.896466	R	A	436	456
PSM	VEEPGMGAEEAVDCR	2319	sp|Q9UM47|NOTC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:35,14-UNIMOD:4	ms_run[1]:scan=7191	8.1220803	2	1664.689304	1663.681786	K	Q	1734	1749
PSM	VGGTSDVEVNEK	2320	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=11441	11.972457	2	1232.586733	1232.588461	K	K	406	418
PSM	DHANYEEDENGDITPIK	2321	sp|Q99547|MPH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=11057	11.62384	2	1959.835650	1958.849380	R	A	134	151
PSM	EEAGAGEQHQDCEPAAAAVR	2322	sp|Q9NPG3|UBN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:4	ms_run[1]:scan=4051	5.0958143	3	2094.901573	2094.902495	K	I	27	47
PSM	VQPPPETPAEEEMETETEAEALQEK	2323	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:35	ms_run[1]:scan=18279	19.021073	3	2828.268282	2827.259331	K	E	1076	1101
PSM	EVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALK	2324	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0		ms_run[1]:scan=19068	20.080994	4	5140.8952	5140.9082	K	R	36	81
PSM	QLQDEYDQQQTEK	2325	sp|Q9H1K0|RBNS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=10331	10.976	2	1634.7063	1634.7055	R	A	491	504
PSM	ASEGPREPESEGIK	2326	sp|Q96T21|SEBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1	ms_run[1]:scan=5945	6.9536985	2	1526.7215	1526.7207	M	L	2	16
PSM	EVLNEEDEVQPNGK	2327	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:27	ms_run[1]:scan=13528	14.033985	2	1580.7330	1580.7313	R	I	109	123
PSM	DINESDEVEVYSR	2328	sp|Q06787|FMR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=12676	13.224008	2	1553.684534	1553.684546	K	A	58	71
PSM	DAQDAEAAMDGAELDGR	2329	sp|Q9BRL6|SRSF8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:35	ms_run[1]:scan=13227	13.751387	3	1750.740281	1749.711172	R	E	67	84
PSM	SAEVPEAASAEEQK	2330	sp|P56211|ARP19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1	ms_run[1]:scan=10107	10.777279	2	1486.6789	1486.6782	M	E	2	16
PSM	TDEAFFDSENDPEK	2331	sp|Q9H583|HEAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=12927	13.457804	2	1642.660800	1642.663476	K	C	1974	1988
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	2332	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=11325	11.863355	3	3725.204698	3722.195067	K	A	158	190
PSM	AAAPAPEEEMDECEQALAAEPK	2333	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=13639	14.14	3	2372.0148	2372.0148	K	A	254	276
PSM	AAAPAPEEEMDECEQALAAEPK	2334	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:4	ms_run[2]:scan=19050	20.055	3	2356.0199	2356.0199	K	A	254	276
PSM	AAELTATQVEEEEEEEDFRK	2335	sp|O75717-2|WDHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14559	15	3	2352.0605	2352.0605	K	K	697	717
PSM	AAQNSGEAEYIEK	2336	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4717	5.685	2	1408.647	1408.6470	K	V	1662	1675
PSM	ADDSREEEEENDDDNSLEGETFPLER	2337	sp|Q5VSL9-3|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17011	17.538	4	3039.2337	3039.2337	K	D	111	137
PSM	AEEELGELEAK	2338	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10281	10.932	2	1216.5823	1216.5823	K	L	685	696
PSM	ALEEEEDDRPYDPEEEYDPER	2339	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12932	13.462	2	2624.0674	2624.0674	K	A	1375	1396
PSM	ALSQAAVEEEEEEEEEEEPAQGK	2340	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12401	12.954	4	2559.0984	2559.0984	R	G	947	970
PSM	AVESIQAEDESAK	2341	sp|Q7L5Y9|MAEA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4644	5.6226	2	1375.6467	1375.6467	K	L	85	98
PSM	CGEDNDGYSVK	2342	sp|Q6NYC1-2|JMJD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4	ms_run[2]:scan=3169	4.3193	2	1242.4823	1242.4823	K	M	101	112
PSM	DCDLQEDACYNCGR	2343	sp|P62633-7|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=7852	8.7252	3	1774.6345	1774.6345	K	G	49	63
PSM	DDPENDNSELPTAK	2344	sp|Q93009|UBP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6592	7.5714	2	1543.6638	1543.6638	K	E	771	785
PSM	DEATLQAMDEK	2345	sp|Q16773-2|KAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8300	9.1247	2	1249.5496	1249.5496	K	L	354	365
PSM	DELNLADSEVDNQK	2346	sp|Q96SB8|SMC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12694	13.242	3	1588.7217	1588.7217	K	R	799	813
PSM	DGQVINETSQHHDDLE	2347	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7292	8.2111	3	1835.7922	1835.7922	R	-	451	467
PSM	DINESDEVEVYSR	2348	sp|Q06787-11|FMR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11900	12.39	2	1553.6845	1553.6845	K	A	58	71
PSM	DLADAPAEELQEK	2349	sp|Q96RY5|CRML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13620	14.122	2	1427.678	1427.6780	K	G	631	644
PSM	DLDEVEAPGPEEPAR	2350	sp|Q6T4R5-2|NHS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12271	12.816	2	1622.7424	1622.7424	R	A	45	60
PSM	DMDLWEQQEEER	2351	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:35	ms_run[2]:scan=11873	12.366	2	1622.6519	1622.6519	K	I	687	699
PSM	DPEPEDEVPDVK	2352	sp|P82675|RT05_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10866	11.455	2	1367.6093	1367.6093	K	L	394	406
PSM	DSDGVDGFEAEGK	2353	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8828	9.5998	2	1324.5419	1324.5419	R	K	1053	1066
PSM	DSDKTDTDWR	2354	sp|P23588-2|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3317	4.4386	2	1237.5211	1237.5211	R	A	152	162
PSM	DSGLSQKEEEEDTFIEEQQLEEEK	2355	sp|Q15696|U2AFM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17213	17.751	3	2868.2673	2868.2673	R	L	39	63
PSM	DSYVGDEAQSKR	2356	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2668	3.8968	2	1353.6161	1353.6161	K	G	51	63
PSM	EAELDVNEELDKK	2357	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10412	11.053	3	1530.7413	1530.7413	K	Y	34	47
PSM	EAEQMGNELER	2358	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5962	6.9682	2	1304.5667	1304.5667	R	L	973	984
PSM	EAETRAEFAER	2359	sp|P06753|TPM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3357	4.4701	3	1307.6106	1307.6106	K	S	235	246
PSM	EAGEDEEGFLSK	2360	sp|Q96EY1|DNJA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9957	10.645	2	1309.5674	1309.5674	R	L	462	474
PSM	EAQGNSSAGVEAAEQRPVEDGER	2361	sp|Q6NYC8-2|PPR18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5097	6.0203	2	2385.0793	2385.0793	R	G	302	325
PSM	EATDEELERTLDK	2362	sp|Q13619-2|CUL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10329	10.974	3	1547.7315	1547.7315	K	I	323	336
PSM	EDAGDNDDTEGAIGVR	2363	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7226	8.1554	3	1632.6863	1632.6863	R	N	377	393
PSM	EDDIEDTMEESGWK	2364	sp|Q92544|TM9S4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17697	18.337	3	1682.6618	1682.6618	K	L	315	329
PSM	EDEEEDEPVVIK	2365	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10300	10.949	3	1429.646	1429.6460	K	A	501	513
PSM	EDEPPEQAEPEPTEAWK	2366	sp|P11171-7|41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12605	13.156	2	1980.8589	1980.8589	K	V	599	616
PSM	EEAGAGEQHQDCEPAAAAVR	2367	sp|Q9NPG3-2|UBN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4	ms_run[2]:scan=4078	5.1217	3	2094.9025	2094.9025	K	I	27	47
PSM	EEAGGGISEEEAAQYDR	2368	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9946	10.634	3	1809.7653	1809.7653	K	Q	5	22
PSM	EEGLPEDELADPTER	2369	sp|Q5TA31|RN187_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14771	15.198	3	1698.7584	1698.7584	K	F	196	211
PSM	EENAEQQALAAK	2370	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4856	5.8116	2	1300.6259	1300.6259	R	R	475	487
PSM	EENNHLQEELER	2371	sp|Q15643-2|TRIPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6060	7.0521	3	1538.6961	1538.6961	K	L	831	843
PSM	EEQELMEEINEDEPVK	2372	sp|O14776-2|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:35	ms_run[2]:scan=14534	14.977	2	1975.8568	1975.8568	K	A	588	604
PSM	EESLQQNVGQEEAEIK	2373	sp|Q8IXJ9-2|ASXL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12410	12.962	3	1829.8643	1829.8643	K	S	368	384
PSM	EEVIDDQENLAHSR	2374	sp|Q9C0A6-2|SETD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6974	7.9258	3	1653.7594	1653.7594	K	R	383	397
PSM	EEVIDDQENLAHSR	2375	sp|Q9C0A6-2|SETD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6993	7.9415	2	1653.7594	1653.7594	K	R	383	397
PSM	EGGGVHAVPPDPEDEGLEETGSK	2376	sp|Q7L1V2|MON1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11126	11.684	2	2305.0346	2305.0346	R	D	30	53
PSM	EGQENGHITTK	2377	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=283	0.38904	2	1212.5735	1212.5735	K	S	2384	2395
PSM	EIESEIDSEEELINK	2378	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=15463	15.921	3	1775.8313	1775.8313	K	K	755	770
PSM	EIFDDDLEDDALDADEK	2379	sp|P09884|DPOLA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=20403	22.189	3	1966.8167	1966.8167	R	G	93	110
PSM	EIVEVKEENIEDATEK	2380	sp|P82970|HMGN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13167	13.694	3	1873.9157	1873.9157	K	G	96	112
PSM	EIVEVKEENIEDATEK	2381	sp|P82970|HMGN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14802	15.227	3	1873.9157	1873.9157	K	G	96	112
PSM	EKLEEEENLTR	2382	sp|Q86V48-2|LUZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4930	5.874	2	1388.6783	1388.6783	K	E	94	105
PSM	ELASTERELDEAR	2383	sp|Q8IVB5|LIX1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6768	7.7397	2	1517.7322	1517.7322	R	L	294	307
PSM	ELDIEPEGGER	2384	sp|Q2YD98|UVSSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9914	10.609	2	1242.5728	1242.5728	K	R	380	391
PSM	ELGENMSDEELR	2385	sp|O15182|CETN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10888	11.475	2	1420.614	1420.6140	R	A	129	141
PSM	ELNEDVSADVEER	2386	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11586	12.104	2	1503.6689	1503.6689	R	F	878	891
PSM	EMEREAEYEESVAK	2387	sp|Q9UNX4|WDR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5745	6.7391	2	1698.7407	1698.7407	R	E	716	730
PSM	ENGASESGDPLDEDDVDTVVDEQPK	2388	sp|Q96JN0-3|LCOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17733	18.38	2	2659.1257	2659.1257	K	F	1073	1098
PSM	EQEELEEALEVER	2389	sp|P51948-2|MAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17611	18.231	2	1601.7421	1601.7421	R	Q	143	156
PSM	EQLMREEAEQK	2390	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3120	4.2748	2	1389.6558	1389.6558	R	R	134	145
PSM	EQPGEEYSEEEESVLK	2391	sp|Q96PY6-4|NEK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13995	14.474	2	1880.8163	1880.8163	R	N	1050	1066
PSM	ERIMNEEDPEK	2392	sp|Q96A33-2|CCD47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3500	4.5853	3	1388.6242	1388.6242	K	Q	442	453
PSM	ERVMEIVDADEK	2393	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:35	ms_run[2]:scan=6014	7.0159	3	1448.6817	1448.6817	K	V	200	212
PSM	ESSTFTDENPSETEESEAAGGIGKLEGEDGDVK	2394	sp|Q96JN0-3|LCOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17512	18.104	3	3413.4754	3413.4754	K	C	749	782
PSM	ESTDDESNPLGR	2395	sp|Q14669|TRIPC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5383	6.2777	2	1318.5637	1318.5637	R	A	1375	1387
PSM	ESVQQEPEREQVQPK	2396	sp|Q96LR5|UB2E2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3178	4.3275	3	1809.8857	1809.8857	R	K	25	40
PSM	ETKPEPMEEDLPENK	2397	sp|P31948-3|STIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:35	ms_run[2]:scan=4583	5.5743	2	1800.8088	1800.8088	K	K	184	199
PSM	EYLEAEENGDLER	2398	sp|Q96DF8|ESS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10773	11.372	2	1565.6845	1565.6845	K	M	67	80
PSM	EYQNEEDSLGGSR	2399	sp|Q5HYK3|COQ5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4795	5.7554	2	1482.6223	1482.6223	K	V	154	167
PSM	FDYDDEPEAVEESKK	2400	sp|O95104-2|SCAF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9687	10.411	3	1799.7738	1799.7738	R	E	265	280
PSM	GDVEEDETIPDSEQDIRPR	2401	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12023	12.519	3	2198.9927	2198.9927	K	F	278	297
PSM	GEPGPNDVRGGEPDGSAR	2402	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3614	4.6869	3	1765.798	1765.7980	K	R	37	55
PSM	GHEENGDVVTEPQVAEK	2403	sp|Q9UG63|ABCF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5654	6.6651	2	1836.849	1836.8490	K	N	26	43
PSM	GQECEYPPTQDGR	2404	sp|P50579|MAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4	ms_run[2]:scan=4496	5.4967	2	1535.6311	1535.6311	K	T	132	145
PSM	KDDEEMDIDTVK	2405	sp|O95149|SPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7219	8.1505	3	1436.6341	1436.6341	K	K	81	93
PSM	KEDEVEEWQHR	2406	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3912	4.97	3	1483.6692	1483.6692	R	A	438	449
PSM	KGQEADLEAGGEEVPEANGSAGK	2407	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7303	8.2188	2	2242.0349	2242.0349	K	R	225	248
PSM	KLPEEEVESSR	2408	sp|Q15154-4|PCM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4061	5.1052	3	1301.6463	1301.6463	K	T	1199	1210
PSM	LEVAEAEEEETSIK	2409	sp|O15213|WDR46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=15109	15.552	2	1575.7516	1575.7516	R	A	132	146
PSM	LEVAEAEEEETSIK	2410	sp|O15213|WDR46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=15785	16.256	2	1575.7516	1575.7516	R	A	132	146
PSM	LLDEEEATDNDLR	2411	sp|Q8WUM4-2|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11488	12.014	3	1531.7002	1531.7002	R	A	462	475
PSM	LSEGQEEENLENEMK	2412	sp|Q15276-2|RABE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13401	13.912	3	1777.7676	1777.7676	R	K	161	176
PSM	LSVEESEAAGDGVDTK	2413	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12239	12.778	2	1605.737	1605.7370	K	V	427	443
PSM	MAESQEAELER	2414	sp|Q99996-5|AKAP9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5138	6.0562	2	1291.5714	1291.5714	R	L	626	637
PSM	MAGQEIPEEGREVEEFSEDDDEDDSDDSEAEK	2415	sp|Q9Y2W2|WBP11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=16112	16.602	3	3630.4071	3630.4071	R	Q	337	369
PSM	MDTIDQDDELIR	2416	sp|Q93008-1|USP9X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=13205	13.731	2	1478.6559	1478.6559	R	Y	1956	1968
PSM	MEDEDEQGWCK	2417	sp|Q9UNF0-2|PACN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=6005	7.0099	2	1425.5177	1425.5177	K	G	415	426
PSM	MEDTLEHTDK	2418	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2936	4.1239	2	1217.5234	1217.5234	K	E	1134	1144
PSM	MESEGGADDSAEEGDLLDDDDNEDRGDDQLELIK	2419	sp|P07910-3|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=19789	21.159	3	3725.513	3725.5130	K	D	171	205
PSM	MEVDQPEPADTQPEDISESK	2420	sp|Q09472|EP300_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=9492	10.234	2	2259.9689	2259.9689	K	V	982	1002
PSM	MNFDEDDREAADEEEEEEEAAVLHK	2421	sp|Q68DQ2|CRBG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=16269	16.753	4	2949.2094	2949.2094	K	G	2136	2161
PSM	NDFTEEEEAQVRK	2422	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12648	13.197	3	1593.7271	1593.7271	K	E	143	156
PSM	NFGEEVDDESLK	2423	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11479	12.005	2	1380.6045	1380.6045	K	E	197	209
PSM	NKHPDEDAVEAEGHEVK	2424	sp|Q9NY27-3|PP4R2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2687	3.9141	4	1902.8708	1902.8708	K	R	174	191
PSM	NSFREQLEEEEEAK	2425	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8985	9.7392	3	1736.7853	1736.7853	K	H	1339	1353
PSM	QCVENADLPEGEK	2426	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=6257	7.2229	2	1487.6562	1487.6562	K	K	111	124
PSM	QDNCLLTPNSGQEDADNDGVGDQCDDDADGDGIK	2427	sp|P49746-2|TSP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=15162	15.612	3	3622.418	3622.4180	K	N	360	394
PSM	QEEELQAKDEELLK	2428	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10699	11.308	3	1700.8469	1700.8469	R	V	850	864
PSM	QGEEEDAEIIVK	2429	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14734	15.166	2	1358.6565	1358.6565	K	I	443	455
PSM	QGEEEDAEIIVK	2430	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=15725	16.196	2	1358.6565	1358.6565	K	I	443	455
PSM	QLQEAEQEMEEMK	2431	sp|Q14789-4|GOGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13200	13.725	3	1621.6964	1621.6964	K	E	1588	1601
PSM	QSEDGSEREFEENGLEK	2432	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7168	8.1029	3	1981.8501	1981.8501	K	D	556	573
PSM	QTDVTGEEELTK	2433	sp|Q14676-3|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6320	7.2767	2	1348.6358	1348.6358	R	G	843	855
PSM	QTNPSAMEVEEDDPVPEIR	2434	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:35	ms_run[2]:scan=16302	16.784	3	2170.9688	2170.9688	R	R	714	733
PSM	QVVEQDEEEDEELTLK	2435	sp|P49768-7|PSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13644	14.144	3	1931.8848	1931.8848	R	Y	61	77
PSM	RDIQENDEEAVQVK	2436	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12517	13.076	3	1671.8064	1671.8064	K	E	33	47
PSM	RDIQENDEEAVQVK	2437	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11142	11.7	3	1671.8064	1671.8064	K	E	33	47
PSM	RPAEDMEEEQAFK	2438	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6730	7.7036	3	1578.6984	1578.6984	K	R	22	35
PSM	SDEHVLEELETEGER	2439	sp|Q96IZ5-3|RBM41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=16141	16.628	2	1770.7908	1770.7908	K	Q	10	25
PSM	SDLNMQQQEEEEK	2440	sp|Q14667-3|K0100_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4661	5.6367	2	1606.6781	1606.6781	K	A	353	366
PSM	SEQSVAQLEEEKK	2441	sp|Q07866-8|KLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4356	5.3664	2	1503.7417	1503.7417	K	H	134	147
PSM	SEYSELDEDESQAPYDPNGKPER	2442	sp|P19387|RPB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11334	11.872	5	2654.1256	2654.1256	K	F	206	229
PSM	SGGNEVSIEER	2443	sp|Q15061|WDR43_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4576	5.5672	2	1175.5418	1175.5418	K	L	431	442
PSM	SLDPENSETELER	2444	sp|A0MZ66-7|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10126	10.796	3	1517.6845	1517.6845	K	I	55	68
PSM	SNHYDPEEDEEYYRK	2445	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5038	5.9652	4	1972.8075	1972.8075	R	Q	1263	1278
PSM	SQPSETERLTDDY	2446	sp|P26006|ITA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9476	10.219	2	1539.6689	1539.6689	K	-	1039	1052
PSM	STSLETQDDDNIR	2447	sp|Q6IA86-4|ELP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5699	6.702	2	1492.6641	1492.6641	K	L	242	255
PSM	SYDEGLDDYREDAK	2448	sp|Q5T5U3-3|RHG21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8176	9.0172	3	1674.7009	1674.7009	K	L	871	885
PSM	TAEEENPEHVEIQK	2449	sp|O00566|MPP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4902	5.8504	3	1651.7689	1651.7689	K	M	485	499
PSM	TDEDVCSLECK	2450	sp|Q5T1V6-2|DDX59_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=6532	7.5147	2	1354.5381	1354.5381	K	A	122	133
PSM	TETKPSVTEK	2451	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1975	3.3452	2	1118.5819	1118.5819	K	E	596	606
PSM	TPQEYAEGSVEETK	2452	sp|Q68DQ2|CRBG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6277	7.2399	2	1566.7049	1566.7049	K	E	1895	1909
PSM	TSGRVAVEEVDEEGK	2453	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6574	7.554	2	1603.7689	1603.7689	R	F	436	451
PSM	TSMPSGDESIDEK	2454	sp|Q03468|ERCC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5923	6.9312	2	1394.5871	1394.5871	K	L	1138	1151
PSM	TVADSDESYMEK	2455	sp|Q9HAW4-2|CLSPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5672	6.6804	2	1373.5657	1373.5657	K	S	106	118
PSM	VDCTANTNTCNK	2456	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=1994	3.3599	2	1396.5711	1396.5711	K	Y	83	95
PSM	VEEAEPEEFVVEK	2457	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14632	15.069	3	1532.7246	1532.7246	K	V	22	35
PSM	VESLEQEAANER	2458	sp|P05067-7|A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7137	8.074	2	1373.6423	1373.6423	K	Q	420	432
PSM	VGGTSDVEVNEK	2459	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=16307	16.79	2	1232.5885	1232.5885	K	K	406	418
PSM	YDDEDISEDIK	2460	sp|Q9UI12-2|VATH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10986	11.561	2	1340.562	1340.5620	K	F	308	319
PSM	YDYEEVEAEGANK	2461	sp|P36871-3|PGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9133	9.8764	3	1515.6365	1515.6365	R	M	231	244
PSM	YFDEEEPEDAPSPELDGD	2462	sp|Q96F63|CCD97_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=18236	18.974	2	2052.796	2052.7960	R	-	326	344
PSM	YNLDASEEEDSNKK	2463	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3999	5.0442	3	1640.7166	1640.7166	K	K	183	197
PSM	YTAQVDAEEK	2464	sp|O75947|ATP5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3947	5.0016	1	1152.5299	1152.5299	K	E	86	96
PSM	QQSDHDAERLR	2465	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=2549	3.7940282	2	1336.6092	1336.6115	R	E	2576	2587
PSM	LSVEESEAAGDGVDTK	2466	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=8377	9.1980039	2	1605.737521	1605.736976	K	V	427	443
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	2467	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	25-UNIMOD:35	ms_run[1]:scan=16488	16.969205	4	3791.631857	3789.614378	K	A	735	771
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	2468	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,23-UNIMOD:35	ms_run[1]:scan=14818	15.243417	4	3573.4652	3573.4552	K	A	737	771
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	2469	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	23-UNIMOD:35	ms_run[1]:scan=17847	18.505857	4	3592.497152	3590.482301	K	A	737	771
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	2470	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=18697	19.528348	3	3575.495064	3574.487386	K	A	737	771
PSM	QLQEAEQEMEEMK	2471	sp|Q14789|GOGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=22066	25.587874	2	1604.6684	1604.6693	K	E	1663	1676
PSM	LKGTEDELDK	2472	sp|P09493|TPM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=2812	4.0170366	2	1146.580076	1146.576833	K	Y	50	60
PSM	EEEMGEEEEVEREIIK	2473	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:35	ms_run[1]:scan=14505	14.949084	3	1993.885443	1992.883382	R	Q	1289	1305
PSM	IEENSLKEEESIEGEK	2474	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=8222	9.0568764	3	1861.879216	1861.879283	K	E	1566	1582
PSM	IAAESSENVDCPENPK	2475	sp|Q32MZ4|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:4	ms_run[1]:scan=5876	6.8816087	2	1758.754395	1758.773044	K	I	634	650
PSM	EDEEEDDDVVAPKPPIEPEEEK	2476	sp|Q13409|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:27	ms_run[1]:scan=14357	14.81104	3	2519.1074	2519.1070	K	T	170	192
PSM	QEAVVEEDYNENAK	2477	sp|P82970|HMGN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=12800	13.339864	2	1619.6985	1619.6946	K	N	68	82
PSM	EIVEVKEENIEDATEK	2478	sp|P82970|HMGN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=11827	12.32751	3	1873.916240	1873.915668	K	G	96	112
PSM	GGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	2479	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:35	ms_run[1]:scan=15347	15.797839	3	3389.416891	3388.379734	R	G	311	347
PSM	TVNEDVEEMEIDEQTK	2480	sp|Q9NRL2|BAZ1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=14829	15.255695	2	1908.816796	1907.830618	K	V	1030	1046
PSM	AAEINGEVDDDDAGGEWR	2481	sp|Q92614|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=12512	13.069883	2	1918.785621	1917.797678	R	L	1355	1373
PSM	QDWVDGEPTEAEK	2482	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=15119	15.563815	2	1485.6269	1485.6254	K	D	2979	2992
PSM	KDVDEAYMNK	2483	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:35	ms_run[1]:scan=2245	3.552924	2	1227.539008	1227.544154	K	V	198	208
PSM	DELTDLDQSNVTEETPEGEEHHPVADTENKENEVEEVK	2484	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=14308	14.765879	4	4334.897702	4333.910603	K	E	229	267
PSM	AAGDTTVIENSDVSPETESSEK	2485	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=11275	11.81752	3	2265.999850	2265.013210	K	E	1300	1322
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	2486	sp|Q9BTT0|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:27	ms_run[1]:scan=16388	16.867432	3	3639.4135	3639.4135	K	R	224	255
PSM	QGEEEDAEIIVK	2487	sp|Q9UHX1|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=18140	18.845327	2	1341.6310	1341.6295	K	I	503	515
PSM	QGEEEDAEIIVK	2488	sp|Q9UHX1|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=17309	17.860823	2	1341.6291	1341.6295	K	I	503	515
PSM	GDRSEDFGVNEDLADSDAR	2489	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=12510	13.068316	2	2067.862728	2066.877720	K	A	186	205
PSM	ELNSNHDGADETSEK	2490	sp|Q01105-2|SET_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:27	ms_run[1]:scan=3704	4.7728412	2	1626.6772	1626.6752	K	E	12	27
PSM	DLGHPVEEEDELESGDQEDEDDESED	2491	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0		ms_run[1]:scan=14280	14.740427	3	2960.0933	2960.0958	K	P	929	955
PSM	QPCPSESDIITEEDK	2492	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,3-UNIMOD:4	ms_run[1]:scan=16363	16.844344	2	1729.7355	1729.7347	K	S	202	217
PSM	QPCPSESDIITEEDK	2493	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:4	ms_run[1]:scan=16249	16.734134	2	1747.764454	1746.761810	K	S	202	217
PSM	NDFTEEEEAQVR	2494	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=10424	11.063803	2	1466.616741	1465.632117	K	K	143	155
PSM	TVETRDGQVINETSQHHDDLE	2495	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7479	8.3823496	4	2422.081499	2422.099674	K	-	446	467
PSM	ETPDTLSDPQTVPEEER	2496	sp|O94822|LTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=11051	11.619333	3	1942.884590	1941.880345	K	E	201	218
PSM	DYEEVGVDSVEGEGEEEGEEY	2497	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=21400	24.144893	3	2347.901054	2347.897571	K	-	431	452
PSM	QVLDGKEEVEK	2498	sp|P82094|TMF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=8247	9.0776474	2	1255.6290	1255.6291	K	Q	609	620
PSM	LDTDDLDEIEK	2499	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=14579	15.018821	2	1304.597224	1304.598357	R	I	465	476
PSM	QEVSEEMEPHGK	2500	sp|O43309|ZSC12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=6627	7.6062905	2	1381.5813	1381.5815	K	T	197	209
PSM	VSALEEDMDDVESSEEEEEEDEK	2501	sp|Q8NAV1|PR38A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:35	ms_run[1]:scan=19013	19.993521	3	2688.060262	2687.028722	R	L	181	204
PSM	SEYSELDEDESQAPYDPNGKPER	2502	sp|P19387|RPB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=11822	12.321724	3	2655.112692	2654.125614	K	F	206	229
PSM	CALEDETYADGAETEVDCNR	2503	sp|Q12841|FSTL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=18707	19.541148	3	2299.8821	2299.8840	K	C	233	253
PSM	VESLEQEAANER	2504	sp|P05067|A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7129	8.0660699	2	1373.642980	1373.642287	K	Q	439	451
PSM	QLEVEPEEPEAENK	2505	sp|P36776|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=15718	16.188878	2	1622.7317	1622.7306	R	H	219	233
PSM	AADCEVEQWDSDEPIPAK	2506	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:4	ms_run[1]:scan=16891	17.405862	2	2059.871285	2058.884051	R	E	26	44
PSM	AADCEVEQWDSDEPIPAK	2507	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:4	ms_run[1]:scan=17441	18.01036	2	2059.869238	2058.884051	R	E	26	44
PSM	EAGVEMGDEDDLSTPNEK	2508	sp|P14868|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=12432	12.985183	2	1936.805713	1934.805132	R	L	357	375
PSM	VQPPPETPAEEEMETETEAEALQEK	2509	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=19861	21.27388	3	2812.278418	2811.264416	K	E	1076	1101
PSM	VQPPPETPAEEEMETETEAEALQEK	2510	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=19754	21.102665	3	2811.266054	2811.264416	K	E	1076	1101
PSM	TDQNASDDDILK	2511	sp|Q8TCN5|ZN507_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7254	8.1801842	2	1333.602121	1333.599754	R	E	598	610
PSM	EADLAAQEEAAKK	2512	sp|Q9Y3B7|RM11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=3300	4.4242785	2	1372.683945	1372.683424	K	-	180	193
PSM	DLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDK	2513	sp|Q15029|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:35	ms_run[1]:scan=14508	14.951388	4	3683.357228	3682.359134	K	K	32	64
PSM	ADLEEQLSDEEK	2514	sp|P47755|CAZA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1	ms_run[1]:scan=18518	19.314259	2	1446.6362	1446.6357	M	V	2	14
PSM	LAGEELAGEEAPQEK	2515	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=9098	9.8423707	2	1569.753066	1569.752232	K	A	575	590
PSM	QLDAGEEATTTK	2516	sp|O15460|P4HA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=9040	9.7890568	2	1245.5727	1245.5720	K	S	195	207
PSM	CEDLETQTQSEK	2517	sp|O00592|PODXL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=10798	11.393203	2	1449.5979	1449.5924	K	Q	344	356
PSM	NYQQNYQNSESGEK	2518	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=2697	3.9232629	2	1688.692163	1687.707407	R	N	157	171
PSM	PGEELSPTDENGK	2519	sp|P42330|AK1C3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=4470	5.468754	2	1371.614571	1371.615404	K	V	124	137
PSM	LAGEELAGEEAPQEK	2520	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=9521	10.261148	2	1570.736658	1569.752232	K	A	575	590
PSM	EREESEDELEEANGNNPIDIEVDQNK	2521	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=17171	17.701741	3	3017.311036	3014.322476	R	E	256	282
PSM	AAAPAPEEEMDECEQALAAEPK	2522	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:4	ms_run[2]:scan=17518	18.109	4	2356.0199	2356.0199	K	A	254	276
PSM	AAPPPVDEEPESSEVDAAGR	2523	sp|Q5M775-4|CYTSB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10559	11.18	2	2021.9178	2021.9178	R	W	700	720
PSM	AEGEPQEESPLK	2524	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5702	6.7043	2	1312.6147	1312.6147	K	S	167	179
PSM	AENSHNAGQVDTR	2525	sp|Q8IWZ3-5|ANKH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=644	1.0971	2	1397.6284	1397.6284	K	S	195	208
PSM	AENSHNAGQVDTR	2526	sp|Q8IWZ3-5|ANKH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=848	1.5513	2	1397.6284	1397.6284	K	S	195	208
PSM	AGVDTSPDTQK	2527	sp|Q9NNW7-4|TRXR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2464	3.7268	2	1117.5251	1117.5251	K	I	83	94
PSM	AIQEEEERDQALQAK	2528	sp|P13994|CC130_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4605	5.5914	2	1756.8592	1756.8592	K	A	196	211
PSM	ANDDVAQEIAER	2529	sp|Q8NBL1|PGLT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9992	10.677	2	1329.6161	1329.6161	K	G	330	342
PSM	APQDKPFEEEETK	2530	sp|Q8NAP3|ZBT38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4052	5.0966	3	1546.7151	1546.7151	K	E	965	978
PSM	AVANYDSVEEGEK	2531	sp|P51659-3|DHB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5897	6.9061	3	1409.6311	1409.6311	K	V	51	64
PSM	CECDDGFTGADCGELK	2532	sp|P24821-6|TENA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,3-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=16449	16.93	2	1832.6651	1832.6652	R	C	392	408
PSM	CGEAALNDPK	2533	sp|Q13616|CUL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4	ms_run[2]:scan=3221	4.361	2	1073.4812	1073.4812	K	M	355	365
PSM	DADDAVYELDGK	2534	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13248	13.771	2	1309.5674	1309.5674	R	E	49	61
PSM	DAINQGMDEELER	2535	sp|P11177-3|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12906	13.438	2	1518.662	1518.6620	R	D	37	50
PSM	DAREEDGVDTIEEDLTR	2536	sp|Q86X53|ERIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=18253	18.993	3	1961.8814	1961.8814	K	A	268	285
PSM	DAVAHCHEAER	2537	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:4	ms_run[2]:scan=76	0.068428	3	1293.552	1293.5520	K	N	183	194
PSM	DCDLQEDEACYNCGR	2538	sp|P62633-8|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8416	9.2315	2	1903.6771	1903.6771	K	G	59	74
PSM	DDMHDVEDELAK	2539	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13224	13.749	3	1415.5875	1415.5875	K	R	601	613
PSM	DEDDEDDCFILEK	2540	sp|A6NHR9-2|SMHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4	ms_run[2]:scan=17180	17.711	2	1641.6352	1641.6352	K	A	451	464
PSM	DEERAEEIVAAQEK	2541	sp|Q9Y4A5-2|TRRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8265	9.093	3	1615.7689	1615.7689	K	S	1223	1237
PSM	DEIVDIDDPETK	2542	sp|Q96QT4|TRPM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=14202	14.666	2	1387.6355	1387.6355	K	R	605	617
PSM	DEPGEQVELKEEAEAPVEDGSQPPPPEPK	2543	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=14705	15.138	3	3126.4517	3126.4517	K	G	614	643
PSM	DGQDAIAQSPEK	2544	sp|Q9NWH9|SLTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4175	5.2104	2	1257.5837	1257.5837	K	E	281	293
PSM	DGQVINETSQHHDDLE	2545	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6205	7.1765	3	1835.7922	1835.7922	R	-	451	467
PSM	DGQVINETSQHHDDLE	2546	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6711	7.6837	3	1835.7922	1835.7922	R	-	451	467
PSM	DGQVINETSQHHDDLE	2547	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9574	10.313	3	1835.7922	1835.7922	R	-	451	467
PSM	DGQVINETSQHHDDLE	2548	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10876	11.464	3	1835.7922	1835.7922	R	-	451	467
PSM	DGQVINETSQHHDDLE	2549	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13348	13.864	3	1835.7922	1835.7922	R	-	451	467
PSM	DGQVINETSQHHDDLE	2550	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8473	9.284	3	1835.7922	1835.7922	R	-	451	467
PSM	DGQVINETSQHHDDLE	2551	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9061	9.8067	3	1835.7922	1835.7922	R	-	451	467
PSM	DINESDEVEVYSR	2552	sp|Q06787-11|FMR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12865	13.399	2	1553.6845	1553.6845	K	A	58	71
PSM	DIVQETQREEDHR	2553	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4181	5.2149	2	1653.7707	1653.7707	R	R	354	367
PSM	DIVVQETMEDIDK	2554	sp|O43852-15|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:35	ms_run[2]:scan=13411	13.923	2	1549.7182	1549.7182	K	N	39	52
PSM	DLDENEVERPEEENASANPPSGIEDETAENGVPK	2555	sp|Q6UN15|FIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=15165	15.614	4	3679.6245	3679.6245	K	P	42	76
PSM	DLNPEPEPESEEPDGGFR	2556	sp|Q9BZL4-2|PP12C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=14155	14.622	3	2012.8599	2012.8599	R	T	604	622
PSM	DQTPDENDQVIVK	2557	sp|Q9NZI8-2|IF2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8156	9.0003	2	1499.7104	1499.7104	R	I	387	400
PSM	DQTPDENDQVVVK	2558	sp|O00425-2|IF2B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6488	7.4671	2	1485.6947	1485.6947	R	I	145	158
PSM	DRLEEALDPDEER	2559	sp|Q2KHM9|MOONR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11403	11.936	3	1585.722	1585.7220	K	R	240	253
PSM	DSAIPVESDTDDEGAPR	2560	sp|Q96D46|NMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10595	11.214	2	1772.7701	1772.7701	R	I	461	478
PSM	DTEMLATGAQDGK	2561	sp|Q2TAY7-2|SMU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:35	ms_run[2]:scan=4239	5.2651	2	1351.5926	1351.5926	R	I	114	127
PSM	DTHDQLSEPSEVR	2562	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5237	6.1434	3	1511.6852	1511.6852	K	S	3800	3813
PSM	DVQGTDASLDEELDR	2563	sp|Q9UJZ1|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=14681	15.116	2	1661.738	1661.7380	R	V	338	353
PSM	DVRNPEAEEMK	2564	sp|Q9H467|CUED2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3818	4.8782	2	1316.6031	1316.6031	K	A	262	273
PSM	EAAAALVEEETR	2565	sp|O75934|SPF27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11266	11.811	3	1287.6307	1287.6307	R	R	30	42
PSM	EAAAALVEEETR	2566	sp|O75934|SPF27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11357	11.895	2	1287.6307	1287.6307	R	R	30	42
PSM	EAELDVNEELDK	2567	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=14437	14.884	2	1402.6464	1402.6464	K	K	34	46
PSM	EAELDVNEELDK	2568	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=15453	15.907	2	1402.6464	1402.6464	K	K	34	46
PSM	EAELDVNEELDKK	2569	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9883	10.581	3	1530.7413	1530.7413	K	Y	34	47
PSM	EAELDVNEELDKK	2570	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10981	11.557	3	1530.7413	1530.7413	K	Y	34	47
PSM	EAEMEEHREHIK	2571	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:35	ms_run[2]:scan=53	0.049505	2	1552.694	1552.6940	K	V	812	824
PSM	EAGHGTQKEEIPEEELAEDVEEIDHAER	2572	sp|P20020-5|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=20115	21.707	4	3188.4382	3188.4382	K	E	1071	1099
PSM	EAPGPAGGGGGGSR	2573	sp|Q9BQ61|TRIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1996	3.3612	2	1125.5163	1125.5163	R	W	14	28
PSM	EEADENYNSVNTR	2574	sp|Q12846-2|STX4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3811	4.8711	2	1539.6437	1539.6437	K	M	107	120
PSM	EEDGSVELESQVQK	2575	sp|Q96B23-2|CR025_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9788	10.5	2	1575.7264	1575.7264	K	D	30	44
PSM	EEMDEAGNKVEQCK	2576	sp|Q68EM7-4|RHG17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:4	ms_run[2]:scan=3177	4.3269	3	1665.6974	1665.6974	K	D	178	192
PSM	EEPAAAGSGAASPSAAEK	2577	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3453	4.546	3	1599.7376	1599.7376	K	G	70	88
PSM	EETVEDEIDVR	2578	sp|Q14149|MORC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12175	12.71	2	1332.6045	1332.6045	K	N	652	663
PSM	EGLELPEDEEEK	2579	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17781	18.434	2	1415.6304	1415.6304	K	K	547	559
PSM	EHGITDDDLR	2580	sp|Q5TAX3-2|TUT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4625	5.6072	2	1169.5313	1169.5313	K	V	365	375
PSM	EKPLEEPDAQGR	2581	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3246	4.3799	3	1367.6681	1367.6681	K	A	2097	2109
PSM	ELDDATEANEGLSR	2582	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8005	8.8622	3	1518.6798	1518.6798	R	E	1906	1920
PSM	ELEAELEDERK	2583	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6783	7.7528	2	1359.6518	1359.6518	R	Q	1600	1611
PSM	ELNEDVSADVEER	2584	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12750	13.294	2	1503.6689	1503.6689	R	F	878	891
PSM	EMASVGEPDK	2585	sp|Q7RTP6|MICA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4094	5.1373	1	1061.4699	1061.4699	K	L	600	610
PSM	EMEREAEYEESVAK	2586	sp|Q9UNX4|WDR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5727	6.724	3	1698.7407	1698.7407	R	E	716	730
PSM	ENSAPLEENTTGK	2587	sp|P52739-2|ZN131_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4058	5.103	2	1388.642	1388.6420	K	N	127	140
PSM	EPFSGEPSEEVK	2588	sp|Q3T8J9|GON4L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8360	9.1815	2	1333.6038	1333.6038	K	E	154	166
PSM	EQEELEEALEVERQENEQR	2589	sp|P51948-2|MAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16541	17.029	3	2386.0884	2386.0884	R	R	143	162
PSM	EQLQRELEEK	2590	sp|Q9NQS7-2|INCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4689	5.6608	2	1300.6623	1300.6623	K	K	745	755
PSM	EQRDCEVIER	2591	sp|O00429-4|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4	ms_run[2]:scan=3041	4.2074	2	1332.6092	1332.6092	R	L	603	613
PSM	EREAELGAK	2592	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1974	3.3445	2	1001.5142	1001.5142	K	A	178	187
PSM	ERPPEEVAAR	2593	sp|Q16891-2|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2683	3.9115	2	1152.5887	1152.5887	R	L	185	195
PSM	ESELPPRAGNEEECPEEDMEGVEDGEEGDLK	2594	sp|O75164|KDM4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:4	ms_run[2]:scan=16059	16.554	3	3474.4199	3474.4199	K	T	356	387
PSM	ETGHVSGPDGQNPEK	2595	sp|Q9NVI1|FANCI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2243	3.5515	3	1550.6961	1550.6961	K	I	855	870
PSM	ETKPEPMEEDLPENK	2596	sp|P31948-3|STIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:35	ms_run[2]:scan=4588	5.5798	3	1800.8088	1800.8088	K	K	184	199
PSM	ETVEEGVEHDPGMPASK	2597	sp|Q96L73-2|NSD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7243	8.1719	3	1810.8043	1810.8043	K	K	1244	1261
PSM	ETVEEQVSTTER	2598	sp|Q13619-2|CUL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6724	7.6973	2	1406.6525	1406.6525	K	V	576	588
PSM	EVEVEVESMDK	2599	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:35	ms_run[2]:scan=6446	7.423	2	1308.5755	1308.5755	R	A	593	604
PSM	EVEVEVESMDK	2600	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11434	11.965	2	1292.5806	1292.5806	R	A	593	604
PSM	EVEVEVESMDK	2601	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12092	12.612	2	1292.5806	1292.5806	R	A	593	604
PSM	EVLEDFAEDGEK	2602	sp|O60313-13|OPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13678	14.179	2	1379.6093	1379.6093	K	K	876	888
PSM	EVLEDFAEDGEK	2603	sp|O60313-13|OPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=14760	15.19	2	1379.6093	1379.6093	K	K	876	888
PSM	EVQETTVTEGAAK	2604	sp|Q9NXH9-2|TRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4036	5.0789	2	1361.6674	1361.6674	R	I	51	64
PSM	EYINECDSDYHEER	2605	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:4	ms_run[2]:scan=5262	6.1661	3	1857.7112	1857.7112	R	T	859	873
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	2606	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=20655	22.654	4	3756.4388	3756.4388	K	A	469	503
PSM	GCCQEEAQFETK	2607	sp|O60613-2|SEP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,3-UNIMOD:4	ms_run[2]:scan=4675	5.6484	2	1485.5864	1485.5864	R	K	72	84
PSM	GDGRDLQELGDSDK	2608	sp|P32004-3|L1CAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5224	6.1319	3	1503.6801	1503.6801	R	Y	550	564
PSM	GEDLTEEEDGGIIR	2609	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13951	14.433	2	1531.7002	1531.7002	K	R	139	153
PSM	GEIEQERLDK	2610	sp|Q16720-8|AT2B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3164	4.3156	2	1215.6095	1215.6095	K	V	731	741
PSM	GGTVADLDEQDEETVTAGGKEDEDPAK	2611	sp|Q92922|SMRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13929	14.412	3	2775.2206	2775.2206	K	G	402	429
PSM	GPPPPPGDENR	2612	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2592	3.8301	2	1131.5309	1131.5309	R	E	248	259
PSM	GQPDVVVKEDEEYK	2613	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6876	7.84	3	1633.7835	1633.7835	K	R	244	258
PSM	HDEEDYVEMK	2614	sp|Q9H7L9|SDS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5900	6.9083	2	1293.5183	1293.5183	K	E	60	70
PSM	HEEEEWTDDDLVESL	2615	sp|P51946|CCNH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=21704	24.803	2	1844.7588	1844.7588	K	-	309	324
PSM	HESEMSQVK	2616	sp|Q92545|TM131_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1263	2.2311	2	1073.4812	1073.4812	K	Q	1455	1464
PSM	HESQMDSVVK	2617	sp|Q00765|REEP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:35	ms_run[2]:scan=1159	2.074	2	1174.5288	1174.5288	K	D	148	158
PSM	HLAETAEEK	2618	sp|Q8NEY1-6|NAV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1203	2.1455	2	1026.4982	1026.4982	R	D	1119	1128
PSM	HNDLDDVGK	2619	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2950	4.1352	2	1011.4621	1011.4621	K	D	82	91
PSM	HQGAEELLDEESR	2620	sp|Q567U6|CCD93_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8357	9.1792	3	1511.6852	1511.6852	R	I	185	198
PSM	ITDEEELNDYK	2621	sp|Q9BZJ0-2|CRNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8585	9.3804	2	1367.6093	1367.6093	K	L	53	64
PSM	KDTEVETLK	2622	sp|Q9H900|ZWILC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2794	4.0001	2	1061.5605	1061.5605	K	H	318	327
PSM	KEAVAAEVK	2623	sp|P82970|HMGN5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2123	3.4577	2	943.53385	943.5338	K	N	116	125
PSM	KEDEVEEWQHR	2624	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3873	4.9332	3	1483.6692	1483.6692	R	A	438	449
PSM	KHDSGAADLER	2625	sp|Q9NX55-3|HYPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=944	1.7465	3	1197.5738	1197.5738	R	V	35	46
PSM	KLENEVEQR	2626	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2469	3.7302	2	1143.5884	1143.5884	K	H	854	863
PSM	KNEEMMEQK	2627	sp|P32456|GBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1537	2.5992	2	1165.5107	1165.5107	K	E	510	519
PSM	LDTDDLDEIEK	2628	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10880	11.469	2	1304.5984	1304.5984	R	I	357	368
PSM	LEEPPEDSPPVEEVR	2629	sp|P41970|ELK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12669	13.217	2	1720.8156	1720.8156	K	T	166	181
PSM	LEVAEAEEEETSIK	2630	sp|O15213|WDR46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13295	13.815	3	1575.7516	1575.7516	R	A	132	146
PSM	MEDEDEQGWCK	2631	sp|Q9UNF0-2|PACN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=4560	5.5556	2	1441.5126	1441.5126	K	G	415	426
PSM	NADPERVENQIEK	2632	sp|Q8N442|GUF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5514	6.4979	3	1540.7481	1540.7481	K	V	200	213
PSM	NCEDMDECSIR	2633	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=5495	6.4818	2	1427.5115	1427.5116	K	N	569	580
PSM	NDFTEEEEAQVRK	2634	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10966	11.543	2	1593.7271	1593.7271	K	E	143	156
PSM	NDFTEEEEAQVRK	2635	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13175	13.702	3	1593.7271	1593.7271	K	E	143	156
PSM	NDFTEEEEAQVRK	2636	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11558	12.077	2	1593.7271	1593.7271	K	E	143	156
PSM	NDFTEEEEAQVRK	2637	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12084	12.601	2	1593.7271	1593.7271	K	E	143	156
PSM	NEIDNYEEDYQK	2638	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9394	10.151	2	1558.6423	1558.6423	K	M	1096	1108
PSM	NENGAPEDEENFEEAIK	2639	sp|Q13564-3|ULA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=14506	14.95	3	1933.8177	1933.8177	K	N	165	182
PSM	NIGENEGGIDK	2640	sp|Q04446|GLGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3966	5.017	2	1144.536	1144.5360	K	F	58	69
PSM	NLAEDGETVAR	2641	sp|A6NED2|RCCD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5671	6.6798	2	1173.5626	1173.5626	R	E	248	259
PSM	NREEFEDQSLEK	2642	sp|Q12830-4|BPTF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4991	5.9259	3	1522.69	1522.6900	K	D	593	605
PSM	NRNEQESAVHPR	2643	sp|Q9UJU6-5|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=614	1.0467	3	1435.6916	1435.6916	R	E	144	156
PSM	NRNEQESAVHPR	2644	sp|Q9UJU6-5|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=845	1.549	3	1435.6916	1435.6916	R	E	144	156
PSM	NSFREQLEEEEEAK	2645	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=18325	19.07	3	1736.7853	1736.7853	K	H	1339	1353
PSM	NSFREQLEEEEEAK	2646	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16463	16.942	2	1736.7853	1736.7853	K	H	1339	1353
PSM	QADIGNLDDFEEDNEDDDENRVNQEEK	2647	sp|Q8NDI1-3|EHBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=15726	16.197	4	3194.3032	3194.3032	K	A	180	207
PSM	QDNYNEEVADLK	2648	sp|Q8N3C0-3|ASCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10397	11.037	2	1436.642	1436.6420	K	I	19	31
PSM	QEVGDGDCFSEK	2649	sp|Q15911|ZFHX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4	ms_run[2]:scan=5239	6.1449	2	1369.5456	1369.5456	K	V	444	456
PSM	QGEEEDAEIIVK	2650	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=15223	15.677	2	1358.6565	1358.6565	K	I	443	455
PSM	QHDQLEAQK	2651	sp|P80303-2|NUCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=15	0.019176	2	1095.5309	1095.5309	R	L	378	387
PSM	QLQEAEQEMEEMK	2652	sp|Q14789-4|GOGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=22088	25.639	2	1621.6964	1621.6964	K	E	1588	1601
PSM	QQEELLAEENQR	2653	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7430	8.3297	3	1485.7059	1485.7059	R	L	2550	2562
PSM	QQEELLAEENQR	2654	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8716	9.5007	2	1485.7059	1485.7059	R	L	2550	2562
PSM	QTNPSAMEVEEDDPVPEIR	2655	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:35	ms_run[2]:scan=16333	16.814	2	2170.9688	2170.9688	R	R	714	733
PSM	QVCGDSIKPEETEQEVAADETR	2656	sp|Q96GM8-2|TOE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4	ms_run[2]:scan=10432	11.07	3	2490.118	2490.1180	K	N	289	311
PSM	RADDNATIR	2657	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=992	1.8212	2	1030.5156	1030.5156	R	V	234	243
PSM	RAGELTEDEVER	2658	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4069	5.1149	3	1402.6688	1402.6688	K	V	55	67
PSM	REEEEDFIR	2659	sp|Q96A65|EXOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6067	7.0593	2	1221.5626	1221.5626	K	A	668	677
PSM	RLDEELEDAEK	2660	sp|Q15008-3|PSMD6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7572	8.4709	3	1345.6361	1345.6361	K	N	44	55
PSM	RLQPDPEPTEEDIEK	2661	sp|P41229-4|KDM5C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8138	8.9847	3	1794.8636	1794.8636	K	N	148	163
PSM	RPAEDMEEEQAFK	2662	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:35	ms_run[2]:scan=3757	4.8245	2	1594.6933	1594.6933	K	R	22	35
PSM	SANAEDAQEFSDVER	2663	sp|Q9HCY8|S10AE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9398	10.154	3	1666.7071	1666.7071	R	A	6	21
PSM	SAQASHSADTRPAGAEK	2664	sp|Q5SXM2|SNPC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1462	2.4916	2	1682.7972	1682.7972	R	Q	641	658
PSM	SDNKDDDIDIDAI	2665	sp|P55010|IF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17482	18.063	2	1447.6314	1447.6314	K	-	419	432
PSM	SEDPDTSMDSYAK	2666	sp|P50416-2|CPT1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6754	7.7253	2	1444.5664	1444.5664	R	S	429	442
PSM	SEEPEVPDQEGLQR	2667	sp|Q9H2V7-5|SPNS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9690	10.414	2	1611.7376	1611.7376	K	I	36	50
PSM	SEEPEVPDQEGLQR	2668	sp|Q9H2V7-5|SPNS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9719	10.44	3	1611.7376	1611.7376	K	I	36	50
PSM	SEQAVAQLEEEK	2669	sp|Q9H0B6|KLC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8054	8.9088	2	1359.6518	1359.6518	R	Q	123	135
PSM	SLAEQRQHEEANK	2670	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1347	2.3532	3	1538.7437	1538.7437	K	T	443	456
PSM	SPSEAADEVCALEEK	2671	sp|Q9H6Z4-3|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4	ms_run[2]:scan=13559	14.064	3	1633.7141	1633.7141	R	E	151	166
PSM	SQESQEADEQLVAEVVEK	2672	sp|O75410-7|TACC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=19635	20.922	3	2016.9488	2016.9488	K	C	46	64
PSM	SRAEAALEEESR	2673	sp|Q969G3-3|SMCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3339	4.4558	3	1346.6426	1346.6426	K	Q	77	89
PSM	SSESSCGVDGDYEDAELNPR	2674	sp|P11274-2|BCR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:4	ms_run[2]:scan=11378	11.915	3	2185.8706	2185.8706	R	F	235	255
PSM	SSPELEDTATSSK	2675	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4340	5.3531	2	1350.6151	1350.6151	K	R	2827	2840
PSM	SSQAQAQELETK	2676	sp|Q14542-3|S29A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3225	4.3636	2	1318.6365	1318.6365	K	A	227	239
PSM	TALQQQEEEIK	2677	sp|Q5T7N3|KANK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6136	7.114	2	1315.662	1315.6620	R	A	368	379
PSM	TANEEEEIVHK	2678	sp|Q6GMV2|SMYD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3474	4.563	3	1297.615	1297.6150	K	L	197	208
PSM	TDQNASDDDILK	2679	sp|Q8TCN5-2|ZN507_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7315	8.2291	2	1333.5998	1333.5998	R	E	598	610
PSM	TEELEEESFPER	2680	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11542	12.061	2	1493.6522	1493.6522	K	S	487	499
PSM	TEEQEFCDLNDSK	2681	sp|Q8N5C7-2|DTWD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=9270	10.019	3	1613.6515	1613.6515	R	C	94	107
PSM	TEVPEEDALSSK	2682	sp|Q96N46|TTC14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8665	9.4504	2	1303.6143	1303.6143	K	E	724	736
PSM	TEWSREEEEK	2683	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2613	3.8489	3	1321.5786	1321.5786	K	L	61	71
PSM	TIDEELERDK	2684	sp|Q9Y320-2|TMX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5334	6.2322	2	1246.6041	1246.6041	K	R	107	117
PSM	TIVEAASDEER	2685	sp|Q9NWY4|HPF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5519	6.5017	2	1218.5728	1218.5728	K	L	254	265
PSM	TNEELQEELR	2686	sp|Q7L590-2|MCM10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8735	9.519	2	1259.5994	1259.5994	K	N	111	121
PSM	TPLLDEEEEENPDK	2687	sp|P23634-7|AT2B4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11320	11.858	3	1656.7366	1656.7366	R	A	1133	1147
PSM	TSLEDEEVFEQK	2688	sp|O75648-5|MTU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13501	14.01	2	1452.662	1452.6620	R	H	131	143
PSM	VAVEEVDEEGK	2689	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5358	6.2532	2	1202.5667	1202.5667	R	F	440	451
PSM	VDEDEEIIVK	2690	sp|P86791|CCZ1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10949	11.529	2	1187.5921	1187.5921	R	A	423	433
PSM	VDESGPPAPSK	2691	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2975	4.1544	2	1082.5244	1082.5244	K	P	1257	1268
PSM	VEGELEEMERK	2692	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6109	7.0929	3	1347.634	1347.6340	K	H	871	882
PSM	VGGTSDVEVNEK	2693	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=15178	15.631	2	1232.5885	1232.5885	K	K	406	418
PSM	VGGTSDVEVNEK	2694	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=18123	18.828	2	1232.5885	1232.5885	K	K	406	418
PSM	VGGTSDVEVNEK	2695	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7823	8.6998	2	1232.5885	1232.5885	K	K	406	418
PSM	VMDVTEDEEEEIK	2696	sp|O95819-4|M4K4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11889	12.382	3	1564.6814	1564.6814	K	L	55	68
PSM	VREEEIEVDSR	2697	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4641	5.6203	3	1359.663	1359.6630	R	V	628	639
PSM	VREEEIEVDSR	2698	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4693	5.6636	1	1359.663	1359.6630	R	V	628	639
PSM	VVEDDEDDFPTTR	2699	sp|Q9Y5P4-2|CERT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9627	10.359	3	1536.658	1536.6580	K	S	199	212
PSM	YEDFKEEGSENAVK	2700	sp|Q9NTK5-2|OLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5520	6.5025	3	1643.7315	1643.7315	K	A	192	206
PSM	QQEELLAEENQR	2701	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=14242	14.705708	2	1468.6789	1468.6789	R	L	2719	2731
PSM	QSTEKPEETLK	2702	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=4591	5.5817312	2	1271.6241	1271.6240	K	R	234	245
PSM	NDMDEPPSGDFGGDEEK	2703	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=10332	10.976777	2	1837.695595	1837.694853	K	S	578	595
PSM	EDQTEYLEERR	2704	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:27	ms_run[1]:scan=8786	9.5651896	2	1448.6537	1448.6527	K	V	187	198
PSM	EGLELPEDEEEKK	2705	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=9430	10.181552	2	1543.726534	1543.725348	K	K	412	425
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	2706	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	27-UNIMOD:35	ms_run[1]:scan=19215	20.28773	3	3772.447971	3772.433739	K	A	469	503
PSM	NEEPSEEEIDAPKPK	2707	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=5792	6.7901067	3	1710.795259	1710.794825	K	K	117	132
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	2708	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:27	ms_run[1]:scan=17644	18.273304	4	3881.6428	3881.6441	K	G	307	347
PSM	EENAEQQALAAK	2709	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:27	ms_run[1]:scan=8884	9.6499479	2	1282.6175	1282.6148	R	R	475	487
PSM	AEEPPSQLDQDTQVQDMDEGSDDEEEGQK	2710	sp|Q15459|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=13016	13.550337	3	3250.310824	3248.305900	K	V	339	368
PSM	AAEINGEVDDDDAGGEWR	2711	sp|Q92614|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=12816	13.353968	2	1917.810469	1917.797678	R	L	1355	1373
PSM	TEALGDAEEDEDDEDFVEVPEK	2712	sp|Q2YD98|UVSSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=18189	18.907088	3	2480.032676	2480.023835	R	E	393	415
PSM	PTGDFDSKPSWADQVEEEGEDDK	2713	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1	ms_run[1]:scan=13192	13.717273	3	2624.0682	2622.0872	M	C	2	25
PSM	AAAPAPEEEMDECEQALAAEPK	2714	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:4	ms_run[1]:scan=19106	20.14669	2	2357.005489	2356.019893	K	A	254	276
PSM	KGHEENGDVVTEPQVAEK	2715	sp|Q9UG63|ABCF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=4681	5.6529875	3	1965.927919	1964.943949	R	N	25	43
PSM	HHESSSVDTEPGLEESK	2716	sp|Q8N157|AHI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=3298	4.4229744	3	1867.826648	1866.823165	R	E	566	583
PSM	EEQELMEEINEDEPVK	2717	sp|O14776|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:35	ms_run[1]:scan=18435	19.207113	3	1976.888470	1975.856833	K	A	609	625
PSM	ESESEDSSDDEPLIK	2718	sp|P35659|DEK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=8625	9.4143766	2	1679.708857	1678.705735	K	K	300	315
PSM	AADEEAFEDNSEEYIR	2719	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=14514	14.957869	2	1887.764990	1886.780631	R	R	356	372
PSM	VVSSTSEEEEAFTEK	2720	sp|Q8N573|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=9481	10.2232	2	1670.750669	1670.752291	R	F	199	214
PSM	QKTEDEVLTSK	2721	sp|Q9BQ61|TRIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=5720	6.7188963	2	1259.6229	1259.6240	K	G	136	147
PSM	QGEEEDAEIIVK	2722	sp|Q9UHX1|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=16369	16.850872	2	1341.6291	1341.6295	K	I	503	515
PSM	QGEEEDAEIIVK	2723	sp|Q9UHX1|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=17719	18.362413	2	1341.6286	1341.6295	K	I	503	515
PSM	AALSASEGEEVPQDK	2724	sp|O95831|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=7166	8.1014449	2	1529.721015	1529.720932	K	A	113	128
PSM	AAELTATQVEEEEEEEDFRK	2725	sp|O75717|WDHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=17198	17.733302	3	2353.064319	2352.060495	K	K	820	840
PSM	EVEVEVESMDK	2726	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:35	ms_run[1]:scan=7057	7.9987991	2	1308.582012	1308.575513	R	A	593	604
PSM	NDFTEEEEAQVRK	2727	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=8895	9.6602041	2	1593.721385	1593.727080	K	E	143	156
PSM	DGQVINETSQHHDDLE	2728	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=8173	9.0149962	2	1836.781593	1835.792199	R	-	451	467
PSM	QDNLEIDEIEDENIK	2729	sp|Q96PY6|NEK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=21077	23.43869	2	1798.8109	1798.8103	R	E	1074	1089
PSM	QEGGDNDLIER	2730	sp|P30566|PUR8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=10926	11.507584	2	1227.5373	1227.5362	K	I	416	427
PSM	DYEEVGVDSVEGEGEEEGEEY	2731	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=22093	25.651179	3	2347.901054	2347.897571	K	-	431	452
PSM	EAELDVNEELDKK	2732	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:27	ms_run[1]:scan=9963	10.649113	3	1512.7267	1512.7302	K	Y	34	47
PSM	QDAQDRLDEMDQQK	2733	sp|Q9UBC2|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=9877	10.576815	2	1701.7223	1701.7259	K	A	443	457
PSM	QHLENDPGSNEDTDIPK	2734	sp|O43396|TXNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=10707	11.314419	2	1891.8102	1890.8222	K	G	105	122
PSM	ASGSENEGDYNPGRK	2735	sp|Q02880|TOP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=2174	3.4967801	3	1580.690159	1579.686277	K	T	1549	1564
PSM	AGPGADNGEEGEIEEEMENPEMVDLPEK	2736	sp|Q13330|MTA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	22-UNIMOD:35	ms_run[1]:scan=20503	22.354308	3	3031.245129	3030.259407	K	L	71	99
PSM	YDIEDGEAIDSR	2737	sp|Q13576|IQGA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=11031	11.60228	2	1381.600273	1381.599754	K	S	1286	1298
PSM	MEEQPQMQDADEPADSGGEGR	2738	sp|Q9H3R5|CENPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,7-UNIMOD:35	ms_run[1]:scan=12958	13.493093	3	2334.9352	2333.9012	-	A	1	22
PSM	EAGVEMGDEDDLSTPNEK	2739	sp|P14868|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:35	ms_run[1]:scan=11401	11.934295	3	1952.824065	1950.800047	R	L	357	375
PSM	EAGVEMGDEDDLSTPNEK	2740	sp|P14868|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:35	ms_run[1]:scan=11383	11.918736	3	1952.824065	1950.800047	R	L	357	375
PSM	VQPPPETPAEEEMETETEAEALQEK	2741	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:35	ms_run[1]:scan=19484	20.683509	4	2827.284812	2827.259331	K	E	1076	1101
PSM	SEQAVAQLEEEK	2742	sp|Q9H0B6|KLC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=8571	9.3659328	2	1359.651947	1359.651789	R	Q	123	135
PSM	GDVEEDETIPDSEQDIRPR	2743	sp|Q92973|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=10904	11.488965	3	2200.002310	2198.992750	K	F	328	347
PSM	NENGAPEDEENFEEAIK	2744	sp|Q13564|ULA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=15009	15.435209	2	1934.816327	1933.817745	K	N	254	271
PSM	GAQEEEPTDPQLMR	2745	sp|P40424|PBX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:35	ms_run[1]:scan=6250	7.2137299	2	1616.710179	1615.714801	R	L	94	108
PSM	EADLAAQEEAAKK	2746	sp|Q9Y3B7|RM11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:27	ms_run[1]:scan=6526	7.5082697	2	1354.6718	1354.6723	K	-	180	193
PSM	HECQANGPEDLNR	2747	sp|P60981|DEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:4	ms_run[1]:scan=3179	4.3281846	2	1539.638989	1538.653203	K	A	133	146
PSM	RSSDTSGNEASEIESVK	2748	sp|Q71F23|CENPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=4992	5.9265713	3	1795.826486	1794.823165	K	I	106	123
PSM	LEVAEAEEEETSIK	2749	sp|O15213|WDR46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=16506	16.986953	2	1575.753970	1575.751563	R	A	132	146
PSM	DINESDEVEVYSR	2750	sp|Q06787|FMR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=13392	13.905407	2	1554.686060	1553.684546	K	A	58	71
PSM	CDEKPEDLLEEPK	2751	sp|Q13029|PRDM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=17093	17.616243	2	1583.7033	1583.7020	R	T	312	325
PSM	ENNISEEVEAPEVEPR	2752	sp|Q9H4Z3|CAPAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=14986	15.4079	2	1840.834496	1839.848651	K	L	385	401
PSM	AAAAAEEGMEPR	2753	sp|P51788|CLCN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1	ms_run[1]:scan=12165	12.700308	2	1243.5484	1243.5498	M	A	2	14
PSM	QDPAAAQEGQDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVK	2754	sp|Q6NT46|GAG2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,36-UNIMOD:4,38-UNIMOD:4,47-UNIMOD:35	ms_run[1]:scan=9895	10.592292	5	5906.4482	5906.4142	R	T	50	106
PSM	GDLSDVEEEEEEEMDVDEATGAVK	2755	sp|Q96ST3|SIN3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=20004	21.541601	3	2625.085887	2624.080698	R	K	829	853
PSM	MEEASEGGGNDRVR	2756	sp|Q9BV40|VAMP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1	ms_run[1]:scan=5492	6.4746272	2	1547.6617	1547.6629	-	N	1	15
PSM	TDEDVCSLECK	2757	sp|Q5T1V6|DDX59_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=6526	7.5082697	2	1354.536963	1354.538082	K	A	122	133
PSM	QGEQEETALCR	2758	sp|Q6NSZ9|ZSC25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:4	ms_run[1]:scan=4130	5.17204	2	1320.578600	1319.577579	R	G	135	146
PSM	CQPKPSEEAPK	2759	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=3648	4.717935	2	1252.5752	1252.5753	R	C	116	127
PSM	ETPPAEGEGHEAPIAK	2760	sp|Q5TCZ1|SPD2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=4276	5.2998144	3	1631.780976	1631.779115	K	K	360	376
PSM	QQWEEEEREALK	2761	sp|Q6PII3|CC174_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=14991	15.413667	2	1556.7201	1556.7102	R	R	216	228
PSM	LPLPDDREDGELEEGELEDDGAEETQDTSGGPER	2762	sp|Q9UPT8|ZC3H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=18108	18.813131	4	3701.594814	3698.582727	R	S	48	82
PSM	MESEGGADDSAEEGDLLDDDDNEDRGDDQLELIK	2763	sp|P07910|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:35	ms_run[1]:scan=19913	21.379351	5	3728.514705	3725.512992	K	D	251	285
PSM	AAAPAPEEEMDECEQALAAEPK	2764	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=14533	14.976	2	2372.0148	2372.0148	K	A	254	276
PSM	AAESAEIEPR	2765	sp|Q9NS91|RAD18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4013	5.0565	2	1071.5197	1071.5197	R	N	480	490
PSM	AAPTAASDQPDSAATTEK	2766	sp|Q9BRP8-2|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3442	4.5358	3	1730.7959	1730.7959	R	A	132	150
PSM	ADHGEPIGR	2767	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2058	3.4084	2	950.45699	950.4570	R	G	169	178
PSM	ADIKGPEDK	2768	sp|P36542-2|ATPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2185	3.5067	2	971.49238	971.4924	K	K	80	89
PSM	AEEDVEPECIMEK	2769	sp|Q9UJU6-5|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4,11-UNIMOD:35	ms_run[2]:scan=7909	8.7753	2	1593.6538	1593.6538	R	V	16	29
PSM	AEEDVEPECIMEK	2770	sp|Q9UJU6-5|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4	ms_run[2]:scan=12971	13.51	2	1577.6589	1577.6589	R	V	16	29
PSM	AEVHPAGDTAK	2771	sp|Q14789-4|GOGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=673	1.1635	2	1094.5356	1094.5356	R	E	1626	1637
PSM	ARNLADDSSENK	2772	sp|P35251-2|RFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1247	2.2153	3	1318.6113	1318.6113	K	V	569	581
PSM	ASVGQDSPEPR	2773	sp|Q6UX71-2|PXDC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2760	3.9745	2	1141.5364	1141.5364	R	S	80	91
PSM	ATEMVEVGADDDEGGAERGEAGDLR	2774	sp|Q6NZI2|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:35	ms_run[2]:scan=10232	10.888	3	2564.0933	2564.0933	K	R	338	363
PSM	ATNPFEDDEEEEPAVPEVEEEK	2775	sp|Q8IYI6|EXOC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=18499	19.278	3	2531.0711	2531.0711	K	V	308	330
PSM	AVTEQGAELSNEER	2776	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8274	9.1017	2	1531.7114	1531.7114	K	N	28	42
PSM	CEEEAAVQPHSR	2777	sp|Q9UPQ0-9|LIMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4	ms_run[2]:scan=2383	3.6631	3	1411.615	1411.6150	R	A	167	179
PSM	CGQEEHDVLLSNEEDRK	2778	sp|Q9UGI8-2|TES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4	ms_run[2]:scan=4903	5.851	4	2056.912	2056.9120	K	V	37	54
PSM	DADDAVYELDGK	2779	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12281	12.826	2	1309.5674	1309.5674	R	E	49	61
PSM	DDLQGAQSEIEAK	2780	sp|Q14BN4-2|SLMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9440	10.189	3	1402.6576	1402.6576	K	Q	446	459
PSM	DDLQGAQSEIEAK	2781	sp|Q14BN4-2|SLMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9515	10.257	2	1402.6576	1402.6576	K	Q	446	459
PSM	DELTDLDQSNVTEETPEGEEHHPVADTENK	2782	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14750	15.18	4	3377.4655	3377.4655	K	E	223	253
PSM	DGDGEGAGGAPEEMPVDR	2783	sp|P28702|RXRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9401	10.156	3	1757.7163	1757.7163	K	I	286	304
PSM	DGQVINETSQHHDDLE	2784	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9347	10.102	2	1835.7922	1835.7922	R	-	451	467
PSM	DGQVINETSQHHDDLE	2785	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10312	10.96	3	1835.7922	1835.7922	R	-	451	467
PSM	DGTDGETEVGEIQQNK	2786	sp|Q6NZY4-2|ZCHC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7599	8.4999	3	1718.7595	1718.7595	K	S	102	118
PSM	DHQLREAPDTAEK	2787	sp|Q96CT7|CC124_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2462	3.7255	3	1508.7219	1508.7219	R	A	107	120
PSM	DLDDTSVVEDGR	2788	sp|Q9Y4D7-2|PLXD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10049	10.726	2	1319.5841	1319.5841	R	K	1622	1634
PSM	DLDECAEGLHDCESR	2789	sp|P35556|FBN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=7589	8.4875	3	1804.6992	1804.6992	K	G	2294	2309
PSM	DLRNDEHTR	2790	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=470	0.76236	2	1154.5428	1154.5428	K	R	120	129
PSM	DLRQDEHTR	2791	sp|P08134|RHOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1421	2.4506	2	1168.5585	1168.5585	K	R	120	129
PSM	DPAAAPATGNKK	2792	sp|Q02218-2|ODO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1548	2.6158	2	1139.5935	1139.5935	R	T	985	997
PSM	DRGSDVESLDK	2793	sp|Q96TA2-3|YMEL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3758	4.8252	2	1219.5681	1219.5681	R	L	153	164
PSM	DRGVAASAGSSGENK	2794	sp|P35249-2|RFC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1962	3.3344	2	1404.6593	1404.6593	K	K	19	34
PSM	DRNLAPDEK	2795	sp|O95232|LC7L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2360	3.6453	2	1056.52	1056.5200	R	R	15	24
PSM	DSGTDDQEEEPLERDFDR	2796	sp|Q8TDP1|RNH2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13256	13.777	2	2151.8829	2151.8829	R	F	101	119
PSM	DTDMDGVGDQCDNCPLEHNPDQLDSDSDR	2797	sp|P07996-2|TSP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=13533	14.038	3	3319.2572	3319.2572	R	I	738	767
PSM	DTSENADGQSDENKDDYTIPDEYR	2798	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12215	12.749	3	2776.122	2776.1220	K	I	757	781
PSM	DTTEVPSSTVEK	2799	sp|O15164-2|TIF1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5273	6.176	2	1291.6143	1291.6143	K	S	147	159
PSM	DVEMEPVQQAEK	2800	sp|Q13464|ROCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:35	ms_run[2]:scan=4760	5.7262	2	1417.6395	1417.6395	K	T	1209	1221
PSM	DVEMEPVQQAEK	2801	sp|Q13464|ROCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8994	9.7499	2	1401.6446	1401.6446	K	T	1209	1221
PSM	DVRDMDDAYDR	2802	sp|P07686|HEXB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6032	7.0304	3	1369.5568	1369.5568	K	L	518	529
PSM	DYEEVGIDSYEDEDEGEE	2803	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17721	18.364	2	2120.7706	2120.7706	K	-	416	434
PSM	EAALAEVADEK	2804	sp|Q15003-2|CND2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8995	9.7506	2	1144.5612	1144.5612	K	M	539	550
PSM	EAALAEVADEK	2805	sp|Q15003-2|CND2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9010	9.763	3	1144.5612	1144.5612	K	M	539	550
PSM	EAALAEVADEK	2806	sp|Q15003-2|CND2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9625	10.357	2	1144.5612	1144.5612	K	M	539	550
PSM	EDEENGLVQPK	2807	sp|Q92613|JADE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5361	6.2555	2	1256.5885	1256.5885	K	E	451	462
PSM	EDLEVHQAK	2808	sp|Q96ER9-2|MITOK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2630	3.8649	2	1067.5247	1067.5247	R	L	12	21
PSM	EEATEIEQTVQK	2809	sp|Q9UGP5-2|DPOLL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8140	8.9861	3	1403.678	1403.6780	R	A	115	127
PSM	EEDIAVLAEEK	2810	sp|Q8TAF3-5|WDR48_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14688	15.121	2	1244.6136	1244.6136	K	I	353	364
PSM	EEEMEGDYQETWK	2811	sp|Q14241|ELOA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11635	12.155	2	1672.6563	1672.6563	K	A	131	144
PSM	EENAEQQALAAK	2812	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4888	5.8385	3	1300.6259	1300.6259	R	R	475	487
PSM	EEQQPEEEEALVQHK	2813	sp|A4D1P6-3|WDR91_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7062	8.0043	3	1821.8381	1821.8381	K	L	212	227
PSM	EEVEEVLDSK	2814	sp|Q7Z5J4-3|RAI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10879	11.468	2	1175.5558	1175.5558	K	A	902	912
PSM	EGALCEENMR	2815	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4	ms_run[2]:scan=4997	5.9298	2	1207.4962	1207.4962	K	G	689	699
PSM	EGLELPEDEEEK	2816	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12758	13.302	2	1415.6304	1415.6304	K	K	547	559
PSM	EGLELPEDEEEK	2817	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13856	14.347	2	1415.6304	1415.6304	K	K	547	559
PSM	EGLELPEDEEEKK	2818	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9024	9.7753	3	1543.7253	1543.7253	K	K	547	560
PSM	EGLELPEDEEEKK	2819	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9546	10.286	3	1543.7253	1543.7253	K	K	547	560
PSM	EGVIEPDTDAPQEMGDENAEITEEMMDQANDKK	2820	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	25-UNIMOD:35	ms_run[2]:scan=17473	18.05	3	3694.5444	3694.5444	K	V	86	119
PSM	EIVEVKEENIEDATEK	2821	sp|P82970|HMGN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16188	16.674	3	1873.9157	1873.9157	K	G	96	112
PSM	EKEPVVVETVEEK	2822	sp|Q8N5N7-2|RM50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8614	9.4041	3	1513.7876	1513.7876	K	K	33	46
PSM	ELQELEPENK	2823	sp|Q92696|PGTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7420	8.3203	2	1227.5983	1227.5983	K	W	373	383
PSM	EMDYETEVEMEK	2824	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13043	13.577	2	1531.6058	1531.6058	R	G	678	690
PSM	ENREAQMAAK	2825	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1050	1.909	1	1146.5452	1146.5452	K	L	110	120
PSM	EPLTADEEEALK	2826	sp|Q9NRL2-2|BAZ1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11392	11.927	2	1343.6456	1343.6456	R	Q	736	748
PSM	EPVETAVDNNSK	2827	sp|Q6FI81-3|CPIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3907	4.9645	2	1301.6099	1301.6099	K	V	84	96
PSM	EQQEAIEHIDEVQNEIDR	2828	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12409	12.962	3	2194.0138	2194.0138	K	L	15	33
PSM	EQSELDQDLDDVEEVEEEETGEETK	2829	sp|P55209-2|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=22311	26.187	4	2923.2102	2923.2102	K	L	8	33
PSM	EQTDQTQAQELHR	2830	sp|A6NJ78-3|MET15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2617	3.8519	2	1582.7336	1582.7336	R	S	47	60
PSM	EREAELGAK	2831	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1972	3.3432	2	1001.5142	1001.5142	K	A	178	187
PSM	EREGLENDLK	2832	sp|Q8WUM4-2|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4298	5.3196	3	1201.5939	1201.5939	K	S	570	580
PSM	EREGLENDLK	2833	sp|Q8WUM4-2|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4335	5.3498	2	1201.5939	1201.5939	K	S	570	580
PSM	ERNGETINTR	2834	sp|Q13616|CUL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1386	2.4002	2	1188.5847	1188.5847	K	L	190	200
PSM	ERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAK	2835	sp|Q12797-9|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15231	15.683	4	4222.9302	4222.9302	K	E	97	135
PSM	ERTSTSSSSVQAR	2836	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1082	1.9479	3	1394.675	1394.6750	K	R	695	708
PSM	ESQLQQEDPMDR	2837	sp|Q5R372-7|RBG1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8204	9.0415	2	1474.6358	1474.6358	R	Y	105	117
PSM	ESTNLGNLEESSE	2838	sp|P24386|RAE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11833	12.332	2	1407.6001	1407.6001	K	-	641	654
PSM	ETKPEPMEEDLPENK	2839	sp|P31948-3|STIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7309	8.2252	3	1784.8138	1784.8138	K	K	184	199
PSM	ETLNQAETK	2840	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2393	3.672	1	1032.5088	1032.5088	K	S	1481	1490
PSM	ETVEEQVSTTER	2841	sp|Q13619-2|CUL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6224	7.1922	2	1406.6525	1406.6525	K	V	576	588
PSM	ETVEEQVSTTER	2842	sp|Q13619-2|CUL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8010	8.8679	2	1406.6525	1406.6525	K	V	576	588
PSM	EVCPSAIDPEDGEK	2843	sp|Q9H1Y0-2|ATG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4	ms_run[2]:scan=9430	10.182	2	1544.6665	1544.6665	K	K	143	157
PSM	EVCSEQAETGPCR	2844	sp|P05067-7|A4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=2999	4.1741	2	1521.6188	1521.6188	R	A	289	302
PSM	EVEEDSEDEEMSEDEEDDSSGEEVVIPQKK	2845	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12444	12.998	3	3440.3944	3440.3944	K	G	23	53
PSM	EVEVEVESMDK	2846	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13112	13.645	2	1292.5806	1292.5806	R	A	593	604
PSM	EVEVEVESMDK	2847	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13667	14.167	2	1292.5806	1292.5806	R	A	593	604
PSM	FDIEGSDEADGSK	2848	sp|P06400|RB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8802	9.5767	2	1368.5681	1368.5681	R	H	877	890
PSM	FEEQGDFESEK	2849	sp|Q9BZF1-3|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6906	7.8661	2	1343.5517	1343.5517	K	L	633	644
PSM	GDAEKPEEELEEDDDEELDETLSER	2850	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20813	22.99	3	2920.2105	2920.2105	K	L	23	48
PSM	GDQPAASGDSDDDEPPPLPR	2851	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11084	11.646	2	2034.8767	2034.8767	R	L	48	68
PSM	GEDNAIEMSEDFDGK	2852	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15209	15.662	3	1655.6621	1655.6621	K	M	4722	4737
PSM	GGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	2853	sp|P08621-2|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15243	15.694	3	3372.3848	3372.3848	R	G	302	338
PSM	GGSREYDTGGGSSSSR	2854	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=211	0.24879	2	1558.6608	1558.6608	R	L	63	79
PSM	GSTDNLMDDIER	2855	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:35	ms_run[2]:scan=8790	9.5679	2	1380.5827	1380.5827	R	A	306	318
PSM	HGSVSADEAAR	2856	sp|Q9NWW5|CLN6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1707	2.9362	2	1098.5054	1098.5054	R	T	29	40
PSM	IEEEEQEPEPPEPFEYIDD	2857	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=22539	26.679	2	2332.9747	2332.9747	K	-	904	923
PSM	IGEEEIQKPEEK	2858	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4428	5.4248	3	1427.7144	1427.7144	K	V	423	435
PSM	INPDEREEMK	2859	sp|P48507|GSH0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2750	3.9655	2	1259.5816	1259.5816	K	V	81	91
PSM	KAVEEELEK	2860	sp|Q96NL6|SCLT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2939	4.1259	2	1073.5605	1073.5605	K	I	423	432
PSM	KDDENIPMETEETHLEETTESQQNGEEGTSTPEDK	2861	sp|Q969G3-3|SMCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15456	15.911	4	3976.6764	3976.6764	K	E	263	298
PSM	KETQTDSISR	2862	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1460	2.4901	2	1163.5782	1163.5782	K	Y	793	803
PSM	KGAVAEDGDELR	2863	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3117	4.2729	3	1258.6153	1258.6153	K	T	7	19
PSM	KHTTDPDIDK	2864	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=67	0.061933	2	1168.5724	1168.5724	K	K	522	532
PSM	KIEESETIEDSSNQAAAR	2865	sp|Q8N573-2|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4817	5.7731	3	1976.9287	1976.9287	K	E	625	643
PSM	KLCEEDLEK	2866	sp|Q9Y6X8|ZHX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4	ms_run[2]:scan=3553	4.632	2	1162.554	1162.5540	K	L	736	745
PSM	KPITDDDVDR	2867	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2676	3.9046	3	1172.5673	1172.5673	K	I	603	613
PSM	KQEETAVLEEDSADWEK	2868	sp|Q96A49|SYAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15146	15.596	3	2005.9116	2005.9116	K	E	302	319
PSM	LAATGREDQGIETDDEK	2869	sp|Q5R372-7|RBG1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4308	5.3269	2	1846.8545	1846.8545	K	D	263	280
PSM	LDDNEALIEK	2870	sp|P61011-2|SRP54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9178	9.9281	2	1158.5768	1158.5768	K	L	263	273
PSM	LDQMDEDELER	2871	sp|O14530-2|TXND9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9755	10.471	2	1391.5875	1391.5875	K	L	36	47
PSM	LDQMDEDELER	2872	sp|O14530-2|TXND9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:35	ms_run[2]:scan=6260	7.225	2	1407.5824	1407.5824	K	L	36	47
PSM	LDTDDLDEIEK	2873	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12485	13.042	2	1304.5984	1304.5984	R	I	357	368
PSM	LDTDDLDEIEK	2874	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15098	15.541	2	1304.5984	1304.5984	R	I	357	368
PSM	LEHVVEEEK	2875	sp|P40937-2|RFC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2718	3.9421	2	1110.5557	1110.5557	R	V	165	174
PSM	LESIDGNEEESMK	2876	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8602	9.393	2	1479.6399	1479.6399	K	E	755	768
PSM	LEVAEAEEEETSIK	2877	sp|O15213|WDR46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16364	16.845	2	1575.7516	1575.7516	R	A	132	146
PSM	LEVEREAEK	2878	sp|Q96AG4|LRC59_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2660	3.891	2	1101.5666	1101.5666	R	K	163	172
PSM	LEVQAEEERK	2879	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3048	4.2144	2	1229.6252	1229.6252	K	Q	177	187
PSM	LLDEEEATDNDLR	2880	sp|Q8WUM4-2|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11366	11.904	2	1531.7002	1531.7002	R	A	462	475
PSM	LSDDPCPVESK	2881	sp|O60244|MED14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4	ms_run[2]:scan=4908	5.8543	2	1245.5547	1245.5547	K	K	616	627
PSM	MGGEEKPIGAGEEK	2882	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2863	4.0625	3	1430.6711	1430.6711	K	Q	13	27
PSM	MPEDGLSDDK	2883	sp|Q05682-6|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4954	5.8934	2	1105.4598	1105.4598	K	K	393	403
PSM	NDFTEEEEAQVRK	2884	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6143	7.121	3	1593.7271	1593.7271	K	E	143	156
PSM	NDFTEEEEAQVRK	2885	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6648	7.626	3	1593.7271	1593.7271	K	E	143	156
PSM	NDFTEEEEAQVRK	2886	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11670	12.187	3	1593.7271	1593.7271	K	E	143	156
PSM	NDFTEEEEAQVRK	2887	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12154	12.69	3	1593.7271	1593.7271	K	E	143	156
PSM	NDFTEEEEAQVRK	2888	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14803	15.228	3	1593.7271	1593.7271	K	E	143	156
PSM	NDFTEEEEAQVRK	2889	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10351	10.995	3	1593.7271	1593.7271	K	E	143	156
PSM	NDFTEEEEAQVRK	2890	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9489	10.231	3	1593.7271	1593.7271	K	E	143	156
PSM	NIEEHASSDVER	2891	sp|Q92930|RAB8B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2866	4.0645	3	1384.6219	1384.6219	R	M	105	117
PSM	NMDDYEDFDEK	2892	sp|Q68DH5|LMBD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11414	11.946	2	1419.5136	1419.5136	R	H	286	297
PSM	NRDLQGEEIK	2893	sp|Q9BXW9|FACD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2953	4.1372	2	1200.6099	1200.6099	K	S	1391	1401
PSM	NSFREQLEEEEEAK	2894	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17901	18.559	3	1736.7853	1736.7853	K	H	1339	1353
PSM	NSQGSEMFGDDDK	2895	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5860	6.8577	2	1428.5463	1428.5463	R	R	593	606
PSM	NSRQPAEAGVVESEN	2896	sp|Q8N2Z9|CENPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4464	5.4594	2	1585.7332	1585.7332	K	-	124	139
PSM	QCQETEITTK	2897	sp|Q96SW2-2|CRBN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4	ms_run[2]:scan=3013	4.1858	2	1236.5656	1236.5656	K	N	324	334
PSM	QEEASGGPTAPK	2898	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2269	3.5712	2	1170.5517	1170.5517	K	A	241	253
PSM	QELQEEEEQTKPPR	2899	sp|P18858-2|DNLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3945	4.9981	3	1739.8326	1739.8326	K	R	209	223
PSM	QEMQEVQSSR	2900	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2623	3.8582	2	1220.5455	1220.5456	R	S	179	189
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	2901	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=19544	20.764	4	3574.4874	3574.4874	K	A	737	771
PSM	QGEEEDAEIIVK	2902	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16236	16.722	2	1358.6565	1358.6565	K	I	443	455
PSM	QLETDSSEEISR	2903	sp|Q96NL6|SCLT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5418	6.3137	2	1392.6369	1392.6369	K	Y	476	488
PSM	QMEVQLEEEYEDK	2904	sp|Q92614-2|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14925	15.351	2	1668.7189	1668.7189	K	Q	1279	1292
PSM	QPCPSESDIITEEDK	2905	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4	ms_run[2]:scan=11313	11.852	2	1746.7618	1746.7618	K	S	202	217
PSM	QQMAEEMVEAAGEDER	2906	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20947	23.196	2	1821.7509	1821.7509	K	E	817	833
PSM	QQQTTEIHSDK	2907	sp|Q6EMB2|TTLL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1058	1.9183	2	1313.6212	1313.6212	K	L	855	866
PSM	QRELAEQELEK	2908	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4470	5.4688	2	1371.6994	1371.6994	R	Q	1654	1665
PSM	QSQQEAEEEEREEEEEAQIIQR	2909	sp|Q9NQZ2|SAS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16692	17.189	3	2716.206	2716.2060	R	R	149	171
PSM	REQEQLNVEK	2910	sp|Q15643-2|TRIPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2666	3.8953	2	1271.647	1271.6470	R	R	334	344
PSM	RGAEEEEVEEPLGVEK	2911	sp|A6NDB9|PALM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9459	10.205	3	1798.8585	1798.8585	K	K	475	491
PSM	RGSIGENQGEEK	2912	sp|Q05682-6|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=198	0.2342	3	1302.6164	1302.6164	K	G	200	212
PSM	RLEEPEEPK	2913	sp|O75822-2|EIF3J_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3053	4.2177	2	1125.5666	1125.5666	K	V	98	107
PSM	RNHDGECTAAPTNR	2914	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=1081	1.9473	2	1597.7015	1597.7016	K	Q	1160	1174
PSM	RQAVSEASAR	2915	sp|Q8TEP8-1|CE192_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=55	0.050995	2	1073.5578	1073.5578	R	I	1822	1832
PSM	RSALENSEEHSAK	2916	sp|Q7Z7A4-3|PXK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1091	1.9565	2	1456.6906	1456.6906	K	Y	243	256
PSM	RTEEQEFCDLNDSK	2917	sp|Q8N5C7-2|DTWD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=6784	7.7535	3	1769.7526	1769.7526	K	C	93	107
PSM	SDNEDKEETELGVMEDQR	2918	sp|Q9BXB5|OSB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10810	11.404	3	2122.8961	2122.8961	K	S	380	398
PSM	SHREEMEVR	2919	sp|Q13951|PEBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1375	2.3871	2	1171.5404	1171.5404	R	V	159	168
PSM	SIPLDEGEDEAQR	2920	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8983	9.7377	2	1457.6634	1457.6634	R	R	2384	2397
PSM	SNAVQEADSELK	2921	sp|Q5VZL5-2|ZMYM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7882	8.7514	2	1289.6099	1289.6099	K	Q	1027	1039
PSM	SNDSEEGLEDAVEGADEALQK	2922	sp|Q9NUJ3|T11L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20950	23.198	3	2204.9557	2204.9557	K	A	18	39
PSM	TDEAFFDSENDPEK	2923	sp|Q9H583|HEAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12857	13.393	3	1642.6635	1642.6635	K	C	1974	1988
PSM	TEEIAEEEETVFPK	2924	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16919	17.433	3	1649.7672	1649.7672	K	A	41	55
PSM	TREEIQEVR	2925	sp|P08559-3|ODPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2736	3.9539	2	1158.5993	1158.5993	R	S	272	281
PSM	TSGRVAVEEVDEEGK	2926	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6840	7.807	3	1603.7689	1603.7689	R	F	436	451
PSM	TVNESHGSVER	2927	sp|Q63HN8|RN213_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1487	2.523	2	1213.5687	1213.5687	K	S	1521	1532
PSM	VAEDEAEAAAAAK	2928	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4457	5.4522	3	1244.5885	1244.5885	K	F	47	60
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	2929	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20065	21.646	4	3368.4764	3368.4764	K	E	312	341
PSM	VESLDVDSEAK	2930	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6811	7.7795	2	1190.5667	1190.5667	K	K	34	45
PSM	VESLEQEAANER	2931	sp|P05067-7|A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7175	8.1101	3	1373.6423	1373.6423	K	Q	420	432
PSM	VGGTSDVEVNEK	2932	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10963	11.541	2	1232.5885	1232.5885	K	K	406	418
PSM	VGGTSDVEVNEK	2933	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15805	16.28	2	1232.5885	1232.5885	K	K	406	418
PSM	VGGTSDVEVNEK	2934	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16901	17.415	2	1232.5885	1232.5885	K	K	406	418
PSM	VGGTSDVEVNEK	2935	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17387	17.951	2	1232.5885	1232.5885	K	K	406	418
PSM	VGGTSDVEVNEK	2936	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=19029	20.021	2	1232.5885	1232.5885	K	K	406	418
PSM	VGTIDDDPEYR	2937	sp|Q9BZI7-2|REN3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7295	8.213	2	1278.5728	1278.5728	K	K	151	162
PSM	VLQSDEYEEVEDK	2938	sp|O15397-2|IPO8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9701	10.424	2	1581.7046	1581.7046	K	T	387	400
PSM	QRQLAAEEER	2939	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=4611	5.5975187	2	1211.5891	1211.5889	R	R	2109	2119
PSM	ENDKTEEMPNDSVLENK	2940	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=10387	11.027842	3	1991.861410	1990.878965	K	S	486	503
PSM	EELQANGSAPAADK	2941	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=4312	5.3317568	2	1400.644439	1399.657937	K	E	56	70
PSM	MQVDQEEPHVEEQQQQTPAENKAESEEMETSQAGSK	2942	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	28-UNIMOD:35	ms_run[1]:scan=6862	7.8275051	3	4102.776495	4101.765142	K	D	522	558
PSM	NDMDEPPSGDFGGDEEK	2943	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:35	ms_run[1]:scan=4769	5.7328477	2	1853.713220	1853.689768	K	S	578	595
PSM	YQGDGIVEDEEETMENNEEK	2944	sp|Q9NYF8|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:35	ms_run[1]:scan=15270	15.723448	3	2374.977385	2372.943810	K	K	892	912
PSM	ALEEEEMEQVGQAEHLEEEHDPSPEEQDREWK	2945	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:35	ms_run[1]:scan=12748	13.292514	5	3879.676036	3877.649701	K	E	342	374
PSM	EAEPEPEPEPELEPEAEAEPEPELEPEPD	2946	sp|O60936|NOL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0		ms_run[1]:scan=21101	23.491906	3	3252.3898	3252.3876	K	P	164	193
PSM	KTEAPAAPAAQETK	2947	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=2595	3.832222	2	1412.714006	1411.730708	K	S	150	164
PSM	GGTVADLDEQDEETVTAGGKEDEDPAK	2948	sp|Q92922|SMRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=15156	15.605253	3	2777.224011	2775.220637	K	G	402	429
PSM	KAAAPAPEEEMDECEQALAAEPK	2949	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:35,14-UNIMOD:4	ms_run[1]:scan=10075	10.747473	2	2500.114842	2500.109771	K	A	253	276
PSM	NKYEDEINK	2950	sp|P04264|K2C1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=2768	3.9799949	2	1151.546480	1151.545868	R	R	268	277
PSM	TTGEENGVEAEEWGK	2951	sp|O00429|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=10142	10.809747	2	1635.689096	1634.706010	K	F	78	93
PSM	EEAEVKPEVK	2952	sp|O75822|EIF3J_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:27	ms_run[1]:scan=5316	6.2151023	2	1138.5871	1138.5865	K	I	61	71
PSM	ELENGEVEGEDAFLSSK	2953	sp|Q86V48|LUZP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=17197	17.732544	2	1852.823668	1851.837418	K	G	352	369
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	2954	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=14606	15.04519	3	3045.138233	3044.151982	K	L	595	622
PSM	QKLEEDAEMK	2955	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=7530	8.4302096	2	1203.5502	1202.5482	K	S	215	225
PSM	DIDDDLEGEVTEECGK	2956	sp|Q9UHX1|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:4	ms_run[1]:scan=17598	18.214298	2	1822.742156	1822.741469	K	F	474	490
PSM	QGEEEDAEIIVK	2957	sp|Q9UHX1|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=17036	17.562733	1	1341.6322	1341.6295	K	I	503	515
PSM	NSDHGEDEVIAVSEK	2958	sp|Q14865|ARI5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=6826	7.7926594	2	1627.729227	1627.732559	R	V	87	102
PSM	QTDVTGEEELTK	2959	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=11686	12.201338	2	1331.6029	1331.6087	R	G	843	855
PSM	HQGVMVGMGQKDSYVGDEAQSK	2960	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:35,8-UNIMOD:35	ms_run[1]:scan=3487	4.5742703	3	2383.092652	2382.058010	R	R	42	64
PSM	DLDEDANGITDEGK	2961	sp|Q5QJE6|TDIF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=10617	11.232848	2	1491.623438	1490.637262	K	E	298	312
PSM	LEGALGADTTEDGDEK	2962	sp|Q9NZM1|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=11736	12.246928	2	1621.722762	1619.716240	K	S	1094	1110
PSM	NDFTEEEEAQVRK	2963	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=8353	9.1761544	3	1594.720820	1593.727080	K	E	143	156
PSM	ETVEEQVSTTER	2964	sp|Q13619|CUL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=6260	7.2249985	2	1406.652844	1406.652518	K	V	676	688
PSM	DYEEVGVDSVEGEGEEEGEEY	2965	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=19765	21.125152	3	2347.901054	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	2966	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=19444	20.624056	3	2347.901054	2347.897571	K	-	431	452
PSM	LESIDGNEEESMK	2967	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=8180	9.020089	2	1479.641594	1479.639904	K	E	755	768
PSM	STAELEAEELEK	2968	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=11503	12.027285	2	1347.640811	1347.640556	K	L	385	397
PSM	MNGDQNSDVYAQEK	2969	sp|P14324-2|FPPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=10182	10.844169	2	1657.6912	1655.6732	-	Q	1	15
PSM	AQETEAAPSQAPADEPEPESAAAQSQENQDTRPK	2970	sp|Q9UNF1|MAGD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7931	8.7938993	3	3578.600426	3577.604071	K	V	138	172
PSM	AEGGAADLDTQR	2971	sp|Q9Y4E8|UBP15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1	ms_run[1]:scan=8803	9.5774414	2	1244.5641	1244.5628	M	S	2	14
PSM	EDFEERTESEMR	2972	sp|Q96JM7|LMBL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7438	8.3377324	3	1557.646096	1556.641301	K	T	638	650
PSM	GAASCEDEELEFK	2973	sp|Q14934|NFAC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,5-UNIMOD:4	ms_run[1]:scan=16452	16.93192	2	1525.6244	1525.6237	M	L	2	15
PSM	TDPEKGEIEDYR	2974	sp|Q8TCS8|PNPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=4948	5.8890144	3	1450.661991	1450.657603	K	L	517	529
PSM	RDIQENDEEAVQVK	2975	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=5880	6.8865784	3	1671.806875	1671.806393	K	E	33	47
PSM	SGNGNAAATAEENSPK	2976	sp|P08397|HEM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1	ms_run[1]:scan=5992	6.9982381	2	1559.7112	1558.6852	M	M	2	18
PSM	ASQPPEDTAESQASDELECK	2977	sp|Q8N6D2|RN182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,19-UNIMOD:4	ms_run[1]:scan=13895	14.37836	3	2232.9342	2232.9323	M	I	2	22
PSM	QDNYNEEVADLK	2978	sp|Q8N3C0|ASCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=15215	15.668744	2	1419.6160	1419.6149	K	I	19	31
PSM	DLSEVSETTESTDVK	2979	sp|P41227|NAA10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=14656	15.091165	2	1638.757298	1638.747206	K	D	211	226
PSM	EAPGPNGATEEDGVPSK	2980	sp|P49585|PCY1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=5677	6.6840233	2	1654.733567	1653.748209	K	V	17	34
PSM	QPVADDTCLEK	2981	sp|Q6PJG6|BRAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=11831	12.330351	2	1257.5537	1257.5542	R	L	21	32
PSM	QVAQQEAERAR	2982	sp|P35232|PHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=3507	4.5904014	2	1267.6271	1267.6264	K	F	187	198
PSM	QLSESESSLEMDDER	2983	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=10125	10.794837	2	1753.764605	1753.731238	R	Y	321	336
PSM	QDENDDDDDWNPCK	2984	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	13-UNIMOD:4	ms_run[1]:scan=8859	9.6253207	2	1765.6022	1764.6162	K	A	333	347
PSM	AGNASKDEIDSAVK	2985	sp|P23381|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=4939	5.8804874	3	1404.673341	1403.689238	K	M	28	42
PSM	CDSSPDSAEDVRK	2986	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:4	ms_run[1]:scan=2294	3.592926	3	1464.611696	1464.615087	K	V	132	145
PSM	MDADDSRAPK	2987	sp|Q01813|PFKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1	ms_run[1]:scan=4024	5.0662519	2	1146.4973	1146.4970	-	G	1	11
PSM	MDADDSRAPK	2988	sp|Q01813|PFKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=2266	3.5692169	2	1162.4918	1162.4919	-	G	1	11
PSM	NGFQDSPCEDEWESR	2989	sp|O43516|WIPF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:4	ms_run[1]:scan=14914	15.340921	2	1855.696449	1854.711506	R	F	439	454
PSM	CEMEQQNQEYK	2990	sp|P02533|K1C14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:35	ms_run[1]:scan=4566	5.5598125	2	1484.5534	1484.5543	R	I	389	400
PSM	CEMEQQNQEYK	2991	sp|P02533|K1C14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=7562	8.4617365	2	1468.5597	1468.5594	R	I	389	400
PSM	MTSEVIEDEK	2992	sp|Q9BV86|NTM1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1	ms_run[1]:scan=15199	15.652657	2	1221.5431	1221.5430	-	Q	1	11
PSM	VGEAQETTEEFNR	2993	sp|O95273|CCDB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=6636	7.6150633	2	1509.656310	1508.674316	R	E	37	50
PSM	ALVLIAFAQYLQQCPFEDHVK	2994	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:4	ms_run[1]:scan=24107	30.83478	3	2491.258936	2489.277703	K	L	45	66
PSM	TAEAGGVTGK	2995	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=971	1.789561	2	889.451158	889.450511	K	G	88	98
PSM	ASDAVQSEPR	2996	sp|Q16512|PKN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1	ms_run[1]:scan=5446	6.3635896	2	1100.5085	1100.5093	M	S	2	12
PSM	ASDAVQSEPR	2997	sp|Q16512|PKN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1	ms_run[1]:scan=5445	6.3626151	2	1101.5072	1100.5092	M	S	2	12
PSM	SNEVETSATNGQPDQQAAPK	2998	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1	ms_run[1]:scan=7984	8.8426161	3	2113.9392	2112.9552	M	A	2	22
PSM	AASSKPEEIK	2999	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1574	2.6561	2	1058.5608	1058.5608	K	M	472	482
PSM	ACIDSNEDGDLSK	3000	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=4858	5.813	2	1422.5933	1422.5933	R	S	208	221
PSM	ACTDESLAVEER	3001	sp|O60293-2|ZC3H1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=7132	8.0703	2	1378.6035	1378.6035	K	I	1586	1598
PSM	ADDTDSQSWR	3002	sp|O75369-8|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3834	4.8938	2	1179.4792	1179.4792	R	S	1464	1474
PSM	ADQDRLDLEER	3003	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6284	7.2448	2	1358.6426	1358.6426	K	K	402	413
PSM	AEEDVEPECIMEK	3004	sp|Q9UJU6-5|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:4	ms_run[2]:scan=12973	13.511	2	1577.6589	1577.6589	R	V	16	29
PSM	AEEDVEPECIMEK	3005	sp|Q9UJU6-5|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:4	ms_run[2]:scan=12974	13.512	3	1577.6589	1577.6589	R	V	16	29
PSM	AGAAGGPEEEAEKPVK	3006	sp|Q8WW12-2|PCNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3179	4.3282	2	1538.7577	1538.7577	R	T	17	33
PSM	AGAAGTAEATAR	3007	sp|P50895|BCAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2113	3.4488	2	1045.5152	1045.5152	R	L	129	141
PSM	AKDEEEEEEEPLPPCEAVR	3008	sp|Q96C34-2|RUND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:4	ms_run[2]:scan=9939	10.629	3	2254.99	2254.9900	K	W	21	40
PSM	ALVSEEGEGK	3009	sp|Q13618-3|CUL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3435	4.5313	1	1017.4979	1017.4979	K	N	261	271
PSM	APPHELTEEEK	3010	sp|Q13409-6|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2938	4.1252	3	1278.6092	1278.6092	K	Q	177	188
PSM	ARNLADDSSENK	3011	sp|P35251-2|RFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1235	2.1984	3	1318.6113	1318.6113	K	V	569	581
PSM	ASSEDAGPSPQTR	3012	sp|Q5T5P2-4|SKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2284	3.5841	2	1301.5848	1301.5848	K	A	766	779
PSM	ATDDYHYEK	3013	sp|Q9NZ63|TLS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2319	3.6129	2	1140.4724	1140.4724	K	F	273	282
PSM	AVANYDSVEEGEK	3014	sp|P51659-3|DHB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5866	6.8673	2	1409.6311	1409.6311	K	V	51	64
PSM	AVTEQGAELSNEER	3015	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9651	10.379	2	1531.7114	1531.7114	K	N	28	42
PSM	CESCYGAEAEDIK	3016	sp|Q9Y282-2|ERGI3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=7166	8.1014	2	1530.5967	1530.5967	R	C	142	155
PSM	CGCLDEDTQR	3017	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4,3-UNIMOD:4	ms_run[2]:scan=3032	4.2012	2	1252.4812	1252.4812	R	Q	421	431
PSM	CGDLEEELK	3018	sp|P67936|TPM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=9023	9.7747	2	1091.4805	1091.4805	K	N	154	163
PSM	CGDLEEELK	3019	sp|P67936|TPM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=9548	10.287	2	1091.4805	1091.4805	K	N	154	163
PSM	CHAEHTPEEEIDHTGAK	3020	sp|O95757|HS74L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=2589	3.8281	4	1959.8381	1959.8381	K	T	540	557
PSM	CMMDTDDEVRDR	3021	sp|Q9UBF2-2|COPG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=5199	6.1093	3	1541.5909	1541.5909	R	A	516	528
PSM	DAASGEVVGK	3022	sp|P52888|THOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3042	4.2082	2	931.46108	931.4611	R	F	401	411
PSM	DAINQGMDEELER	3023	sp|P11177-3|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12946	13.479	3	1518.662	1518.6620	R	D	37	50
PSM	DAPPPTRAETR	3024	sp|P08621-2|RU17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2177	3.499	2	1209.6102	1209.6102	R	E	53	64
PSM	DDENIPMETEETHLEETTESQQNGEEGTSTPEDK	3025	sp|Q969G3-3|SMCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15928	16.42	3	3848.5814	3848.5814	K	E	264	298
PSM	DDENIPMETEETHLEETTESQQNGEEGTSTPEDK	3026	sp|Q969G3-3|SMCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15936	16.428	3	3848.5814	3848.5814	K	E	264	298
PSM	DDNFGEGNDGGILDDK	3027	sp|O60216|RAD21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14993	15.415	2	1679.6911	1679.6911	K	L	217	233
PSM	DDPEGDRDGCVITK	3028	sp|Q96IU2|ZBED3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:4	ms_run[2]:scan=4332	5.3477	2	1575.6835	1575.6835	K	V	218	232
PSM	DEDCDLLEGQK	3029	sp|Q5SWX8-3|ODR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4	ms_run[2]:scan=9705	10.427	2	1320.5504	1320.5504	K	K	228	239
PSM	DEELQDIQVEGEPK	3030	sp|Q9H5I5-2|PIEZ2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14617	15.054	2	1627.7577	1627.7577	K	E	628	642
PSM	DELSERDEQELQEIR	3031	sp|Q6XUX3-3|DUSTY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13578	14.082	3	1887.881	1887.8810	K	K	255	270
PSM	DELTDLDQSNVTEETPEGEEHHPVADTENK	3032	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12370	12.92	4	3377.4655	3377.4655	K	E	223	253
PSM	DGAVEDEEGEGEDGEERDPETEEPLWASR	3033	sp|Q9Y2U8|MAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16944	17.458	3	3231.3236	3231.3236	K	T	214	243
PSM	DGDPPGPIDNTK	3034	sp|Q8TEY7|UBP33_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5186	6.0978	2	1224.5622	1224.5622	K	I	866	878
PSM	DGQDRPLTK	3035	sp|Q9HAU0-8|PKHA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1694	2.9126	2	1028.5251	1028.5251	K	I	224	233
PSM	DGRYTDATSK	3036	sp|Q13217|DNJC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1353	2.3595	2	1112.5098	1112.5098	R	Y	281	291
PSM	DGTSPEEEIEIER	3037	sp|Q9H501|ESF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13281	13.802	3	1502.6736	1502.6736	K	Q	691	704
PSM	DIVEDEDDDFLK	3038	sp|Q9NYV6-4|RRN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18648	19.474	2	1451.6304	1451.6304	K	G	417	429
PSM	DIVVQETMEDIDK	3039	sp|O43852-15|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:35	ms_run[2]:scan=13147	13.677	3	1549.7182	1549.7182	K	N	39	52
PSM	DKDGDGEGAGGAPEEMPVDR	3040	sp|P28702|RXRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7254	8.1802	3	2000.8382	2000.8382	K	I	284	304
PSM	DLDDIEDENEQLK	3041	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14182	14.646	3	1574.6948	1574.6948	R	Q	313	326
PSM	DLVQEEEQLMEEK	3042	sp|Q8NDV7-6|TNR6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=20928	23.17	2	1618.7396	1618.7396	R	K	19	32
PSM	DMNQFGEGEQAK	3043	sp|Q00341-2|VIGLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:35	ms_run[2]:scan=3854	4.9125	2	1368.5616	1368.5616	K	I	127	139
PSM	DQDAIETDAMIK	3044	sp|P35251-2|RFC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:35	ms_run[2]:scan=9859	10.561	2	1364.613	1364.6130	K	K	1109	1121
PSM	DQDEEDRELIMK	3045	sp|O60524-2|NEMF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8996	9.7512	3	1519.6824	1519.6824	K	L	85	97
PSM	DSLGDIDSEK	3046	sp|O94830|DDHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7419	8.3196	2	1077.4826	1077.4826	K	D	366	376
PSM	DSSHNELYYEEAEHER	3047	sp|Q8TAA9-2|VANG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6863	7.8282	4	2006.8242	2006.8242	R	R	335	351
PSM	DVLETEDEEPPPRR	3048	sp|Q9ULV3-5|CIZ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6870	7.8354	3	1680.7955	1680.7955	R	W	540	554
PSM	DYEEVGADSADGEDEGEEY	3049	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13551	14.056	2	2077.7396	2077.7396	K	-	431	450
PSM	EAAFDDAVEER	3050	sp|Q09028-3|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8998	9.7525	2	1250.5415	1250.5415	K	V	5	16
PSM	EAAFDDAVEER	3051	sp|Q09028-3|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9529	10.269	2	1250.5415	1250.5415	K	V	5	16
PSM	EAGGGGVGGPGAK	3052	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2016	3.3765	2	1012.4938	1012.4938	K	S	40	53
PSM	EALEQVAEEGR	3053	sp|Q8IWB1|IPRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8546	9.3458	2	1229.5888	1229.5888	K	Q	67	78
PSM	EALQEQLDER	3054	sp|Q13439-3|GOGA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7963	8.8236	2	1229.5888	1229.5888	K	L	317	327
PSM	EDINAIEMEEDK	3055	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:35	ms_run[2]:scan=9252	10.002	2	1450.6134	1450.6134	K	R	262	274
PSM	EEEAIKEEVVK	3056	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5274	6.1767	3	1301.6715	1301.6715	K	E	586	597
PSM	EEEDDVDLELR	3057	sp|Q9HCS7|SYF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14024	14.501	2	1360.5994	1360.5994	R	L	320	331
PSM	EEIRDEEENIIK	3058	sp|Q9H1X3-2|DJC25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9479	10.222	3	1515.7417	1515.7417	K	N	90	102
PSM	EFTNQEAAEPK	3059	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4163	5.1979	2	1262.5779	1262.5779	K	E	419	430
PSM	EGAAAAPPPER	3060	sp|Q7Z2K6|ERMP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2665	3.8945	2	1064.5251	1064.5251	R	E	21	32
PSM	EGLELPEDEEEK	3061	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12255	12.8	2	1415.6304	1415.6304	K	K	547	559
PSM	EGLELPEDEEEK	3062	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13313	13.832	2	1415.6304	1415.6304	K	K	547	559
PSM	EGLELPEDEEEK	3063	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14544	14.986	2	1415.6304	1415.6304	K	K	547	559
PSM	EGLELPEDEEEK	3064	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15064	15.497	2	1415.6304	1415.6304	K	K	547	559
PSM	EGLELPEDEEEK	3065	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16484	16.966	2	1415.6304	1415.6304	K	K	547	559
PSM	EIDDTYIEDAADVDAR	3066	sp|Q99459|CDC5L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18348	19.105	3	1809.7905	1809.7905	R	K	506	522
PSM	EIESEIDSEEELINK	3067	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=17806	18.462	3	1775.8313	1775.8313	K	K	755	770
PSM	EKDEMVEQEFNR	3068	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7506	8.4082	2	1552.6828	1552.6828	K	L	373	385
PSM	EKEELEEIR	3069	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4895	5.8432	3	1173.5877	1173.5877	R	Q	539	548
PSM	ELASTERELDEAR	3070	sp|Q8IVB5|LIX1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6748	7.7209	3	1517.7322	1517.7322	R	L	294	307
PSM	ELDVEEAHAASTEEK	3071	sp|Q96C86|DCPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5985	6.9912	3	1656.7479	1656.7479	R	E	14	29
PSM	EQYSDAPEEIR	3072	sp|Q8NEJ9-2|NGDN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7281	8.2014	2	1335.5943	1335.5943	K	D	211	222
PSM	ESGASVDEVAR	3073	sp|P50579|MAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4134	5.1749	2	1118.5204	1118.5204	K	Q	59	70
PSM	ESQSEREEFESEFK	3074	sp|Q5VT25-3|MRCKA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9598	10.333	2	1759.7537	1759.7537	R	Q	668	682
PSM	EVLNEEDEVQPNGK	3075	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7334	8.2446	3	1598.7424	1598.7424	R	I	109	123
PSM	EYAEDDNIYQQK	3076	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7003	7.9508	2	1514.6525	1514.6525	K	I	60	72
PSM	EYQEPEVPESNQK	3077	sp|P33981-2|TTK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6421	7.3862	2	1575.7053	1575.7053	K	Q	373	386
PSM	FDDGDVTECK	3078	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:4	ms_run[2]:scan=5288	6.1888	2	1184.4656	1184.4656	K	M	1900	1910
PSM	FDDVTSEDTR	3079	sp|Q9H6R0|DHX33_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4894	5.8425	2	1183.4993	1183.4993	R	I	157	167
PSM	GEENLMDAQVK	3080	sp|P50990-3|TCPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:35	ms_run[2]:scan=4651	5.6297	2	1248.5656	1248.5656	K	A	198	209
PSM	GEGPEVDVK	3081	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4620	5.6035	1	928.45018	928.4502	K	L	1397	1406
PSM	GEVDEEDAALYR	3082	sp|Q9NPQ8-2|RIC8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9938	10.628	3	1365.6048	1365.6048	K	H	232	244
PSM	GGSGSGPTIEEVD	3083	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10079	10.752	1	1203.5255	1203.5255	K	-	574	587
PSM	GLSEDTTEETLK	3084	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6801	7.7702	2	1321.6249	1321.6249	K	E	578	590
PSM	GLSEDTTEETLK	3085	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11362	11.901	2	1321.6249	1321.6249	K	E	578	590
PSM	GPAESPDEGITTTEGEGECEQTPEELEPVEK	3086	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	19-UNIMOD:4	ms_run[2]:scan=16939	17.452	3	3343.4409	3343.4409	K	Q	887	918
PSM	GQTVNEDSMDVK	3087	sp|Q9UQR0|SCML2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5116	6.0362	2	1321.582	1321.5820	M	K	2	14
PSM	GSVSSEASELDK	3088	sp|Q8TDB6|DTX3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5326	6.2243	2	1207.5568	1207.5568	K	K	544	556
PSM	GTGEAEEEYVGPR	3089	sp|Q13895|BYST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6290	7.249	3	1392.6157	1392.6157	R	L	41	54
PSM	GVAASAGSSGENK	3090	sp|P35249-2|RFC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1448	2.4777	2	1133.5313	1133.5313	R	K	21	34
PSM	HDGTMCDTCR	3091	sp|Q86YT6|MIB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=1401	2.4212	2	1251.4431	1251.4431	K	Q	80	90
PSM	HDIETIEEK	3092	sp|O00472-2|ELL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3825	4.8855	2	1112.535	1112.5350	K	E	228	237
PSM	HSEGLREVPDDE	3093	sp|Q6P9B6|MEAK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4593	5.583	3	1381.611	1381.6110	R	-	445	457
PSM	IESGELDPER	3094	sp|P20338|RAB4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6368	7.3182	2	1143.5408	1143.5408	K	M	178	188
PSM	INSSTENSDEGLK	3095	sp|P28715|ERCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3256	4.3894	2	1392.6369	1392.6369	R	V	421	434
PSM	KIYEDGDDDMK	3096	sp|Q9HB71|CYBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3519	4.6011	3	1327.5602	1327.5602	K	R	197	208
PSM	KPPTDEELK	3097	sp|P35659-2|DEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2503	3.7585	2	1055.5499	1055.5499	K	E	284	293
PSM	KTPVTEQEEK	3098	sp|Q9NTI5|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1642	2.793	2	1187.6034	1187.6034	K	L	1219	1229
PSM	KVEEDELLEK	3099	sp|Q9ULD4|BRPF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6228	7.1952	3	1230.6343	1230.6343	R	S	876	886
PSM	LDTDDLDEIEK	3100	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13978	14.457	2	1304.5984	1304.5984	R	I	357	368
PSM	LGHGEEELETEK	3101	sp|O60306|AQR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3688	4.759	3	1369.6361	1369.6361	R	D	879	891
PSM	LQAETDQLEEEK	3102	sp|P53539-7|FOSB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6796	7.7665	2	1431.6729	1431.6729	R	A	144	156
PSM	LWGDDDEEEDEEEEDNKTEETGPGMDEEDSELVAK	3103	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	25-UNIMOD:35	ms_run[2]:scan=15804	16.279	4	4028.576	4028.5760	R	D	4778	4813
PSM	MDTEEARPAK	3104	sp|Q9NRX1|PNO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2108	3.4452	2	1146.5339	1146.5339	R	R	47	57
PSM	MPEDGLSDDK	3105	sp|Q05682-6|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=3103	4.2589	2	1121.4547	1121.4547	K	K	393	403
PSM	MPEDGLSDDKK	3106	sp|Q05682-6|CALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3417	4.5167	3	1233.5547	1233.5547	K	P	393	404
PSM	NDFTEEEEAQVR	3107	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8923	9.6848	3	1465.6321	1465.6321	K	K	143	155
PSM	NDFTEEEEAQVR	3108	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9113	9.8574	2	1465.6321	1465.6321	K	K	143	155
PSM	NDFTEEEEAQVRK	3109	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13706	14.205	3	1593.7271	1593.7271	K	E	143	156
PSM	NDFTEEEEAQVRK	3110	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15327	15.777	3	1593.7271	1593.7271	K	E	143	156
PSM	NDFTEEEEAQVRK	3111	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14252	14.715	3	1593.7271	1593.7271	K	E	143	156
PSM	NEDSGSETAYLENR	3112	sp|Q49A88|CCD14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7560	8.4603	2	1583.67	1583.6700	R	S	121	135
PSM	NEPQNPGANSAR	3113	sp|P20339-2|RAB5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2049	3.4002	2	1253.5749	1253.5749	K	G	170	182
PSM	NGEPEPTPVVNGEK	3114	sp|P40222|TXLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6119	7.0999	2	1465.7049	1465.7049	R	E	120	134
PSM	NIEEHASADVEK	3115	sp|P61006-2|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6360	7.3102	2	1340.6208	1340.6208	R	M	105	117
PSM	NIEEHASADVEK	3116	sp|P61006-2|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10322	10.967	2	1340.6208	1340.6208	R	M	105	117
PSM	NSFREQLEEEEEAK	3117	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16928	17.442	2	1736.7853	1736.7853	K	H	1339	1353
PSM	NYTDNELEK	3118	sp|P00367-2|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4539	5.5363	1	1124.4986	1124.4986	K	I	25	34
PSM	QAQQAQNVQR	3119	sp|Q9NQ55-2|SSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=975	1.7987	2	1169.5901	1169.5901	R	K	326	336
PSM	QDENDDDDDWNPCK	3120	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:4	ms_run[2]:scan=8209	9.0452	3	1764.6169	1764.6169	K	A	188	202
PSM	QEGGDNDLIER	3121	sp|P30566|PUR8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5784	6.7822	2	1244.5633	1244.5633	K	I	416	427
PSM	QGDITEDETIR	3122	sp|Q86VN1-2|VPS36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6538	7.5212	2	1275.5943	1275.5943	K	F	148	159
PSM	QKEIQEPDPTYEEK	3123	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5071	5.9952	3	1732.8156	1732.8156	K	M	70	84
PSM	QLHEDEEFAR	3124	sp|P35251-2|RFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4430	5.4263	2	1272.5735	1272.5735	R	T	218	228
PSM	QLQEEDRGIDR	3125	sp|Q8NE86-3|MCU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3139	4.2915	3	1357.6586	1357.6586	R	V	65	76
PSM	QNSLGSNEEK	3126	sp|O75554-2|WBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1567	2.6458	2	1104.5047	1104.5047	K	S	254	264
PSM	QPVADDTCLEK	3127	sp|Q6PJG6-2|BRAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=5353	6.2496	2	1274.5813	1274.5813	R	L	21	32
PSM	QQEELLAEENQR	3128	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14269	14.73	2	1485.7059	1485.7059	R	L	2550	2562
PSM	QQTNNQTEVVK	3129	sp|Q5BKZ1-3|ZN326_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2336	3.627	2	1287.6419	1287.6419	K	I	167	178
PSM	QRQLAAEEER	3130	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2166	3.4911	3	1228.616	1228.6160	R	R	1940	1950
PSM	QTEEQVNDLK	3131	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3770	4.8334	2	1202.5779	1202.5779	R	E	943	953
PSM	QYMEEENYDK	3132	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4974	5.9098	2	1347.5289	1347.5289	K	I	303	313
PSM	RGITSENER	3133	sp|O76024|WFS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=104	0.094702	2	1060.5261	1060.5261	R	E	153	162
PSM	RNEIDAEPPAK	3134	sp|Q8TDN6|BRX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3272	4.4008	2	1238.6255	1238.6255	K	R	21	32
PSM	RPAEDMEEEQAFK	3135	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8219	9.0547	3	1578.6984	1578.6984	K	R	22	35
PSM	RQSEDECFR	3136	sp|O96028-4|NSD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:4	ms_run[2]:scan=2308	3.6053	2	1225.5146	1225.5146	K	C	455	464
PSM	RQTQSESSNYDSELEK	3137	sp|P46100-6|ATRX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3507	4.5904	3	1899.8446	1899.8446	K	E	740	756
PSM	RTGLSEGDGDK	3138	sp|Q5T5U3-3|RHG21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=108	0.097593	2	1133.5313	1133.5313	R	L	6	17
PSM	RVEVVEEDGPSEK	3139	sp|O15231-2|ZN185_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4086	5.1295	3	1471.7155	1471.7155	K	S	79	92
PSM	SDKTEEIAEEEETVFPK	3140	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16166	16.651	3	1979.9211	1979.9211	K	A	38	55
PSM	SDLLEEDRR	3141	sp|Q969Q5|RAB24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4671	5.6457	2	1131.552	1131.5520	K	R	122	131
PSM	SDTVADIESEPVVESTETEGT	3142	sp|Q9UPN6|SCAF8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18790	19.664	3	2193.9649	2193.9649	K	-	1251	1272
PSM	SEDQNIQDDFK	3143	sp|Q9BS34|ZN670_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8893	9.6567	2	1337.5735	1337.5735	K	N	47	58
PSM	SEQAVAQLEEEK	3144	sp|Q9H0B6|KLC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8011	8.8687	1	1359.6518	1359.6518	R	Q	123	135
PSM	SEQSVAQLEEEK	3145	sp|Q07866-8|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6700	7.6735	2	1375.6467	1375.6467	K	K	134	146
PSM	SGELAQEYDK	3146	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4614	5.5995	2	1138.5142	1138.5142	R	R	161	171
PSM	SGSSGGQQPSGMK	3147	sp|Q9BRQ6|MIC25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1453	2.4832	2	1206.5299	1206.5299	R	E	72	85
PSM	SHREEMEVR	3148	sp|Q13951|PEBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1377	2.3885	3	1171.5404	1171.5404	R	V	159	168
PSM	SIPLDEGEDEAQR	3149	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8997	9.7519	3	1457.6634	1457.6634	R	R	2384	2397
PSM	SMPEESEDCWEAR	3150	sp|Q96A19|C102A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:4	ms_run[2]:scan=10233	10.889	2	1624.6134	1624.6134	K	S	206	219
PSM	SMYEEEINETR	3151	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:35	ms_run[2]:scan=6095	7.0804	2	1415.5875	1415.5875	K	R	210	221
PSM	SMYEEEINETR	3152	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8935	9.6958	2	1399.5926	1399.5926	K	R	210	221
PSM	SQAEEEIDEIRK	3153	sp|Q5T1M5|FKB15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7396	8.3005	3	1445.6998	1445.6998	R	S	755	767
PSM	SSGPGGQNVNK	3154	sp|Q14197|ICT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=25	0.027796	2	1043.4996	1043.4996	R	V	84	95
PSM	STAELEAEELEK	3155	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11032	11.603	3	1347.6406	1347.6406	K	L	385	397
PSM	SVSGTDVQEECR	3156	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:4	ms_run[2]:scan=3226	4.3643	2	1365.5831	1365.5831	K	E	244	256
PSM	SVTEQGAELSNEER	3157	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7742	8.6275	2	1547.7063	1547.7063	K	N	28	42
PSM	SVTEQGAELSNEER	3158	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11562	12.08	2	1547.7063	1547.7063	K	N	28	42
PSM	SVTVDSMDEEK	3159	sp|P29084|T2EB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5830	6.8263	2	1238.5336	1238.5336	R	I	222	233
PSM	TATDSDERIDDEIDTEVEETQEEK	3160	sp|Q8N5P1|ZC3H8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=17448	18.018	3	2796.1945	2796.1945	K	I	18	42
PSM	TCHIQECDK	3161	sp|P07996-2|TSP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=901	1.6633	2	1189.4856	1189.4856	R	R	337	346
PSM	TDLVPEEDVK	3162	sp|Q9BRT8-2|CBWD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10646	11.259	2	1143.5659	1143.5659	K	K	169	179
PSM	TGISEEAAIEENK	3163	sp|Q5UIP0-2|RIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10016	10.697	2	1389.6624	1389.6624	K	R	1935	1948
PSM	TLDTGETPSETK	3164	sp|Q9UKZ1|CNO11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3759	4.8258	2	1277.5987	1277.5987	K	M	496	508
PSM	TLDVSTDEEDK	3165	sp|P16383-3|GCFC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5371	6.2648	2	1250.5514	1250.5514	R	I	92	103
PSM	TLEEDEEELFK	3166	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=19415	20.563	2	1380.6297	1380.6297	K	M	40	51
PSM	TLEEDEEELFK	3167	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=19729	21.066	2	1380.6297	1380.6297	K	M	40	51
PSM	TLEEDEEELFK	3168	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=20430	22.237	2	1380.6297	1380.6297	K	M	40	51
PSM	TMQNTSDLDTAR	3169	sp|P14923|PLAK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:35	ms_run[2]:scan=3092	4.2513	2	1367.5987	1367.5987	R	C	192	204
PSM	TNELEEELSAEK	3170	sp|Q8WZ74|CTTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13697	14.196	2	1390.6464	1390.6464	K	R	206	218
PSM	TQDEEEQAEALRR	3171	sp|O75771-7|RA51D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4221	5.25	3	1573.7332	1573.7332	K	I	154	167
PSM	TSQVVEQDVPEEVDR	3172	sp|Q9Y6X8|ZHX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10813	11.407	3	1728.8166	1728.8166	R	A	15	30
PSM	VAIQEAEDVDELEDEEEGAETR	3173	sp|Q9BRS8-2|LARP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18341	19.095	3	2475.0773	2475.0773	R	G	20	42
PSM	VNGDASPAAAESGAK	3174	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2692	3.9175	2	1343.6317	1343.6317	K	E	41	56
PSM	VVDDEDLVDQR	3175	sp|Q76M96|CCD80_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9307	10.058	2	1301.6099	1301.6099	R	L	686	697
PSM	VVEDDEDDFPTTR	3176	sp|Q9Y5P4-2|CERT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9836	10.54	2	1536.658	1536.6580	K	S	199	212
PSM	YEGNVTEETR	3177	sp|Q8IY37|DHX37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3199	4.3438	2	1196.5309	1196.5309	R	I	335	345
PSM	YYETPEEEREK	3178	sp|Q9Y2K7-3|KDM2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3010	4.1838	3	1471.6467	1471.6467	R	L	129	140
PSM	QQEELLAEENQR	3179	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=14385	14.836152	2	1468.6789	1468.6789	R	L	2719	2731
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	3180	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	25-UNIMOD:35	ms_run[1]:scan=7237	8.1655471	4	3789.619610	3789.614378	K	A	735	771
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	3181	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=11428	11.958876	3	3575.488834	3574.487386	K	A	737	771
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	3182	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=11404	11.936572	3	3575.488834	3574.487386	K	A	737	771
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	3183	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=15365	15.813572	3	3576.454609	3574.487386	K	A	737	771
PSM	EIPLSETERGEVEEDK	3184	sp|Q14789|GOGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9139	9.882927	3	1858.881875	1858.879617	K	E	1026	1042
PSM	EGLELPEDEEEKK	3185	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:27	ms_run[1]:scan=9096	9.8408184	3	1526.7042	1525.7142	K	K	539	552
PSM	EGLELPEDEEEK	3186	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=13278	13.799708	2	1415.629957	1415.630385	K	K	412	424
PSM	EGLELPEDEEEKK	3187	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:27	ms_run[1]:scan=9055	9.8022251	3	1525.7225	1525.7143	K	K	539	552
PSM	TALETESQDSAEPSGSEEESDPVSLER	3188	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=14180	14.644937	3	2879.249075	2878.247580	K	E	1483	1510
PSM	IKEDLEEQEALEDGVACADEK	3189	sp|O75691|UTP20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	17-UNIMOD:4	ms_run[1]:scan=16062	16.556086	3	2391.079193	2390.079516	K	A	2578	2599
PSM	EDINAIEMEEDK	3190	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=12261	12.806114	2	1434.613883	1434.618440	K	R	262	274
PSM	EAEGAPQVEAGK	3191	sp|Q05682-2|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:27	ms_run[1]:scan=6752	7.7237593	2	1166.5552	1166.5562	K	R	294	306
PSM	QEEEEEEELLPVNGSQEEAKPQVR	3192	sp|Q9NZ53|PDXL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=15403	15.852119	4	2796.292835	2795.309727	K	D	181	205
PSM	RPAEDMEEEQAFK	3193	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=7623	8.5221159	2	1579.716526	1578.698422	K	R	22	35
PSM	QEAVVEEDYNENAK	3194	sp|P82970|HMGN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=12787	13.328033	2	1619.6985	1619.6946	K	N	68	82
PSM	EIVEVKEENIEDATEK	3195	sp|P82970|HMGN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:27	ms_run[1]:scan=16774	17.273577	2	1856.9002	1855.9042	K	G	96	112
PSM	EELEQREAELQK	3196	sp|Q14152|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=5052	5.9773478	2	1500.742623	1500.742001	K	V	592	604
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	3197	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:27	ms_run[1]:scan=15583	16.052595	4	3881.6481	3881.6441	K	G	307	347
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	3198	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=15023	15.450671	5	3899.657160	3899.655180	K	G	307	347
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAKK	3199	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1	ms_run[1]:scan=21572	24.509101	5	3391.4644	3391.4694	M	D	2	34
PSM	GQECEYPPTQDGR	3200	sp|P50579|MAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:4	ms_run[1]:scan=3840	4.8982684	2	1535.631125	1535.631071	K	T	132	145
PSM	ELVSSSSSGSDSDSEVDK	3201	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=4703	5.6727916	2	1813.771478	1813.770126	K	K	6	24
PSM	TVNEDVEEMEIDEQTK	3202	sp|Q9NRL2|BAZ1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:35	ms_run[1]:scan=6575	7.5548237	2	1923.850799	1923.825533	K	V	1030	1046
PSM	FGESEEVEMEVESDEEDDKQEK	3203	sp|Q15459|SF3A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:35	ms_run[1]:scan=10565	11.186024	4	2632.064005	2632.049398	K	A	317	339
PSM	QDWVDGEPTEAEK	3204	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=15103	15.547082	2	1485.6269	1485.6254	K	D	2979	2992
PSM	KGHEENGDVVTEPQVAEK	3205	sp|Q9UG63|ABCF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=5124	6.0442004	4	1965.927899	1964.943949	R	N	25	43
PSM	AAAPAPEEEMDECEQALAAEPK	3206	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[1]:scan=10456	11.089842	3	2372.024088	2372.014808	K	A	254	276
PSM	EPVADEEEEDSDDDVEPITEFR	3207	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:27	ms_run[1]:scan=21403	24.147686	3	2546.0480	2546.0451	K	F	92	114
PSM	AADEEAFEDNSEEYIR	3208	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=17290	17.840364	2	1888.793848	1886.780631	R	R	356	372
PSM	AADEEAFEDNSEEYIR	3209	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=14545	14.987067	3	1887.767361	1886.780631	R	R	356	372
PSM	QEEQEPTGEEPAVLGGDK	3210	sp|Q6NS38|ALKB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=14847	15.273282	3	1894.8450	1894.8427	K	E	17	35
PSM	QKLEEDAEMK	3211	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=6791	7.7608093	2	1202.5479	1202.5484	K	S	215	225
PSM	DSALVEESNGTLEEK	3212	sp|Q9UJA5|TRM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=11736	12.246928	2	1620.735827	1619.752626	K	Q	281	296
PSM	MEDEEVAESWEEAADSGEIDRR	3213	sp|Q7Z422|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1	ms_run[1]:scan=22172	25.861218	2	2594.0716	2594.0709	-	L	1	23
PSM	LSSSSEPYEEDEFNDDQSIKK	3214	sp|Q9H4L7|SMRCD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=10739	11.340774	2	2446.077732	2446.065974	K	T	210	231
PSM	KGQGTAATGNQATPK	3215	sp|Q5T1M5|FKB15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1056	1.9167272	3	1428.730640	1428.732105	K	T	49	64
PSM	HQGVMVGMGQKDSYVGDEAQSK	3216	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=3650	4.7194516	3	2350.046123	2350.068180	R	R	42	64
PSM	ESLTEAEVATEK	3217	sp|P18858|DNLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:27	ms_run[1]:scan=13956	14.43631	2	1287.6208	1287.6189	K	E	162	174
PSM	EVEVEVESMDK	3218	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=13632	14.132963	2	1292.580209	1292.580598	R	A	593	604
PSM	AGEAAELQDAEVESSAK	3219	sp|Q9NZT2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9877	10.576815	2	1703.787211	1703.784988	K	S	657	674
PSM	QPCPSESDIITEEDK	3220	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,3-UNIMOD:4	ms_run[1]:scan=16185	16.669603	3	1729.7344	1729.7347	K	S	202	217
PSM	NDFTEEEEAQVRK	3221	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=10085	10.758809	2	1594.727456	1593.727080	K	E	143	156
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	3222	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=16265	16.750301	3	3370.488997	3368.476411	K	E	312	341
PSM	DYEEVGVDSVEGEGEEEGEEY	3223	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=22772	27.158131	3	2347.901054	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	3224	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=21873	25.147647	3	2347.901054	2347.897571	K	-	431	452
PSM	SNGALSTEEREEEMK	3225	sp|Q8IUD2|RB6I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=5283	6.1831814	3	1709.741804	1708.757394	K	Q	410	425
PSM	SNGALSTEEREEEMK	3226	sp|Q8IUD2|RB6I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=5299	6.198794	2	1709.743135	1708.757394	K	Q	410	425
PSM	EAELDVNEELDK	3227	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:27	ms_run[1]:scan=17811	18.467379	2	1384.6341	1384.6353	K	K	34	46
PSM	SDVEENNFEGRESR	3228	sp|Q13595|TRA2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1	ms_run[1]:scan=7202	8.1340907	2	1709.7402	1708.7282	M	S	2	16
PSM	SDVEENNFEGR	3229	sp|Q13595|TRA2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1	ms_run[1]:scan=9758	10.473161	2	1336.5526	1336.5526	M	E	2	13
PSM	EMDYETEVEMEK	3230	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:27	ms_run[1]:scan=17770	18.418369	2	1513.5976	1513.5947	R	G	678	690
PSM	SEYSELDEDESQAPYDPNGKPER	3231	sp|P19387|RPB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=11850	12.346787	2	2655.114554	2654.125614	K	F	206	229
PSM	EEAGGGISEEEAAQYDR	3232	sp|Q9UBE0|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9435	10.184823	3	1809.765290	1809.765316	K	Q	5	22
PSM	LEDGDIEEAPGAGGR	3233	sp|Q9Y613|FHOD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=7964	8.8242748	2	1484.677568	1484.674316	K	R	336	351
PSM	QSAEQLEDKK	3234	sp|O95394|AGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=4198	5.2310788	2	1157.5561	1157.5559	K	R	389	399
PSM	QEEFDVANNGSSQANK	3235	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=6775	7.745026	2	1737.746987	1736.760171	K	L	153	169
PSM	QNTEESTIGRK	3236	sp|Q9ULF5|S39AA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=3228	4.3655576	2	1244.5991	1244.5992	K	L	534	545
PSM	RDIQENDEEAVQVK	3237	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=10598	11.216567	3	1672.810560	1671.806393	K	E	33	47
PSM	ESELPPRAGNEEECPEEDMEGVEDGEEGDLK	3238	sp|O75164|KDM4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:4	ms_run[1]:scan=15712	16.182434	3	3475.432065	3474.419884	K	T	356	387
PSM	DLSEVSETTESTDVK	3239	sp|P41227|NAA10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=11088	11.651152	3	1639.740212	1638.747206	K	D	211	226
PSM	NDDGDTVVVVEK	3240	sp|P32856|STX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=10867	11.455367	2	1289.600769	1288.614676	K	D	14	26
PSM	YSEEANNLIEECEQAER	3241	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:4	ms_run[1]:scan=13506	14.013352	3	2083.863088	2082.880028	K	L	120	137
PSM	DDNFGEGNDGGILDDK	3242	sp|O60216|RAD21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=15756	16.225868	2	1680.676299	1679.691088	K	L	217	233
PSM	NSRPEANEALER	3243	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=4274	5.2982956	2	1385.654244	1384.669505	K	G	131	143
PSM	EIEADLERQEK	3244	sp|Q8NBT2|SPC24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=5617	6.6264988	2	1358.666426	1358.667774	K	E	113	124
PSM	DLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDK	3245	sp|Q15029|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	24-UNIMOD:35	ms_run[1]:scan=12812	13.350979	4	3684.368146	3682.359134	K	K	32	64
PSM	TELQQDVEDTK	3246	sp|Q96HH9|GRM2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1	ms_run[1]:scan=14159	14.625046	2	1346.6194	1346.6196	M	P	2	13
PSM	LEVAEAEEEETSIK	3247	sp|O15213|WDR46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=14438	14.884544	2	1575.753075	1575.751563	R	A	132	146
PSM	QQSEEAFPQEQQK	3248	sp|O94923|GLCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=8774	9.5521998	2	1558.6909	1558.6894	K	A	71	84
PSM	ELEIESQTEEQPTTK	3249	sp|Q9NYH9|UTP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9598	10.332827	2	1760.832424	1760.831604	R	Q	281	296
PSM	SQSDLDDQHDYDSVASDEDTDQEPLR	3250	sp|Q9Y2X7|GIT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=12567	13.121604	3	2980.209205	2979.212592	R	S	373	399
PSM	QAEEQVEAARK	3251	sp|Q6ZRS2|SRCAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=3960	5.0105267	2	1240.6035	1240.6043	K	D	2334	2345
PSM	ATDYGPEEVCER	3252	sp|O75157|T22D2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:4	ms_run[1]:scan=7000	7.9486831	2	1424.581399	1424.587809	R	S	54	66
PSM	QDPAAAQEGQDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVK	3253	sp|Q6NT46|GAG2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,36-UNIMOD:4,38-UNIMOD:4,47-UNIMOD:35	ms_run[1]:scan=9780	10.491644	5	5906.4482	5906.4142	R	T	50	106
PSM	MEEDEFIGEK	3254	sp|Q9H0Y0|ATG10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1	ms_run[1]:scan=18679	19.507598	2	1267.5267	1267.5273	-	T	1	11
PSM	VREEEIEVDSR	3255	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=5150	6.0669085	2	1359.663186	1359.663023	R	V	628	639
PSM	ENAEQGEVDMESHR	3256	sp|P14209|CD99_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=3623	4.6936744	2	1630.686203	1629.668913	K	N	157	171
PSM	DADDAVYELDGK	3257	sp|Q13243|SRSF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=13621	14.122554	2	1309.567543	1309.567391	R	E	49	61
PSM	EAAFDDAVEER	3258	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:27	ms_run[1]:scan=15367	15.817028	2	1232.5305	1232.5304	K	V	5	16
PSM	EAAFDDAVEER	3259	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9812	10.519885	2	1250.541747	1250.541511	K	V	5	16
PSM	CEDLETQTQSEK	3260	sp|O00592|PODXL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=9581	10.317988	2	1449.5772	1449.5922	K	Q	344	356
PSM	MEQEPQNGEPAEIK	3261	sp|Q8N0X7|SPART_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1	ms_run[1]:scan=12244	12.786135	2	1640.7363	1640.7347	-	I	1	15
PSM	TATPQQAQEVHEK	3262	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=2406	3.6804552	3	1466.700558	1465.716121	K	L	213	226
PSM	EEEMEGDYQETWK	3263	sp|Q14241|ELOA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=11771	12.277397	3	1672.657349	1672.656282	K	A	131	144
PSM	EEISLEDEAVDK	3264	sp|Q8TET4|GANC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=12346	12.896022	2	1375.638785	1375.635471	K	N	7	19
PSM	GGTQVDTEIEEK	3265	sp|Q9Y2H6|FND3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=5578	6.5732086	2	1305.608573	1304.609590	K	D	244	256
PSM	QLTETYEEDRK	3266	sp|Q8WXW3|PIBF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=8313	9.1364641	2	1393.6344	1393.6356	K	N	221	232
PSM	TAEAGGVTGK	3267	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=725	1.2854707	2	889.451158	889.450511	K	G	88	98
PSM	DINAYNCEEPTEK	3268	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:4	ms_run[1]:scan=7805	8.684541	2	1582.646546	1581.661702	K	L	85	98
PSM	NEEENENSISQYK	3269	sp|P82673|RT35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=5086	6.0100592	3	1583.679360	1582.674710	K	E	301	314
PSM	ESSETPDQFMTADETR	3270	sp|P16070|CD44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=13771	14.266012	2	1843.740171	1842.757787	K	N	716	732
PSM	ESSETPDQFMTADETR	3271	sp|P16070|CD44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=13696	14.194921	2	1843.740171	1842.757787	K	N	716	732
PSM	GAEEEEEEEEEEEEELQVVQVSEK	3272	sp|Q9UNS1|TIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=21835	25.097576	3	2834.190894	2834.198899	R	E	664	688
PSM	SNEVETSATNGQPDQQAAPK	3273	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1	ms_run[1]:scan=7993	8.8514665	2	2113.9422	2112.9552	M	A	2	22
PSM	MDIEDEENMSSSSTDVK	3274	sp|P78563|RED1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=17563	18.159854	2	1974.7982	1973.7712	-	E	1	18
PSM	EAVEENGVITDK	3275	sp|Q96KB5|TOPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=7103	8.0408094	2	1303.621232	1302.630326	K	A	216	228
PSM	AALEEANGEIEK	3276	sp|Q8NB16|MLKL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=6397	7.3538423	2	1273.604018	1272.619761	K	F	67	79
PSM	AADEEAFEDNSEEYIR	3277	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15848	16.334	3	1886.7806	1886.7806	R	R	356	372
PSM	AALSEEELEK	3278	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7351	8.2592	2	1117.5503	1117.5503	K	K	1039	1049
PSM	AEAGPEGVAPAPEGEK	3279	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6132	7.111	3	1507.7155	1507.7155	K	K	670	686
PSM	AEEELGELEAK	3280	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10959	11.538	2	1216.5823	1216.5823	K	L	685	696
PSM	AEKPMDNSESSEESSDSADSEEAPAAMTAAQAK	3281	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8911	9.6738	3	3370.3937	3370.3937	K	P	524	557
PSM	APEFEDSEEVRR	3282	sp|Q96RR1-3|PEO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5527	6.5096	3	1462.6688	1462.6688	K	I	145	157
PSM	AQEPESGLSEETQVK	3283	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7838	8.7132	3	1630.7686	1630.7686	R	C	4060	4075
PSM	AQGEPVAGHESPK	3284	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2075	3.4215	3	1305.6313	1305.6313	R	I	522	535
PSM	AQLEQSVEENK	3285	sp|Q96SB3|NEB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4316	5.3345	2	1273.615	1273.6150	K	E	707	718
PSM	ATEMVEVGADDDEGGAERGEAGDLR	3286	sp|Q6NZI2|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:35	ms_run[2]:scan=11359	11.897	3	2564.0933	2564.0933	K	R	338	363
PSM	ATLEQDSAKK	3287	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=43	0.040301	2	1089.5666	1089.5666	K	E	1085	1095
PSM	CAELEEELK	3288	sp|P09493-9|TPM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=9196	9.9474	2	1119.5118	1119.5118	K	T	190	199
PSM	CEEEAQEIVR	3289	sp|Q5TKA1-3|LIN9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=6035	7.0323	2	1261.5609	1261.5609	R	H	400	410
PSM	CGDLEEELK	3290	sp|P67936|TPM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=9253	10.002	1	1091.4805	1091.4805	K	N	154	163
PSM	CGDLEEELK	3291	sp|P67936|TPM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=11395	11.93	2	1091.4805	1091.4805	K	N	154	163
PSM	DAINQGMDEELERDEK	3292	sp|P11177-3|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12642	13.19	3	1890.8265	1890.8265	R	V	37	53
PSM	DDGDPPLLYDE	3293	sp|O14730-2|RIOK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=19506	20.714	2	1247.5194	1247.5194	K	-	506	517
PSM	DDNFGEGNDGGILDDK	3294	sp|O60216|RAD21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14903	15.331	3	1679.6911	1679.6911	K	L	217	233
PSM	DELPERQPR	3295	sp|P60983|GMFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3016	4.1879	2	1138.5731	1138.5731	K	F	59	68
PSM	DEPQRETLK	3296	sp|P21926|CD9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2342	3.6309	2	1114.5619	1114.5619	K	A	136	145
PSM	DEREDAILEEGMER	3297	sp|Q8IWE4|DCNL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14188	14.651	3	1690.7468	1690.7468	K	F	100	114
PSM	DERQEDPYGPQTK	3298	sp|O15226|NKRF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3349	4.4625	2	1561.7009	1561.7009	K	E	69	82
PSM	DGGNQEVEIAR	3299	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5633	6.6454	2	1186.5578	1186.5578	K	C	297	308
PSM	DGGNQEVEIAR	3300	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6235	7.2024	2	1186.5578	1186.5578	K	C	297	308
PSM	DGNCRDCIK	3301	sp|Q15785|TOM34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=865	1.5856	2	1136.4703	1136.4703	K	D	64	73
PSM	DINESDEVEVYSR	3302	sp|Q06787-11|FMR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13144	13.675	2	1553.6845	1553.6845	K	A	58	71
PSM	DIQEDSGMEPR	3303	sp|O75844|FACE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6281	7.2428	2	1275.5401	1275.5401	K	N	293	304
PSM	DLEESIVQEEK	3304	sp|Q9UPU7-2|TBD2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14371	14.824	2	1317.63	1317.6300	K	K	263	274
PSM	DLEPESEPQLESETAGK	3305	sp|Q8TE68-4|ES8L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12770	13.311	2	1857.848	1857.8480	R	W	244	261
PSM	DLESKDEVPGSR	3306	sp|O95613|PCNT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4387	5.3919	2	1330.6365	1330.6365	R	L	2940	2952
PSM	DLNPEPEPESEEPDGGFR	3307	sp|Q9BZL4-2|PP12C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14147	14.616	2	2012.8599	2012.8599	R	T	604	622
PSM	DLRQDEHTR	3308	sp|P08134|RHOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=1430	2.4587	3	1168.5585	1168.5585	K	R	120	129
PSM	DMDLWEQQEEER	3309	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	2-UNIMOD:35	ms_run[2]:scan=11877	12.369	3	1622.6519	1622.6519	K	I	687	699
PSM	DNSTASASLASNGTSGGQEAGAPEEEEDELLR	3310	sp|Q96T23-3|RSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=18403	19.169	3	3191.3974	3191.3974	K	V	1144	1176
PSM	DPAAVTESK	3311	sp|Q8TCT9-5|HM13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2628	3.8635	2	916.45018	916.4502	K	E	311	320
PSM	DRDFTAEDYEK	3312	sp|O43314-2|VIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5917	6.9248	3	1387.5892	1387.5892	K	L	630	641
PSM	DSSSQTMPVEDK	3313	sp|Q9ULV3-5|CIZ1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4712	5.6813	2	1322.566	1322.5660	K	S	96	108
PSM	DTELSQESDFK	3314	sp|P24588|AKAP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8793	9.57	2	1297.5674	1297.5674	K	E	308	319
PSM	DVRNPEAEEMK	3315	sp|Q9H467|CUED2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3817	4.8775	3	1316.6031	1316.6031	K	A	262	273
PSM	DYEEVGIDSYEDEDEGEE	3316	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=17725	18.367	2	2120.7706	2120.7706	K	-	416	434
PSM	DYEEVGVDSVEGEGEEEGEEY	3317	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=17414	17.984	2	2347.8976	2347.8976	K	-	315	336
PSM	EADDGCALGGR	3318	sp|O75127|PTCD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	6-UNIMOD:4	ms_run[2]:scan=3362	4.4734	2	1119.4615	1119.4615	K	-	690	701
PSM	EAEMEEHREHIK	3319	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:35	ms_run[2]:scan=38	0.036749	3	1552.694	1552.6940	K	V	812	824
PSM	EALQEADVAK	3320	sp|Q8TDM6-2|DLG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5221	6.1297	2	1072.5401	1072.5401	K	C	511	521
PSM	EAMEDGEIDGNK	3321	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4607	5.5948	2	1306.5347	1306.5347	K	V	628	640
PSM	EDDIEDTMEESGWK	3322	sp|Q92544|TM9S4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	8-UNIMOD:35	ms_run[2]:scan=10586	11.204	2	1698.6567	1698.6567	K	L	315	329
PSM	EDINAIEMEEDKR	3323	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	8-UNIMOD:35	ms_run[2]:scan=7543	8.4437	3	1606.7145	1606.7145	K	D	262	275
PSM	EDINAIEMEEDKR	3324	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9770	10.484	3	1590.7196	1590.7196	K	D	262	275
PSM	EDQLEYQEELR	3325	sp|Q96BY6-3|DOC10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11805	12.307	2	1450.6576	1450.6576	K	S	2115	2126
PSM	EDQTEYLEER	3326	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7610	8.5102	2	1310.5626	1310.5626	K	R	192	202
PSM	EDSSSTEFVEK	3327	sp|O60749-2|SNX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5250	6.155	2	1256.5408	1256.5408	K	R	107	118
PSM	EEEATEWQHK	3328	sp|P35241-4|RADI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3138	4.2909	2	1285.5575	1285.5575	K	A	303	313
PSM	EEQQDDTVYMGK	3329	sp|Q14203-5|DCTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5852	6.8497	2	1441.6031	1441.6031	K	V	1097	1109
PSM	EGALCEENMR	3330	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=2884	4.0797	2	1223.4911	1223.4911	K	G	689	699
PSM	EGLELPEDEEEK	3331	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15972	16.461	2	1415.6304	1415.6304	K	K	547	559
PSM	EGLELPEDEEEK	3332	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=18462	19.237	2	1415.6304	1415.6304	K	K	547	559
PSM	EGLELPEDEEEK	3333	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=18938	19.882	2	1415.6304	1415.6304	K	K	547	559
PSM	EGLELPEDEEEK	3334	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=19312	20.412	2	1415.6304	1415.6304	K	K	547	559
PSM	EIVEVKEENIEDATEK	3335	sp|P82970|HMGN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15181	15.635	3	1873.9157	1873.9157	K	G	96	112
PSM	ELEIEERER	3336	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4919	5.8645	2	1201.5939	1201.5939	R	R	828	837
PSM	ELRDEEQTAESIK	3337	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6265	7.2288	3	1546.7475	1546.7475	K	N	314	327
PSM	EMDYETEVEMEK	3338	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	2-UNIMOD:35	ms_run[2]:scan=10200	10.86	2	1547.6007	1547.6007	R	G	678	690
PSM	ENGASESGDPLDEDDVDTVVDEQPK	3339	sp|Q96JN0-3|LCOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=17681	18.318	3	2659.1257	2659.1257	K	F	1073	1098
PSM	EPESAAEAVK	3340	sp|O76031|CLPX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3195	4.3411	2	1029.4979	1029.4979	K	L	149	159
PSM	EPTEEEMEAYR	3341	sp|O95391|SLU7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8592	9.3853	2	1382.566	1382.5660	R	M	560	571
PSM	ERLDEELK	3342	sp|Q9Y3D7|TIM16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4808	5.7667	2	1030.5295	1030.5295	K	I	103	111
PSM	ESLTEAEVATEK	3343	sp|P18858-2|DNLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7966	8.8277	2	1305.63	1305.6300	K	E	162	174
PSM	ESLTEAEVATEK	3344	sp|P18858-2|DNLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8006	8.863	3	1305.63	1305.6300	K	E	162	174
PSM	ETVEEQVSTTER	3345	sp|Q13619-2|CUL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7445	8.3429	2	1406.6525	1406.6525	K	V	576	588
PSM	EVTELSQEEK	3346	sp|O00716-2|E2F3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4570	5.5627	2	1190.5667	1190.5667	K	K	131	141
PSM	EYAEDDNIYQQK	3347	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6994	7.9422	3	1514.6525	1514.6525	K	I	60	72
PSM	GAEAFGDSEEDGEDVFEVEK	3348	sp|Q99549|MPP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=18771	19.642	3	2157.8862	2157.8862	R	I	44	64
PSM	GAGEMLEDGSER	3349	sp|Q96DE5|APC16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6007	7.0112	2	1249.5245	1249.5245	K	F	41	53
PSM	GDSDEEVIQDGVR	3350	sp|Q9BUE6|ISCA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8957	9.7142	2	1417.6321	1417.6321	K	V	71	84
PSM	GEEIPTQKPDQ	3351	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4564	5.5585	2	1240.5935	1240.5935	R	-	1131	1142
PSM	GLSEDTTEETLK	3352	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7397	8.3012	3	1321.6249	1321.6249	K	E	578	590
PSM	GLSEDTTEETLK	3353	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7866	8.7376	2	1321.6249	1321.6249	K	E	578	590
PSM	GLSEDTTEETLK	3354	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8452	9.2644	2	1321.6249	1321.6249	K	E	578	590
PSM	GLSEDTTEETLK	3355	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10601	11.219	2	1321.6249	1321.6249	K	E	578	590
PSM	GPTEADELMK	3356	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:35	ms_run[2]:scan=4182	5.2156	2	1105.4961	1105.4961	R	R	488	498
PSM	GSETPGATPGSK	3357	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2141	3.4722	2	1087.5146	1087.5146	K	I	241	253
PSM	GSQTEFEQQER	3358	sp|Q96EA4-2|SPDLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3424	4.5215	2	1337.5848	1337.5848	K	L	209	220
PSM	HAVSEGTK	3359	sp|Q93079|H2B1H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=22360	26.296	2	827.41373	827.4137	K	A	110	118
PSM	HAVSEGTK	3360	sp|Q93079|H2B1H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=22622	26.842	2	827.41373	827.4137	K	A	110	118
PSM	HAVSEGTK	3361	sp|Q93079|H2B1H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=23083	27.956	2	827.41373	827.4137	K	A	110	118
PSM	HAVSEGTK	3362	sp|Q93079|H2B1H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=23365	28.692	2	827.41373	827.4137	K	A	110	118
PSM	HDPQAEEALAK	3363	sp|Q8WVM7-2|STAG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3344	4.4591	3	1207.5833	1207.5833	R	R	443	454
PSM	IDEMPEAAVK	3364	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:35	ms_run[2]:scan=5019	5.9495	2	1117.5325	1117.5325	R	S	30	40
PSM	IEADSESQEDIIR	3365	sp|P55957|BID_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10005	10.688	3	1503.7053	1503.7053	R	N	72	85
PSM	ISAEGGEQVER	3366	sp|Q9BQE5|APOL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3534	4.614	2	1173.5626	1173.5626	R	V	249	260
PSM	KAEEELGELEAK	3367	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7277	8.1985	2	1344.6773	1344.6773	R	L	684	696
PSM	KEDEVEEWQHR	3368	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3836	4.8953	4	1483.6692	1483.6692	R	A	438	449
PSM	KFEEETVK	3369	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2545	3.7913	2	1008.5128	1008.5128	R	S	275	283
PSM	KPPTDEELK	3370	sp|P35659-2|DEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2548	3.7933	3	1055.5499	1055.5499	K	E	284	293
PSM	KQEEEEMDFR	3371	sp|P31749-2|AKT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4907	5.8536	3	1339.5714	1339.5714	K	S	50	60
PSM	KQEETAVLEEDSADWEK	3372	sp|Q96A49|SYAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15640	16.11	3	2005.9116	2005.9116	K	E	302	319
PSM	LDQEVAEVDK	3373	sp|Q99816-2|TS101_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6048	7.0433	2	1144.5612	1144.5612	R	N	172	182
PSM	LEDGDIEEAPGAGGRR	3374	sp|Q9Y613|FHOD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5742	6.7368	3	1640.7754	1640.7754	K	E	336	352
PSM	LESTARPSESSEEFLEEEPEQR	3375	sp|Q9Y6X4|F169A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12799	13.339	3	2578.1671	2578.1671	K	G	369	391
PSM	LEVQAEEERK	3376	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3030	4.1999	3	1229.6252	1229.6252	K	Q	177	187
PSM	LLDEEEATDNDLR	3377	sp|Q8WUM4-2|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12393	12.946	2	1531.7002	1531.7002	R	A	462	475
PSM	LNSEGMEEAR	3378	sp|P07738|PMGE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3616	4.6884	2	1134.4975	1134.4975	K	N	30	40
PSM	LNSNDEDIHTANER	3379	sp|P04424-3|ARLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2937	4.1246	3	1626.7234	1626.7234	K	R	81	95
PSM	MTDEEIMEK	3380	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35	ms_run[2]:scan=4699	5.6698	2	1140.4679	1140.4679	K	L	227	236
PSM	MTDEEIMEK	3381	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6699	7.6728	2	1124.473	1124.4730	K	L	227	236
PSM	NDDIETDINK	3382	sp|Q9UPW5-2|CBPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6371	7.3223	2	1175.5306	1175.5306	K	L	356	366
PSM	NDELNHLEEEGR	3383	sp|Q63HN8|RN213_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7376	8.2817	3	1453.6433	1453.6433	R	F	4192	4204
PSM	NEEDDMVEMEEERLR	3384	sp|P80303-2|NUCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	6-UNIMOD:35	ms_run[2]:scan=10972	11.548	2	1938.7935	1938.7935	K	M	282	297
PSM	NEEDDMVEMEEERLR	3385	sp|P80303-2|NUCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:35	ms_run[2]:scan=14846	15.273	2	1938.7935	1938.7935	K	M	282	297
PSM	NEEMEVMEVEDEGR	3386	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14865	15.291	3	1694.6764	1694.6764	K	S	161	175
PSM	NFGEEVDDESLK	3387	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12025	12.521	2	1380.6045	1380.6045	K	E	197	209
PSM	NGYEYEESTK	3388	sp|O75717-2|WDHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3427	4.5234	2	1218.5041	1218.5041	K	N	622	632
PSM	NIEEHASADVEK	3389	sp|P61006-2|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3197	4.3425	3	1340.6208	1340.6208	R	M	105	117
PSM	NIEEHASADVEK	3390	sp|P61006-2|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7710	8.5995	2	1340.6208	1340.6208	R	M	105	117
PSM	NLQPQGDEDPGK	3391	sp|Q66K14-2|TBC9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3401	4.5039	2	1296.5946	1296.5946	K	F	125	137
PSM	NVATEGTSTQK	3392	sp|Q9GZR7-2|DDX24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=1982	3.3497	2	1134.5517	1134.5517	K	E	106	117
PSM	NVPHEDICEDSDIDGDYR	3393	sp|O00629|IMA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	8-UNIMOD:4	ms_run[2]:scan=11205	11.757	3	2147.8702	2147.8702	R	V	50	68
PSM	NVSEQMTNEDK	3394	sp|Q9H9A7|RMI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3040	4.2067	2	1293.5507	1293.5507	K	S	377	388
PSM	QDNYNEEVADLK	3395	sp|Q8N3C0-3|ASCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10451	11.086	3	1436.642	1436.6420	K	I	19	31
PSM	QDWVDGEPTEAEK	3396	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9576	10.314	3	1502.6525	1502.6525	K	D	2979	2992
PSM	QEESVDPDYWEK	3397	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12954	13.49	2	1523.6416	1523.6416	K	L	1305	1317
PSM	QEETAVLEEDSADWEK	3398	sp|Q96A49|SYAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=20590	22.511	2	1877.8167	1877.8167	K	E	303	319
PSM	QEFSSDEEIK	3399	sp|Q6P4F7-3|RHGBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6173	7.1491	2	1210.5354	1210.5354	K	K	526	536
PSM	QELDENISK	3400	sp|Q7Z333-3|SETX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4798	5.7574	2	1074.5193	1074.5193	R	V	2110	2119
PSM	QEMQEVQSSR	3401	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:35	ms_run[2]:scan=2649	3.8808	2	1236.5405	1236.5405	R	S	179	189
PSM	QEMQSAGSQR	3402	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=1236	2.1991	2	1120.4931	1120.4931	K	G	183	193
PSM	QEVIGDQAEK	3403	sp|Q9HCK8-2|CHD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3498	4.5818	2	1115.5459	1115.5459	R	V	1310	1320
PSM	QGEEEDAEIIVK	3404	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11616	12.136	3	1358.6565	1358.6565	K	I	443	455
PSM	QHCTEEDEEEDEEEEEESFMTSR	3405	sp|Q9NY27-3|PP4R2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:4	ms_run[2]:scan=16118	16.609	3	2903.0505	2903.0505	R	E	238	261
PSM	QITEEDLEGK	3406	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7176	8.1108	2	1160.5561	1160.5561	R	T	87	97
PSM	QKLEEDAEMK	3407	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3184	4.3314	2	1219.5755	1219.5755	K	S	215	225
PSM	QLQEAEQEMEEMK	3408	sp|Q14789-4|GOGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13325	13.843	2	1621.6964	1621.6964	K	E	1588	1601
PSM	QLSESESSLEMDDER	3409	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=16977	17.497	2	1753.7312	1753.7312	R	Y	321	336
PSM	QPGGGQVNSSR	3410	sp|Q07352|TISB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=1300	2.2892	2	1085.5214	1085.5214	K	Y	104	115
PSM	QQEELLAEENQR	3411	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8254	9.083	3	1485.7059	1485.7059	R	L	2550	2562
PSM	QQHQEEEDILDVRDEK	3412	sp|Q5T3I0|GPTC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8438	9.2521	4	2009.929	2009.9290	R	D	383	399
PSM	QRELAEQELEK	3413	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4482	5.4843	3	1371.6994	1371.6994	R	Q	1654	1665
PSM	QTPEYQNESSR	3414	sp|P11117|PPAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2455	3.7207	2	1337.5848	1337.5848	R	N	171	182
PSM	REFLNEDDPEEK	3415	sp|Q9BWU1-2|CDK19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6077	7.0658	3	1519.6791	1519.6791	K	G	296	308
PSM	RIEDLEEER	3416	sp|Q9BWC9|CC106_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4720	5.6892	2	1187.5782	1187.5782	K	D	78	87
PSM	RNEIDAEPPAK	3417	sp|Q8TDN6|BRX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3340	4.4565	3	1238.6255	1238.6255	K	R	21	32
PSM	RTEEQEFCDLNDSK	3418	sp|Q8N5C7-2|DTWD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	8-UNIMOD:4	ms_run[2]:scan=6927	7.8856	2	1769.7526	1769.7526	K	C	93	107
PSM	RVEEELEK	3419	sp|Q9NWB6-3|ARGL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2553	3.7967	2	1030.5295	1030.5295	K	R	66	74
PSM	RVEIMEEESEQ	3420	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8432	9.2456	2	1377.6082	1377.6082	R	-	449	460
PSM	RVQSEEMLEDK	3421	sp|Q8IY37|DHX37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4156	5.1928	3	1362.6449	1362.6449	R	W	940	951
PSM	SDAEPEPGNLSEK	3422	sp|Q96FS4|SIPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5142	6.0591	2	1371.6154	1371.6154	K	V	965	978
PSM	SDMSECENDDPLLR	3423	sp|Q15058|KIF14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	6-UNIMOD:4	ms_run[2]:scan=13721	14.218	3	1679.6767	1679.6767	K	S	42	56
PSM	SEAQEEIGDLK	3424	sp|Q69YQ0-2|CYTSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8498	9.3066	2	1217.5776	1217.5776	K	R	765	776
PSM	SEEQPMDLENR	3425	sp|Q96T23-3|RSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7373	8.2794	2	1346.5772	1346.5772	K	S	3	14
PSM	SEMEVQDAELK	3426	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:35	ms_run[2]:scan=9123	9.8669	2	1293.5758	1293.5758	K	A	345	356
PSM	SENISPEEEYK	3427	sp|Q9Y2A7|NCKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6011	7.0138	2	1323.583	1323.5830	K	I	984	995
PSM	SEPEPVYIDEDK	3428	sp|O75886-2|STAM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10513	11.141	2	1419.6406	1419.6406	K	M	285	297
PSM	SETQHRGSAPHSESDLPEQEEEILGSDDDEQEDPNDYCK	3429	sp|Q96SB4-4|SRPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	38-UNIMOD:4	ms_run[2]:scan=13739	14.236	4	4471.8378	4471.8378	R	G	10	49
PSM	SGCSDLEEAVDSGADK	3430	sp|Q92538-3|GBF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:4	ms_run[2]:scan=11088	11.651	3	1638.6679	1638.6679	K	K	659	675
PSM	SISETGDEEGLK	3431	sp|Q9ULD4|BRPF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5222	6.1304	2	1263.583	1263.5830	R	E	403	415
PSM	SLAAEEEAAR	3432	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4083	5.1273	2	1045.504	1045.5040	K	Q	1961	1971
PSM	SMYEEEINETR	3433	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	2-UNIMOD:35	ms_run[2]:scan=6641	7.6188	2	1415.5875	1415.5875	K	R	210	221
PSM	SMYEEEINETR	3434	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8794	9.5707	3	1399.5926	1399.5926	K	R	210	221
PSM	SQGSSNVAPGEK	3435	sp|Q14004-2|CDK13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=1987	3.3529	2	1159.5469	1159.5469	K	Q	1070	1082
PSM	SSFSSDPDEK	3436	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2850	4.0508	2	1097.4513	1097.4513	R	A	127	137
PSM	SSLSNEVNEK	3437	sp|Q9BZF9-2|UACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3361	4.4727	2	1105.5251	1105.5251	K	A	624	634
PSM	SSREDIGDNVAK	3438	sp|P49454|CENPF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2769	3.9806	2	1289.6212	1289.6212	K	V	1877	1889
PSM	STAELEAEELEK	3439	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11439	11.971	2	1347.6406	1347.6406	K	L	385	397
PSM	STAELEAEELEK	3440	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12309	12.853	2	1347.6406	1347.6406	K	L	385	397
PSM	STARPNGQPQASK	3441	sp|P61020-2|RAB5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=1072	1.9385	3	1340.6797	1340.6797	R	I	5	18
PSM	STARPNGQPQASK	3442	sp|P61020-2|RAB5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=1078	1.945	2	1340.6797	1340.6797	R	I	5	18
PSM	TEELEEESFPER	3443	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12065	12.577	2	1493.6522	1493.6522	K	S	487	499
PSM	TEFSTQEEEQLR	3444	sp|Q5SRE7-2|PHYD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9779	10.491	2	1495.6791	1495.6791	R	A	51	63
PSM	TELNSSAESEQPLDK	3445	sp|Q9Y5B6-3|PAXB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7028	7.9712	3	1646.7635	1646.7635	K	T	150	165
PSM	TEMIDQEEGIS	3446	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12368	12.919	2	1250.5336	1250.5336	K	-	280	291
PSM	TIDEELERDK	3447	sp|Q9Y320-2|TMX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5524	6.5074	3	1246.6041	1246.6041	K	R	107	117
PSM	TIEESEETLK	3448	sp|O95347-2|SMC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5356	6.2518	2	1177.5714	1177.5714	K	N	751	761
PSM	TKPQMQEER	3449	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=1469	2.4998	3	1145.5499	1145.5499	R	R	59	68
PSM	TLDGELDEK	3450	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6088	7.0758	2	1018.4819	1018.4819	K	Y	1689	1698
PSM	TLEEDEEELFK	3451	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=20019	21.573	2	1380.6297	1380.6297	K	M	40	51
PSM	TLSEEEIEK	3452	sp|P18440|ARY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5375	6.2698	2	1076.5237	1076.5237	K	V	257	266
PSM	TNADTDGMVK	3453	sp|P09622-2|DLDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3119	4.2741	2	1050.4652	1050.4652	K	I	332	342
PSM	TREPVTDNVEK	3454	sp|Q9Y6X9-2|MORC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2569	3.8119	3	1286.6466	1286.6466	R	F	92	103
PSM	TSNEVTVETDKK	3455	sp|Q9NRY5|F1142_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2444	3.7107	2	1349.6674	1349.6674	R	T	223	235
PSM	TSNSLTEDSK	3456	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2126	3.4597	2	1080.4935	1080.4935	K	M	859	869
PSM	TTSNNTYEVEK	3457	sp|O14802|RPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2970	4.1509	2	1284.5834	1284.5834	R	T	1246	1257
PSM	VDIDEFDENK	3458	sp|Q9BPX5|ARP5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12470	13.029	2	1222.5354	1222.5354	R	F	13	23
PSM	VEGELEEMER	3459	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8955	9.7127	2	1219.5391	1219.5391	K	K	871	881
PSM	VEIETSEEIQEK	3460	sp|Q14676-3|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9634	10.364	2	1432.6933	1432.6933	K	Q	892	904
PSM	VKAEDEALLSEEDDPIDR	3461	sp|Q04721|NOTC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15161	15.611	3	2042.9644	2042.9644	K	R	1769	1787
PSM	VLEEEEQRR	3462	sp|Q05682-6|CALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2412	3.6865	2	1186.5942	1186.5942	K	K	349	358
PSM	VQAEEEILER	3463	sp|Q5T9S5-2|CCD18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10886	11.474	2	1214.6143	1214.6143	K	N	266	276
PSM	YDDSFDDVDR	3464	sp|P53778-2|MK12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9553	10.293	2	1245.4786	1245.4786	K	T	316	326
PSM	YKLDEDEDEDDADLSK	3465	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8712	9.4958	3	1898.7905	1898.7905	K	Y	167	183
PSM	YYETPEEEREK	3466	sp|Q9Y2K7-3|KDM2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3015	4.1872	2	1471.6467	1471.6467	R	L	129	140
PSM	QQSDHDAERLR	3467	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=2546	3.791978	3	1336.6108	1336.6115	R	E	2576	2587
PSM	QEEEMMAKEEELVK	3468	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=13509	14.015645	2	1721.757344	1721.785188	R	V	843	857
PSM	QEEEMMAKEEELVK	3469	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:35	ms_run[1]:scan=8419	9.23371	3	1737.782774	1737.780103	R	V	843	857
PSM	QEEEMMAKEEELVK	3470	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:35	ms_run[1]:scan=8137	8.9839119	3	1737.780460	1737.780103	R	V	843	857
PSM	QLEEAEEEAQR	3471	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=13449	13.958146	2	1313.5723	1313.5730	R	A	1878	1889
PSM	LSVEESEAAGDGVDTK	3472	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=14033	14.510025	2	1605.738048	1605.736976	K	V	427	443
PSM	GLSEDTTEETLK	3473	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=10476	11.108825	2	1321.626385	1321.624906	K	E	578	590
PSM	NRPDYVSEEEEDDEDFETAVK	3474	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=15386	15.837232	3	2515.054049	2515.051052	K	K	2662	2683
PSM	ESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEK	3475	sp|Q969G3|SMCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:35	ms_run[1]:scan=16560	17.049712	4	4354.818498	4353.783413	K	K	368	410
PSM	QEESVDPDYWEK	3476	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=17916	18.579242	2	1506.6154	1506.6145	K	L	1305	1317
PSM	EGLELPEDEEEK	3477	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:27	ms_run[1]:scan=12919	13.449937	2	1397.6196	1397.6193	K	K	539	551
PSM	EGLELPEDEEEKK	3478	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:27	ms_run[1]:scan=13569	14.073165	2	1525.7138	1525.7143	K	K	539	552
PSM	ASNGNARPETVTNDDEEALDEETK	3479	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=9249	9.9992607	2	2606.135838	2604.142327	K	R	178	202
PSM	QLEEEQQALQK	3480	sp|P07951|TPM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=6283	7.2440924	2	1343.656971	1342.672859	K	K	38	49
PSM	FDDGDVTECK	3481	sp|Q93008|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:4	ms_run[1]:scan=5315	6.2143605	2	1184.466041	1184.465569	K	M	1900	1910
PSM	TSGRVAVEEVDEEGK	3482	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=6199	7.1723848	2	1604.769776	1603.768944	R	F	436	451
PSM	TSGRVAVEEVDEEGK	3483	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=9308	10.058425	3	1604.773531	1603.768944	R	F	436	451
PSM	EIVEVKEENIEDATEK	3484	sp|P82970|HMGN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=15136	15.584073	3	1873.917026	1873.915668	K	G	96	112
PSM	DLDDIEDENEQLK	3485	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=14438	14.884544	2	1574.693652	1574.694776	R	Q	313	326
PSM	IEELDQENEAALENGIKNEENTEPGAESSENADDPNK	3486	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=17593	18.205521	4	4041.770799	4041.768296	K	D	720	757
PSM	MTEESSDVPR	3487	sp|Q5VZK9|CARL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1	ms_run[1]:scan=10384	11.025563	2	1191.5089	1191.5072	-	E	1	11
PSM	EEDIAVLAEEK	3488	sp|Q8TAF3|WDR48_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:27	ms_run[1]:scan=19753	21.101889	2	1226.6016	1226.6025	K	I	628	639
PSM	QDWVDGEPTEAEK	3489	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=14485	14.930073	2	1485.6260	1485.6254	K	D	2979	2992
PSM	AAAPAPEEEMDECEQALAAEPK	3490	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[1]:scan=13528	14.033985	3	2372.018196	2372.014808	K	A	254	276
PSM	QNSIENDIEEK	3491	sp|Q12830|BPTF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=13341	13.857196	2	1300.5774	1300.5778	K	V	1308	1319
PSM	TGISEEAAIEENK	3492	sp|Q5UIP0|RIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=10084	10.75805	2	1389.663067	1389.662354	K	R	1935	1948
PSM	GEDLTEEEDGGIIR	3493	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=14461	14.906058	2	1531.700108	1531.700196	K	R	139	153
PSM	AKAEASSGDHPTDTEMK	3494	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	16-UNIMOD:35	ms_run[1]:scan=1483	2.5170172	4	1789.779068	1789.778858	K	E	425	442
PSM	AADEEAFEDNSEEYIRR	3495	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=11733	12.24268	2	2043.867093	2042.881742	R	D	356	373
PSM	QKLEEDAEMK	3496	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=8087	8.9397079	2	1202.5504	1202.5484	K	S	215	225
PSM	GDRSEDFGVNEDLADSDAR	3497	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=12468	13.025308	3	2067.862464	2066.877720	K	A	186	205
PSM	ETDYPAGEDLSESGQVDK	3498	sp|O60271|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=10190	10.850313	2	1938.859842	1938.833061	R	A	803	821
PSM	MEDEEVAESWEEAADSGEIDRR	3499	sp|Q7Z422|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1	ms_run[1]:scan=22397	26.357025	3	2594.0723	2594.0709	-	L	1	23
PSM	ELRDEEQTAESIK	3500	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=6113	7.0954444	3	1546.749055	1546.747481	K	N	314	327
PSM	LEGALGADTTEDGDEK	3501	sp|Q9NZM1|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=7212	8.1416803	2	1620.719558	1619.716240	K	S	1094	1110
PSM	PNATQEELK	3502	sp|P31689|DNJA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=2829	4.0318158	2	1028.515458	1028.513839	K	K	15	24
PSM	CGEDDETIPSEYR	3503	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:4	ms_run[1]:scan=10686	11.294765	2	1570.610826	1569.625317	K	L	328	341
PSM	NDFTEEEEAQVR	3504	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=11245	11.791007	2	1466.624307	1465.632117	K	K	143	155
PSM	DGQVINETSQHHDDLE	3505	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=11007	11.580469	2	1836.785314	1835.792199	R	-	451	467
PSM	QERLDFEETENK	3506	sp|Q9H0E9|BRD8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=6527	7.509028	2	1537.706746	1536.705616	K	G	482	494
PSM	DYEEVGVDSVEGEGEEEGEEY	3507	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=21169	23.641405	3	2347.901054	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	3508	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=19687	21.007879	2	2348.901420	2347.897571	K	-	431	452
PSM	EAELDVNEELDK	3509	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:27	ms_run[1]:scan=17906	18.563767	2	1384.6341	1384.6353	K	K	34	46
PSM	EKEPVVVETVEEK	3510	sp|Q8N5N7|RM50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=8604	9.3945622	2	1513.788939	1513.787555	K	K	33	46
PSM	SPSEAADEVCALEEK	3511	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:4	ms_run[1]:scan=13694	14.193454	3	1633.713835	1633.714132	R	E	219	234
PSM	EMDYETEVEMEK	3512	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:35	ms_run[1]:scan=10258	10.911448	2	1547.600783	1547.600742	R	G	678	690
PSM	QEENVDPDYWEK	3513	sp|Q12873|CHD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=17412	17.982075	2	1533.6268	1533.6254	K	L	1309	1321
PSM	MAGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQR	3514	sp|Q9H2V7|SPNS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:35	ms_run[1]:scan=9807	10.514237	4	4977.196982	4975.257775	-	I	1	50
PSM	GSGSGGSGSDSEPDSPVFEDSK	3515	sp|P36956|SRBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=8905	9.6692852	2	2083.845280	2083.845417	R	A	447	469
PSM	FVDEEDGGDGQAGPDEGEVDSCLR	3516	sp|O15511|ARPC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	22-UNIMOD:4	ms_run[1]:scan=15254	15.704496	3	2553.026672	2552.024520	K	Q	24	48
PSM	AGPGADNGEEGEIEEEMENPEMVDLPEK	3517	sp|Q13330|MTA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=21643	24.654626	3	3015.247822	3014.264492	K	L	71	99
PSM	SVTEQGAELSNEER	3518	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=5714	6.7150234	2	1547.706665	1547.706344	K	N	28	42
PSM	AELGEADEAELQR	3519	sp|Q9Y5J9|TIM8B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1	ms_run[1]:scan=16748	17.245795	3	1471.6779	1471.6785	M	L	2	15
PSM	LEEANGNTQMVEK	3520	sp|O94906|PRP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=5500	6.4855483	2	1462.663546	1461.676958	K	I	473	486
PSM	GHEDLRQDER	3521	sp|P42345|MTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1186	2.113359	2	1253.578727	1253.574876	K	V	2188	2198
PSM	DGTAPPPQSPGSPGTGQDEEWSDEESPRK	3522	sp|Q9UKS6|PACN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=9608	10.342438	3	3039.317906	3037.317331	R	A	333	362
PSM	MEGAGENAPESSSSAPGSEESARDPQVPPPEEESGDCAR	3523	sp|Q9BYX2|TBD2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,37-UNIMOD:4	ms_run[1]:scan=13601	14.10335	4	4041.6710	4041.6707	-	S	1	40
PSM	AELEGAGER	3524	sp|Q8WX92-2|NELFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1	ms_run[1]:scan=8663	9.4488789	2	972.4508	972.4507	M	G	2	11
PSM	VGGTSDVEVNEK	3525	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=13122	13.65611	2	1232.580655	1232.588461	K	K	406	418
PSM	EAEIEYRER	3526	sp|Q6PML9|ZNT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=3375	4.4842432	2	1193.567555	1193.567666	K	L	196	205
PSM	QLSESESSLEMDDER	3527	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=16917	17.43151	2	1755.736106	1753.731238	R	Y	321	336
PSM	NENGAPEDEENFEEAIK	3528	sp|Q13564|ULA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=15385	15.836472	3	1934.801887	1933.817745	K	N	254	271
PSM	YDYEEVEAEGANK	3529	sp|P36871|PGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=9860	10.561954	2	1515.637271	1515.636533	R	M	428	441
PSM	DCDLQEDACYNCGR	3530	sp|P62633|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=8042	8.8977871	2	1774.634627	1774.634519	K	G	66	80
PSM	ADLEEQLSDEEK	3531	sp|P47755|CAZA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1	ms_run[1]:scan=19249	20.327986	2	1447.6362	1446.6352	M	V	2	14
PSM	IETNENNLESAK	3532	sp|Q07065|CKAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=5981	6.9861735	2	1361.630668	1360.647038	K	G	567	579
PSM	VLQSDEYEEVEDK	3533	sp|O15397|IPO8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=9863	10.564265	2	1581.705136	1581.704613	K	T	592	605
PSM	ELDVEEAHAASTEEK	3534	sp|Q96C86|DCPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=6918	7.8770281	2	1657.765394	1656.747875	R	E	14	29
PSM	QLAEQEELER	3535	sp|Q9UH65|SWP70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=6409	7.3701718	2	1243.601998	1243.604445	K	Q	330	340
PSM	RNEIDAEPPAK	3536	sp|Q8TDN6|BRX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=3318	4.4392431	3	1238.626267	1238.625515	K	R	21	32
PSM	EVLEDFAEDGEK	3537	sp|O60313|OPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:27	ms_run[1]:scan=20508	22.369818	2	1361.5971	1361.5982	K	K	912	924
PSM	QDAQDLYEAGEK	3538	sp|P09525|ANXA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=12926	13.457141	2	1348.5992	1348.5782	R	K	173	185
PSM	EAALAEVADEK	3539	sp|Q15003|CND2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:27	ms_run[1]:scan=16327	16.807382	2	1126.5500	1126.5501	K	M	675	686
PSM	MEQEPQNGEPAEIK	3540	sp|Q8N0X7|SPART_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1	ms_run[1]:scan=12927	13.457804	2	1642.7312	1640.7342	-	I	1	15
PSM	TATPQQAQEVHEK	3541	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=2410	3.6830782	2	1466.700676	1465.716121	K	L	213	226
PSM	MTSEVIEDEK	3542	sp|Q9BV86|NTM1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=9069	9.8127103	2	1237.5370	1237.5379	-	Q	1	11
PSM	SLEQEEETQPGR	3543	sp|Q6P4A7|SFXN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1	ms_run[1]:scan=8940	9.6994475	2	1443.6469	1443.6472	M	L	2	14
PSM	LNSEGMEEAR	3544	sp|P07738|PMGE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=3675	4.7472807	2	1134.498183	1134.497537	K	N	30	40
PSM	MEDPNPEENMK	3545	sp|Q9H609|ZN576_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1	ms_run[1]:scan=11894	12.385593	2	1374.5435	1374.5426	-	Q	1	12
PSM	EVDEGAWETK	3546	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:27	ms_run[1]:scan=13709	14.208748	2	1144.5028	1144.5031	K	I	186	196
PSM	DYPSNEDLHER	3547	sp|P49815|TSC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0		ms_run[1]:scan=4102	5.1452245	2	1373.5851	1373.5842	K	L	129	140
PSM	QAEVANQETK	3548	sp|P05114|HMGN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=4233	5.2606914	2	1099.5142	1099.5140	K	E	62	72
PSM	SPGDLTAEEK	3549	sp|O94761|RECQ4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=3898	4.9558017	2	1045.480679	1045.492769	R	D	1039	1049
PSM	QVTDAETKPK	3550	sp|O43684|BUB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=3239	4.3751764	2	1098.5555	1098.5552	R	S	315	325
PSM	ALDREEEAELR	3551	sp|Q9UN66|PCDB8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=4885	5.8364459	3	1330.656212	1329.652458	K	L	200	211
PSM	MKEQEDLAK	3552	sp|Q9NP61|ARFG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:35	ms_run[1]:scan=1289	2.2680754	2	1106.529650	1106.527775	K	V	255	264
PSM	TRITEEQDK	3553	sp|Q8IVF2|AHNK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=667	1.1473752	2	1118.554662	1118.556767	R	G	563	572
PSM	TNQELQEINR	3554	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=5630	6.643245	2	1244.596502	1243.615679	R	V	136	146
PSM	SEQAVAQLEEEK	3555	sp|Q9H0B6|KLC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=7973	8.8325014	3	1359.655447	1359.651789	R	Q	123	135
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	3556	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	23-UNIMOD:35	ms_run[1]:scan=12418	12.970518	3	3593.475959	3590.482301	K	A	737	771
PSM	GGTVADLDEQDEETVTAGGKEDEDPAK	3557	sp|Q92922|SMRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=16896	17.411672	3	2775.201900	2775.220637	K	G	402	429
PSM	AADQTTAEQGMR	3558	sp|Q92805|GOGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2652	3.883	2	1277.567	1277.5670	R	Q	427	439
PSM	AAELTATQVEEEEEEEDFRK	3559	sp|O75717-2|WDHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17214	17.751	3	2352.0605	2352.0605	K	K	697	717
PSM	AAVELEEPEDAR	3560	sp|O94906-2|PRP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9403	10.158	2	1327.6256	1327.6256	K	I	409	421
PSM	ADAEENLEDAMEEVR	3561	sp|Q68DH5|LMBD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=19981	21.496	3	1719.7258	1719.7258	K	K	238	253
PSM	AEEDEILNR	3562	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7352	8.2599	2	1087.5146	1087.5146	K	S	466	475
PSM	AEELLAEEK	3563	sp|O00429-4|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6951	7.9073	2	1030.5183	1030.5183	K	S	561	570
PSM	AELDNELMEGK	3564	sp|Q13523|PRP4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	8-UNIMOD:35	ms_run[2]:scan=7454	8.3515	2	1263.5653	1263.5653	K	V	118	129
PSM	AESTPEIAEQR	3565	sp|Q13098-5|CSN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4878	5.8319	2	1229.5888	1229.5888	K	G	221	232
PSM	AGNGTLENQK	3566	sp|O94916-2|NFAT5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=230	0.27849	2	1030.5043	1030.5043	K	G	174	184
PSM	AHEAQDAGYR	3567	sp|P16298-2|PP2BB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=642	1.0945	2	1116.4948	1116.4948	R	M	307	317
PSM	AMDEEIVSEK	3568	sp|Q92581|SL9A6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7452	8.35	2	1149.5224	1149.5224	R	Q	52	62
PSM	APIDTSDVEEK	3569	sp|Q06265-3|EXOS9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6110	7.0935	2	1202.5667	1202.5667	K	A	217	228
PSM	AQHEDQVEQYK	3570	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2399	3.6759	3	1373.6212	1373.6212	R	K	250	261
PSM	ARQELQEAK	3571	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=98	0.088435	2	1071.5673	1071.5673	K	E	845	854
PSM	ATISDEEIER	3572	sp|Q9UQN3-2|CHM2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6442	7.415	2	1161.5513	1161.5513	K	Q	155	165
PSM	AVEPQLQEEER	3573	sp|P55058-3|PLTP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6280	7.2421	2	1326.6416	1326.6416	R	M	157	168
PSM	AYEKPPEK	3574	sp|Q12905|ILF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=1934	3.3137	2	960.49165	960.4916	K	K	357	365
PSM	CDMEDERVVSSER	3575	sp|P20336|RAB3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:4	ms_run[2]:scan=4860	5.8145	3	1610.6665	1610.6665	K	G	137	150
PSM	CEEEAAVQPHSR	3576	sp|Q9UPQ0-9|LIMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:4	ms_run[2]:scan=2387	3.6658	2	1411.615	1411.6150	R	A	167	179
PSM	CPEILSDESSSDEDEK	3577	sp|P35659-2|DEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:4	ms_run[2]:scan=17304	17.855	2	1838.7364	1838.7364	K	K	188	204
PSM	DADDAVYELDGK	3578	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11681	12.196	3	1309.5674	1309.5674	R	E	49	61
PSM	DADDAVYELDGK	3579	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13271	13.792	3	1309.5674	1309.5674	R	E	49	61
PSM	DDDDVVIGK	3580	sp|O15144|ARPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6543	7.5249	2	974.45566	974.4557	K	V	171	180
PSM	DDDGGEDDDANCNLICGDEYGPETR	3581	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	12-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=15801	16.277	4	2801.0301	2801.0301	K	L	597	622
PSM	DDEDTREALVK	3582	sp|Q9NYB0|TE2IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4615	5.6001	3	1289.6099	1289.6099	K	K	373	384
PSM	DDETMYVESKK	3583	sp|O15144|ARPC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4553	5.5485	3	1343.5915	1343.5915	R	D	148	159
PSM	DEEQAALGQK	3584	sp|Q1ED39|KNOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3799	4.8602	2	1087.5146	1087.5146	K	R	190	200
PSM	DEFTNTCPSDK	3585	sp|Q9Y696|CLIC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	7-UNIMOD:4	ms_run[2]:scan=4837	5.7936	2	1312.5241	1312.5241	R	E	228	239
PSM	DETTCISQDTR	3586	sp|Q8IYB7-4|DI3L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	5-UNIMOD:4	ms_run[2]:scan=4637	5.6174	2	1324.5565	1324.5565	K	A	212	223
PSM	DGQVINETSQHHDDLE	3587	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11451	11.98	3	1835.7922	1835.7922	R	-	451	467
PSM	DGQVINETSQHHDDLE	3588	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10332	10.977	2	1835.7922	1835.7922	R	-	451	467
PSM	DGQVINETSQHHDDLE	3589	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5977	6.9833	2	1835.7922	1835.7922	R	-	451	467
PSM	DGQVINETSQHHDDLE	3590	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12007	12.5	3	1835.7922	1835.7922	R	-	451	467
PSM	DGTSPEEEIEIER	3591	sp|Q9H501|ESF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14498	14.942	2	1502.6736	1502.6736	K	Q	691	704
PSM	DHANEELDELK	3592	sp|Q14789-4|GOGB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7297	8.2143	3	1311.5943	1311.5943	R	R	2673	2684
PSM	DHVDELEPER	3593	sp|O95613|PCNT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4862	5.816	2	1237.5575	1237.5575	K	H	576	586
PSM	DIQEDSGMEPR	3594	sp|O75844|FACE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	8-UNIMOD:35	ms_run[2]:scan=3618	4.6899	2	1291.535	1291.5350	K	N	293	304
PSM	DIQEDSGMEPR	3595	sp|O75844|FACE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6311	7.266	3	1275.5401	1275.5401	K	N	293	304
PSM	DKEGEALEVK	3596	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3857	4.9146	3	1116.5663	1116.5663	K	E	284	294
PSM	DLDQCRDGK	3597	sp|P60903|S10AA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	5-UNIMOD:4	ms_run[2]:scan=1226	2.1858	2	1105.4822	1105.4822	K	V	58	67
PSM	DLRNDEHTR	3598	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=491	0.79916	3	1154.5428	1154.5428	K	R	120	129
PSM	DLRNDEHTR	3599	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=492	0.80102	1	1154.5428	1154.5428	K	R	120	129
PSM	DRCTLAEK	3600	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:4	ms_run[2]:scan=1711	2.9442	2	991.47568	991.4757	K	L	145	153
PSM	DRLDYEDK	3601	sp|Q86W92-3|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3075	4.2374	2	1052.4775	1052.4775	K	F	36	44
PSM	DSDEATEDFMR	3602	sp|Q16877-2|F264_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11467	11.994	2	1314.5034	1314.5034	R	R	183	194
PSM	DSEAWVPDSEER	3603	sp|Q96F63|CCD97_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11596	12.115	2	1418.595	1418.5950	K	L	267	279
PSM	DSEQVAELK	3604	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5417	6.313	2	1017.4979	1017.4979	R	Q	783	792
PSM	DSYVGDEAQSK	3605	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3527	4.6089	3	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3606	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4027	5.0683	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3607	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18235	18.973	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3608	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20303	22.002	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3609	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=21797	25.027	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3610	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10425	11.065	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3611	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11028	11.598	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3612	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14079	14.555	2	1197.515	1197.5150	K	R	51	62
PSM	DTLEGAGDTSEVMDTQAGSVDEENGR	3613	sp|Q9UBL3|ASH2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14612	15.05	3	2682.1199	2682.1199	K	Q	83	109
PSM	DYIEEEVIDEK	3614	sp|Q15042-4|RB3GP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16174	16.661	2	1380.6297	1380.6297	R	G	662	673
PSM	EAAGEGPALYEDPPDQK	3615	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10495	11.125	3	1785.8057	1785.8057	K	T	36	53
PSM	EAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEER	3616	sp|O60936|NOL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=21620	24.605	5	4477.9133	4477.9133	K	D	164	203
PSM	EAQLEAEVK	3617	sp|Q9HD26-3|GOPC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5372	6.2656	2	1015.5186	1015.5186	K	L	172	181
PSM	ECEEDNPVIR	3618	sp|Q9NQT8|KI13B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	2-UNIMOD:4	ms_run[2]:scan=6082	7.0695	2	1259.5452	1259.5452	K	S	772	782
PSM	EDQTEYLEERR	3619	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5136	6.0548	3	1466.6638	1466.6638	K	I	192	203
PSM	EDQTEYLEERR	3620	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5660	6.6696	3	1466.6638	1466.6638	K	I	192	203
PSM	EEAEEEIDFEK	3621	sp|Q15477|SKIV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11435	11.966	2	1366.5776	1366.5776	R	D	171	182
PSM	EEAEIQAELER	3622	sp|Q9UKI8-3|TLK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12275	12.821	2	1315.6256	1315.6256	K	L	196	207
PSM	EEAEIQAELER	3623	sp|Q9UKI8-3|TLK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13360	13.876	2	1315.6256	1315.6256	K	L	196	207
PSM	EEESQQQAVLEQERR	3624	sp|Q9UM54-5|MYO6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4636	5.6167	3	1857.8817	1857.8817	K	D	994	1009
PSM	EEIKDDNPHLK	3625	sp|Q9HAV7|GRPE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2677	3.9053	3	1336.6623	1336.6623	K	N	128	139
PSM	EENQAGPEATTSDPQDLDMK	3626	sp|O75781-2|PALM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10505	11.133	3	2174.9274	2174.9274	R	K	314	334
PSM	EEPADFPVEQPEEN	3627	sp|Q5BKZ1-3|ZN326_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15992	16.48	2	1628.6842	1628.6842	K	-	363	377
PSM	EETNEIQVVNEEPQRDR	3628	sp|Q8NBJ4-2|GOLM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8248	9.0784	3	2083.977	2083.9770	K	L	243	260
PSM	EFETIERDER	3629	sp|Q10570|CPSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5338	6.2347	3	1322.6103	1322.6103	K	Y	1056	1066
PSM	EGLELPEDEEEK	3630	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11934	12.42	3	1415.6304	1415.6304	K	K	547	559
PSM	EHEEAVSVDR	3631	sp|Q13126-4|MTAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2600	3.8359	2	1169.5313	1169.5313	K	V	226	236
PSM	EHLEEEIK	3632	sp|Q15643-2|TRIPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3784	4.8451	2	1025.5029	1025.5029	K	H	877	885
PSM	EIPEDVDMEEEK	3633	sp|Q8IWA0|WDR75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11076	11.64	2	1461.6181	1461.6181	K	E	766	778
PSM	EKEPVVVETVEEK	3634	sp|Q8N5N7-2|RM50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9441	10.189	3	1513.7876	1513.7876	K	K	33	46
PSM	ELEIESQTEEQPTTK	3635	sp|Q9NYH9|UTP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9471	10.216	3	1760.8316	1760.8316	R	Q	281	296
PSM	ELEQGEPLEK	3636	sp|Q9BQL6-4|FERM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6022	7.0238	2	1170.5768	1170.5768	K	L	408	418
PSM	ELNEDKLEK	3637	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3126	4.2787	2	1116.5663	1116.5663	R	L	222	231
PSM	EMDDGLAEGGPQR	3638	sp|Q96GY3|LIN37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7129	8.0661	2	1373.5881	1373.5881	R	S	79	92
PSM	EMDYETEVEMEK	3639	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13951	14.433	2	1531.6058	1531.6058	R	G	678	690
PSM	EMFEDTVEER	3640	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11277	11.821	2	1283.534	1283.5340	K	V	5	15
PSM	EMFEDTVEER	3641	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11829	12.329	2	1283.534	1283.5340	K	V	5	15
PSM	ENESLTHSTDR	3642	sp|Q8WX93-4|PALLD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2172	3.4953	2	1287.5691	1287.5691	K	V	559	570
PSM	EPVVVETVEEK	3643	sp|Q8N5N7-2|RM50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11216	11.765	2	1256.65	1256.6500	K	K	35	46
PSM	EQERPPEAVSK	3644	sp|Q9H0G5|NSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2467	3.7287	3	1268.6361	1268.6361	K	F	512	523
PSM	EQLMREEAEQK	3645	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3118	4.2735	3	1389.6558	1389.6558	R	R	134	145
PSM	EREALEAAR	3646	sp|Q13459-2|MYO9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2478	3.7388	2	1043.536	1043.5360	K	A	1058	1067
PSM	ERIVEEANK	3647	sp|P30519-2|HMOX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2292	3.5916	2	1086.5669	1086.5669	K	A	188	197
PSM	ERIVEEANK	3648	sp|P30519-2|HMOX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2302	3.5989	3	1086.5669	1086.5669	K	A	188	197
PSM	ERPPEEVAAR	3649	sp|Q16891-2|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2662	3.8923	3	1152.5887	1152.5887	R	L	185	195
PSM	ERVEELEHR	3650	sp|Q08379|GOGA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2541	3.7887	3	1195.5945	1195.5945	K	C	824	833
PSM	ESAVASTEVK	3651	sp|P56524-2|HDAC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3097	4.2546	2	1019.5135	1019.5135	K	M	46	56
PSM	ESVPLDDQEK	3652	sp|Q96S52-2|PIGS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5341	6.237	2	1158.5404	1158.5404	R	L	64	74
PSM	ETEDEEERNVFK	3653	sp|Q9BSH4|TACO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5502	6.487	3	1523.674	1523.6740	K	F	220	232
PSM	ETVEEQVSTTER	3654	sp|Q13619-2|CUL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5708	6.7087	3	1406.6525	1406.6525	K	V	576	588
PSM	EVEVEVESMDK	3655	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12577	13.131	2	1292.5806	1292.5806	R	A	593	604
PSM	EVLEDFAEDGEK	3656	sp|O60313-13|OPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14477	14.922	3	1379.6093	1379.6093	K	K	876	888
PSM	EVQQGEEFERR	3657	sp|P00568|KAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3314	4.4366	3	1405.6586	1405.6586	R	I	98	109
PSM	GAEETSWSGEER	3658	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4920	5.8652	2	1336.5531	1336.5531	K	A	958	970
PSM	GDAMIMEETGK	3659	sp|Q9UQ80|PA2G4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	6-UNIMOD:35	ms_run[2]:scan=4992	5.9266	2	1196.5053	1196.5053	K	I	52	63
PSM	GFSESERNK	3660	sp|Q7L1Q6-2|BZW1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=27	0.029302	2	1052.4887	1052.4887	K	L	141	150
PSM	GGAEQFMEETER	3661	sp|Q99832-2|TCPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	7-UNIMOD:35	ms_run[2]:scan=5241	6.1464	2	1398.5722	1398.5722	R	S	172	184
PSM	GGTVADLDEQDEETVTAGGKEDEDPAK	3662	sp|Q92922|SMRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14501	14.946	3	2775.2206	2775.2206	K	G	402	429
PSM	GIDEDDLLEDK	3663	sp|O75486|SUPT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14627	15.063	2	1260.5721	1260.5721	K	L	113	124
PSM	GIMEEDEACGR	3664	sp|P14923|PLAK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	9-UNIMOD:4	ms_run[2]:scan=5693	6.698	2	1265.5016	1265.5016	K	Q	41	52
PSM	GLEEPEMDPK	3665	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8417	9.2323	1	1143.5118	1143.5118	K	S	497	507
PSM	HAGSCAGTPEEPPGGESAEEEENFV	3666	sp|O95633-2|FSTL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	5-UNIMOD:4	ms_run[2]:scan=14290	14.75	2	2586.0453	2586.0453	R	-	213	238
PSM	HIAEEADR	3667	sp|P06753|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=400	0.63091	2	939.44101	939.4410	K	K	154	162
PSM	HNLCGETEEEK	3668	sp|Q03013-2|GSTM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	4-UNIMOD:4	ms_run[2]:scan=2176	3.4982	3	1344.5616	1344.5616	K	I	84	95
PSM	HQEAMDVK	3669	sp|Q9H2F5|EPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=1577	2.6582	2	956.43857	956.4386	K	E	312	320
PSM	HTFEEAEK	3670	sp|P42345|MTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2144	3.4741	2	989.44543	989.4454	R	G	236	244
PSM	KEEMPATK	3671	sp|P49790-2|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=984	1.8084	2	932.46372	932.4637	K	G	1030	1038
PSM	KLQGEVEK	3672	sp|O15212|PFD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=913	1.6863	2	929.5182	929.5182	K	Y	8	16
PSM	KQDADSLQR	3673	sp|P14324-2|FPPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=231	0.27923	2	1059.5309	1059.5309	R	A	76	85
PSM	KQEIVAEK	3674	sp|Q9ULV4|COR1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=1409	2.4342	2	943.53385	943.5338	R	E	205	213
PSM	KVEEVLEEEEEEYVVEK	3675	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=21117	23.52	3	2108.0049	2108.0049	K	V	9	26
PSM	LAGEELAGEEAPQEK	3676	sp|Q7Z4V5-2|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9311	10.063	2	1569.7522	1569.7522	K	A	575	590
PSM	LDEGTPPEPK	3677	sp|Q9Y4G6|TLN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4621	5.6041	2	1081.5292	1081.5292	K	G	1839	1849
PSM	LDGLDEDGEK	3678	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5634	6.6461	2	1089.4826	1089.4826	K	E	98	108
PSM	LEAIEDDSVK	3679	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7907	8.7738	2	1117.5503	1117.5503	K	E	180	190
PSM	LEEREAELK	3680	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3205	4.3479	3	1115.5823	1115.5823	R	K	145	154
PSM	LEPNLGEDDEDK	3681	sp|Q92797|SYMPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7386	8.2893	2	1372.5994	1372.5994	K	D	362	374
PSM	LEVAEAEEEETSIK	3682	sp|O15213|WDR46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12766	13.308	3	1575.7516	1575.7516	R	A	132	146
PSM	LEVAEAEEEETSIK	3683	sp|O15213|WDR46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13937	14.42	3	1575.7516	1575.7516	R	A	132	146
PSM	LGQDEDMDVK	3684	sp|P30154-5|2AAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5392	6.2883	2	1148.502	1148.5020	K	Y	452	462
PSM	LLAEEEEEEK	3685	sp|Q8IYW5|RN168_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5024	5.9531	2	1217.5663	1217.5663	R	R	149	159
PSM	LSVEESEAAGDGVDTK	3686	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14834	15.261	2	1605.737	1605.7370	K	V	427	443
PSM	LTAEEMDEQR	3687	sp|Q86VI3|IQGA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4980	5.914	2	1220.5343	1220.5343	R	R	16	26
PSM	MEEEERLAEQQR	3688	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:35	ms_run[2]:scan=3021	4.1917	2	1562.6995	1562.6995	R	A	1312	1324
PSM	MPEEEDEAPVLDVR	3689	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:35	ms_run[2]:scan=14401	14.85	3	1643.7349	1643.7349	K	Y	467	481
PSM	NADEVELK	3690	sp|Q99715-2|COCA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4714	5.6828	1	916.45018	916.4502	K	M	173	181
PSM	NDVIEEDLAK	3691	sp|Q58A45-2|PAN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11477	12.002	2	1144.5612	1144.5612	R	E	452	462
PSM	NEEAADEVFK	3692	sp|P00519|ABL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8320	9.1436	2	1150.5142	1150.5142	K	D	790	800
PSM	NEIDNYEEDYQK	3693	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9110	9.8552	3	1558.6423	1558.6423	K	M	1096	1108
PSM	NELQEPCDSPK	3694	sp|O94913|PCF11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	7-UNIMOD:4	ms_run[2]:scan=4391	5.3947	2	1315.5714	1315.5714	K	V	1512	1523
PSM	NQPEVDMSDR	3695	sp|Q15404|RSU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4789	5.7513	2	1189.5034	1189.5034	K	G	16	26
PSM	NSPQEEVELK	3696	sp|Q99933-3|BAG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6547	7.5298	2	1171.5721	1171.5721	K	K	151	161
PSM	PEPVLEETAPEDAQK	3697	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10680	11.29	3	1651.7941	1651.7941	K	S	215	230
PSM	QDENDDDDDWNPCK	3698	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	13-UNIMOD:4	ms_run[2]:scan=12264	12.808	2	1764.6169	1764.6169	K	A	188	202
PSM	QEDEWDKPR	3699	sp|P13674-3|P4HA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3222	4.3616	2	1201.5364	1201.5364	K	I	328	337
PSM	QEEEMMAKEEELVK	3700	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13218	13.743	3	1721.7852	1721.7852	R	V	843	857
PSM	QELEREEEALASK	3701	sp|P53814-5|SMTN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7525	8.4265	2	1530.7526	1530.7526	R	R	40	53
PSM	QGEEEDAEIIVK	3702	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17243	17.783	2	1358.6565	1358.6565	K	I	443	455
PSM	QGVAEAAGK	3703	sp|P37840-2|SYUA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=1457	2.4859	2	829.42938	829.4294	K	T	24	33
PSM	QNVAEVESSK	3704	sp|Q8NEF9|SRFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2786	3.9947	2	1089.5302	1089.5302	R	N	128	138
PSM	QREDQEQLQEEIK	3705	sp|Q99996-5|AKAP9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5880	6.8866	3	1671.8064	1671.8064	R	R	1631	1644
PSM	QREEMLEK	3706	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2443	3.7099	3	1061.5175	1061.5175	K	H	187	195
PSM	QRQQQQEALR	3707	sp|Q6Y7W6-4|GGYF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=967	1.7846	3	1283.6694	1283.6694	R	R	892	902
PSM	RDPEDSDVFEEDTHL	3708	sp|Q9NZ53-2|PDXL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15792	16.263	3	1802.7595	1802.7595	K	-	515	530
PSM	RESGEEFR	3709	sp|P30533|AMRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=1617	2.7377	2	1008.4625	1008.4625	K	M	48	56
PSM	RPAEDMEEEQAFK	3710	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6893	7.8543	3	1578.6984	1578.6984	K	R	22	35
PSM	RPANSGELDK	3711	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=419	0.66603	2	1085.5465	1085.5465	K	M	1201	1211
PSM	RPDEEPMEEEPPL	3712	sp|P56524-2|HDAC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14763	15.192	2	1566.6872	1566.6872	K	-	960	973
PSM	RQDPGDNWEEGGGGGGGMEK	3713	sp|Q9UKY7-3|CDV3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	18-UNIMOD:35	ms_run[2]:scan=3741	4.8091	2	2047.829	2047.8290	K	S	15	35
PSM	SAFEEEGK	3714	sp|Q15042-4|RB3GP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2712	3.9338	1	895.39233	895.3923	R	E	304	312
PSM	SAVEDEGLK	3715	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3732	4.8024	2	946.46074	946.4607	K	G	496	505
PSM	SDDDTWIER	3716	sp|Q6ZS30-1|NBEL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9892	10.59	2	1135.4782	1135.4782	K	G	1459	1468
PSM	SDIVDSLDEDR	3717	sp|Q8IY33-3|MILK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13713	14.212	2	1262.5626	1262.5626	R	L	441	452
PSM	SEGSEYEEIPK	3718	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7668	8.5619	2	1266.5616	1266.5616	R	R	1089	1100
PSM	SEMEVQDAELK	3719	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8548	9.3471	2	1277.5809	1277.5809	K	A	345	356
PSM	SEMEVQDAELK	3720	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9106	9.8504	2	1277.5809	1277.5809	K	A	345	356
PSM	SEMEVQDAELK	3721	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9620	10.353	2	1277.5809	1277.5809	K	A	345	356
PSM	SEMEVQDAELK	3722	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10196	10.857	2	1277.5809	1277.5809	K	A	345	356
PSM	SEMEVQDAELK	3723	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10869	11.457	2	1277.5809	1277.5809	K	A	345	356
PSM	SFANEEGEAQK	3724	sp|Q03518|TAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3070	4.2341	2	1208.5309	1208.5309	R	F	439	450
PSM	SGQEASIGK	3725	sp|Q69YN2-3|C19L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=1731	2.9772	2	875.43486	875.4349	K	Q	132	141
PSM	SIDDEVVEQR	3726	sp|P54646|AAPK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7646	8.5433	2	1188.5622	1188.5622	K	S	471	481
PSM	SKHEEEEWTDDDLVESL	3727	sp|P51946|CCNH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20044	21.614	2	2059.8858	2059.8858	K	-	307	324
PSM	SLEEQDQETLR	3728	sp|P48681|NEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5774	6.773	2	1346.6314	1346.6314	R	T	746	757
PSM	SMSDPDQDFDK	3729	sp|Q9Y5S2|MRCKB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7008	7.9545	2	1283.4976	1283.4976	R	E	1657	1668
PSM	SMYEEEINETR	3730	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	2-UNIMOD:35	ms_run[2]:scan=8815	9.5881	2	1415.5875	1415.5875	K	R	210	221
PSM	SSGSHRDVEDEELTR	3731	sp|Q8IUH3-2|RBM45_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2783	3.9926	2	1715.7711	1715.7711	R	I	108	123
PSM	STTQELMEDDR	3732	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6537	7.5204	2	1323.5613	1323.5613	R	V	2205	2216
PSM	SVTEQGAELSNEER	3733	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8848	9.6169	2	1547.7063	1547.7063	K	N	28	42
PSM	TEDEVLTSK	3734	sp|Q9BQ61|TRIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4247	5.275	2	1020.4975	1020.4975	K	G	138	147
PSM	TGPSAAQAGK	3735	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=367	0.57161	2	886.45084	886.4508	K	Q	842	852
PSM	TGYTPDEK	3736	sp|O95139-2|NDUB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2540	3.7881	1	909.40798	909.4080	M	L	2	10
PSM	TIQGDEEDLR	3737	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5344	6.2391	2	1174.5466	1174.5466	K	-	286	296
PSM	TLEEDEEELFK	3738	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18318	19.063	3	1380.6297	1380.6297	K	M	40	51
PSM	TVNEDVEEMEIDEQTK	3739	sp|Q9NRL2-2|BAZ1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14736	15.168	2	1907.8306	1907.8306	K	V	998	1014
PSM	TYTEEELNAK	3740	sp|Q7RTP6|MICA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5043	5.9687	2	1196.5561	1196.5561	R	L	1818	1828
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	3741	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14487	14.932	3	3368.4764	3368.4764	K	E	312	341
PSM	VDVADQAQDK	3742	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3145	4.2978	2	1087.5146	1087.5146	R	D	129	139
PSM	VEAIDVEEAK	3743	sp|P33991|MCM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8418	9.233	2	1101.5554	1101.5554	K	R	753	763
PSM	VEEAEPEEFVVEK	3744	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14684	15.118	2	1532.7246	1532.7246	K	V	22	35
PSM	VEEAEPEEFVVEK	3745	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15072	15.508	2	1532.7246	1532.7246	K	V	22	35
PSM	VEVEEDGQLK	3746	sp|Q8NHS0|DNJB8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6623	7.6033	2	1144.5612	1144.5612	R	S	207	217
PSM	VIPEDASESEEK	3747	sp|Q9H2P0|ADNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4266	5.2927	2	1331.6093	1331.6093	K	L	915	927
PSM	VQSEEMLEDK	3748	sp|Q8IY37|DHX37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5986	6.9919	2	1206.5438	1206.5438	R	W	941	951
PSM	VVSSTSEEEEAFTEK	3749	sp|Q8N573-2|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9342	10.097	3	1670.7523	1670.7523	R	F	191	206
PSM	VVVEPPEGEEK	3750	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6561	7.5424	2	1210.6081	1210.6081	K	V	1607	1618
PSM	YQGDGIVEDEEETMENNEEK	3751	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15135	15.583	3	2356.9489	2356.9489	K	K	841	861
PSM	YTAQVDAEEK	3752	sp|O75947|ATP5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3548	4.6283	2	1152.5299	1152.5299	K	E	86	96
PSM	YTTPEDATPEPGEDPR	3753	sp|P63092-3|GNAS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8092	8.9451	3	1773.7693	1773.7693	R	V	303	319
PSM	QSSEAEIQAK	3754	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28	ms_run[1]:scan=5272	6.1753646	2	1072.5028	1072.5031	R	A	1564	1574
PSM	QQEELLAEENQR	3755	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28	ms_run[1]:scan=14807	15.231217	2	1468.6780	1468.6789	R	L	2719	2731
PSM	QQEELLAEENQR	3756	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=8611	9.4018621	2	1485.702552	1485.705950	R	L	2719	2731
PSM	ENDKTEEMPNDSVLENK	3757	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=12867	13.400445	3	1991.860661	1990.878965	K	S	486	503
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	3758	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	25-UNIMOD:35	ms_run[1]:scan=14519	14.963655	4	3790.616547	3789.614378	K	A	735	771
PSM	GLSEDTTEETLK	3759	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=8926	9.6869144	2	1321.625611	1321.624906	K	E	578	590
PSM	EDQTEYLEERR	3760	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:27	ms_run[1]:scan=5201	6.1108460000000004	3	1448.6587	1448.6527	K	V	187	198
PSM	SLEEQDQETLR	3761	sp|P48681|NEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=5991	6.9974796	2	1346.632725	1346.631388	R	T	746	757
PSM	MQMLEDEDDLAYAETEKK	3762	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:35	ms_run[1]:scan=12848	13.38406	3	2173.937273	2173.939517	K	T	4346	4364
PSM	GMVAEEIEEEPAAGDDEELEEEAVPQDESSQKK	3763	sp|O75691|UTP20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:35	ms_run[1]:scan=16304	16.785962	4	3632.572991	3632.568322	K	K	873	906
PSM	QEEEEEEELLPVNGSQEEAKPQVR	3764	sp|Q9NZ53|PDXL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28	ms_run[1]:scan=18581	19.387759	3	2779.2642	2778.2822	K	D	181	205
PSM	QLHEDEEFAR	3765	sp|P35251|RFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28	ms_run[1]:scan=10261	10.913738	2	1255.5479	1255.5464	R	T	218	228
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAKK	3766	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1	ms_run[1]:scan=20314	22.024521	4	3392.4572	3391.4692	M	D	2	34
PSM	QQNQEITDQLEEEK	3767	sp|Q08379|GOGA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28	ms_run[1]:scan=14758	15.186321	3	1713.7700	1713.7688	K	K	189	203
PSM	SGTNLDGNDEFDEQLR	3768	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1	ms_run[1]:scan=18690	19.517965	2	1851.7832	1850.7912	M	M	2	18
PSM	THVNPMDEEENEVNHVNGEQENR	3769	sp|Q8TAF3|WDR48_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=8561	9.358829	3	2721.140678	2719.152849	R	V	477	500
PSM	TTSPLEEEER	3770	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=5093	6.0152418	2	1190.541695	1189.546262	K	E	363	373
PSM	MEVAEPSSPTEEEEEEEEHSAEPRPR	3771	sp|Q9NWV8|BABA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1	ms_run[1]:scan=13622	14.123329	3	3051.2888	3051.2882	-	T	1	27
PSM	GEDLTEEEDGGIIR	3772	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=14529	14.973161	2	1531.709537	1531.700196	K	R	139	153
PSM	KPPTDEELK	3773	sp|P35659|DEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=2758	3.9710679	2	1055.550230	1055.549890	K	E	318	327
PSM	QGEEEDAEIIVK	3774	sp|Q9UHX1|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28	ms_run[1]:scan=18742	19.59964	2	1341.6299	1341.6295	K	I	503	515
PSM	QLVNGEVSDER	3775	sp|Q96T23|RSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=6243	7.2083507	2	1245.588423	1244.599694	K	V	440	451
PSM	DSYVGDEAQSK	3776	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=11739	12.249172	2	1197.515718	1197.514961	K	R	53	64
PSM	DSYVGDEAQSK	3777	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=8570	9.3651872	2	1198.517761	1197.514961	K	R	53	64
PSM	ESLTEAEVATEK	3778	sp|P18858|DNLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=8532	9.3335434	2	1305.630248	1305.629991	K	E	162	174
PSM	EVELNELEPEK	3779	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=15448	15.903297	2	1328.635021	1327.650727	K	Q	112	123
PSM	EVELNELEPEK	3780	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=12108	12.630437	2	1328.635557	1327.650727	K	Q	112	123
PSM	EVEVEVESMDK	3781	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=12678	13.225524	2	1292.581132	1292.580598	R	A	593	604
PSM	EVEVEVESMDK	3782	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:27	ms_run[1]:scan=17953	18.630029	2	1274.5680	1274.5695	R	A	593	604
PSM	SDENEDPSVVGEFK	3783	sp|Q9NZM1|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=13634	14.136421	2	1551.659363	1550.673647	K	G	1508	1522
PSM	DSGQESESIPEYTAEEER	3784	sp|Q8WUY3|PRUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=11665	12.181662	2	2054.856640	2054.855253	K	E	2859	2877
PSM	NDFTEEEEAQVRK	3785	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=14130	14.60115	2	1594.724722	1593.727080	K	E	143	156
PSM	SKSNDSEEGLEDAVEGADEALQK	3786	sp|Q9NUJ3|T11L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=19652	20.951558	3	2421.066891	2420.082687	K	A	16	39
PSM	LEVQAEEERK	3787	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=3014	4.1864326	2	1229.626265	1229.625181	K	Q	177	187
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	3788	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=13618	14.120292	4	3368.483549	3368.476411	K	E	312	341
PSM	DYEEVGVDSVEGEGEEEGEEY	3789	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=21639	24.645815	3	2347.901054	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	3790	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=20051	21.626912	3	2347.901054	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	3791	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=20903	23.133131	3	2347.901054	2347.897571	K	-	431	452
PSM	DEENHEESESLQEDMLGNR	3792	sp|Q8IX12|CCAR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=13594	14.096123	3	2259.911240	2259.918598	K	L	985	1004
PSM	ELEPEAAEEALENGPK	3793	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=16665	17.164766	3	1725.793799	1724.810475	K	E	348	364
PSM	QDAQDRLDEMDQQK	3794	sp|Q9UBC2|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=5908	6.91619	2	1718.752676	1718.752977	K	A	443	457
PSM	CEEEAQEIVR	3795	sp|Q5TKA1|LIN9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=16203	16.687228	2	1244.5332	1244.5338	R	H	435	445
PSM	DDEEMDIDTVK	3796	sp|O95149|SPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=11153	11.709734	2	1308.535921	1308.539127	K	K	82	93
PSM	MNGDQNSDVYAQEK	3797	sp|P14324-2|FPPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=3658	4.7275078	2	1655.6734	1655.6728	-	Q	1	15
PSM	MNGDQNSDVYAQEK	3798	sp|P14324-2|FPPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1	ms_run[1]:scan=9795	10.50501	2	1640.6652	1639.6782	-	Q	1	15
PSM	ALSDREEEEEDDEEEEEEVEAAAQR	3799	sp|Q8N3E9|PLCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=13240	13.763133	4	2936.203004	2935.196273	R	R	494	519
PSM	NGEPEPTPVVNGEKEPSK	3800	sp|P40222|TXLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=7038	7.98058	3	1907.913652	1906.927236	R	G	120	138
PSM	DTDLDGFPDEK	3801	sp|P49747|COMP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=12898	13.430067	2	1250.530341	1250.530277	R	L	269	280
PSM	ACIDSNEDGDLSK	3802	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:4	ms_run[1]:scan=5538	6.5199046	2	1423.578709	1422.593288	R	S	208	221
PSM	SEMEVQDAELK	3803	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=10127	10.796326	2	1277.580307	1277.580933	K	A	345	356
PSM	SEMEVQDAELK	3804	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=10358	11.002205	2	1278.576340	1277.580933	K	A	345	356
PSM	SEMEVQDAELK	3805	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=10245	10.899738	2	1278.565082	1277.580933	K	A	345	356
PSM	RDIQENDEEAVQVK	3806	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=10572	11.191321	3	1672.810560	1671.806393	K	E	33	47
PSM	RDIQENDEEAVQVK	3807	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=6686	7.6591821	3	1672.813391	1671.806393	K	E	33	47
PSM	EETNEIQVVNEEPQR	3808	sp|Q8NBJ4|GOLM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=10409	11.050367	3	1812.840805	1812.848986	K	D	253	268
PSM	AGNFDSEER	3809	sp|P46108|CRK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1	ms_run[1]:scan=7663	8.5580514	2	1065.4359	1065.4358	M	S	2	11
PSM	EVMSDLEESK	3810	sp|Q01433|AMPD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=7681	8.5736327	2	1165.516906	1165.517270	K	Y	524	534
PSM	ERPPEEVAAR	3811	sp|Q16891|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:27	ms_run[1]:scan=5184	6.0963353	2	1134.5783	1134.5776	R	L	196	206
PSM	QDENDDDDDWNPCK	3812	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28,13-UNIMOD:4	ms_run[1]:scan=12807	13.345243	2	1748.5772	1747.5902	K	A	333	347
PSM	ETEDEEERNVFK	3813	sp|Q9BSH4|TACO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=5466	6.4102649	2	1524.677952	1523.673981	K	F	220	232
PSM	ADLEEQLSDEEK	3814	sp|P47755|CAZA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1	ms_run[1]:scan=17569	18.169443	2	1446.6363	1446.6357	M	V	2	14
PSM	SEDDESGAGELTREELR	3815	sp|P33993|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=9596	10.331273	2	1891.840551	1891.839543	K	Q	309	326
PSM	QHESEEPFMPEER	3816	sp|Q9BSF0|SMAKA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28	ms_run[1]:scan=12983	13.519106	2	1626.6588	1626.6615	K	C	21	34
PSM	EAAAALVEEETR	3817	sp|O75934|SPF27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:27	ms_run[1]:scan=18336	19.086275	2	1269.6184	1269.6196	R	R	30	42
PSM	KNEEMMEQK	3818	sp|P32456|GBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1696	2.9140008	2	1165.510427	1165.510745	K	E	510	519
PSM	QLAEQEELER	3819	sp|Q9UH65|SWP70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28	ms_run[1]:scan=13902	14.387498	2	1226.5780	1226.5774	K	Q	330	340
PSM	MEEASEGGGNDRVR	3820	sp|Q9BV40|VAMP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1	ms_run[1]:scan=5517	6.5001773	3	1548.6562	1547.6632	-	N	1	15
PSM	AGQEDPVQR	3821	sp|Q8WUW1|BRK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1	ms_run[1]:scan=5310	6.2087502	2	1040.4880	1040.4882	M	E	2	11
PSM	QQQQQQNDVVK	3822	sp|Q15286|RAB35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28	ms_run[1]:scan=3820	4.8797454	2	1324.6361	1324.6366	K	L	179	190
PSM	EAAFDDAVEER	3823	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=10159	10.82473	2	1251.541993	1250.541511	K	V	5	16
PSM	DQTPDENDQVVVK	3824	sp|O00425|IF2B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=7030	7.974672	2	1486.683911	1485.694717	R	I	526	539
PSM	CNTCGEPITDR	3825	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=8532	9.3335434	2	1304.5125	1304.5120	K	M	444	455
PSM	MEEPQAGDAAR	3826	sp|O15446|RPA34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1	ms_run[1]:scan=8067	8.9206744	2	1215.5194	1215.5185	-	F	1	12
PSM	SEEPAEILPPARDEEEEEEEGMEQGLEEEEEVDPR	3827	sp|O60239|3BP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	22-UNIMOD:35	ms_run[1]:scan=16599	17.095503	4	4069.756395	4069.722985	R	I	10	45
PSM	EMDDGLAEGGPQR	3828	sp|Q96GY3|LIN37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=7137	8.0739553	2	1373.586533	1373.588143	R	S	79	92
PSM	ENLEDEYEPR	3829	sp|P49643|PRI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0		ms_run[1]:scan=9123	9.8668665	2	1293.5732	1292.5512	R	R	87	97
PSM	SENISPEEEYK	3830	sp|Q9Y2A7|NCKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=5978	6.9840382	2	1323.583271	1323.583041	K	I	984	995
PSM	MDEEIVSEK	3831	sp|Q92581-3|SL9A6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1	ms_run[1]:scan=15037	15.465334	2	1120.4947	1120.4953	-	Q	1	10
PSM	AGNGTLENQK	3832	sp|O94916|NFAT5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=222	0.26765986	2	1030.504726	1030.504337	K	G	250	260
PSM	MTTDEGAK	3833	sp|Q13451|FKBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1	ms_run[1]:scan=4432	5.4278519	1	893.3813	893.3795	-	N	1	9
PSM	KYEDEINK	3834	sp|P35908|K22E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=2486	3.7441696	2	1037.504302	1037.502940	K	R	267	275
PSM	AAGELEGGK	3835	sp|Q8N668|COMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1	ms_run[1]:scan=6985	7.9354865	2	872.4237	872.4234	M	P	2	11
PSM	AGEAGAIER	3836	sp|Q9NVN3|RIC8B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=2583	3.8238872	2	872.435240	872.435195	R	V	12	21
PSM	ADTNQLADK	3837	sp|O43493|TGON2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=2368	3.6510657	2	975.464518	974.466889	K	G	278	287
PSM	TEAAAAAPQR	3838	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=2173	3.4960385	2	985.503458	984.498858	R	S	124	134
PSM	RATVEETAR	3839	sp|Q9UK23|NAGPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=222	0.26765986	2	1031.538729	1031.535972	R	A	120	129
PSM	QLTCDLEDDSDK	3840	sp|Q8IWI9|MGAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:4	ms_run[1]:scan=7331	8.2425762	2	1438.623093	1437.592954	K	L	1292	1304
PSM	VQPPPETPAEEEMETETEAEALQEK	3841	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:35	ms_run[1]:scan=14514	14.957869	3	2830.288367	2827.259331	K	E	1076	1101
PSM	GSLGSQGAKDEPEEELQK	3842	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=5798	6.7965005	2	1903.912892	1900.901415	K	G	1406	1424
PSM	DYEEVGVDSVEGEGEEEGEEY	3843	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=20367	22.128611	3	2347.901054	2347.897571	K	-	431	452
PSM	EEEEEAAAAAAMATEGGK	3844	sp|Q02446|SP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=13971	14.451575	3	1763.752823	1763.751974	K	T	7	25
PSM	DQPPFGDSDDSVEADK	3845	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=10752	11.35418	3	1723.748036	1720.706404	K	S	488	504
PSM	AAGDEFETR	3846	sp|Q92843-2|B2CL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4018	5.0599	2	994.43559	994.4356	R	F	48	57
PSM	AALSASEGEEVPQDK	3847	sp|O95831-3|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6654	7.6321	3	1529.7209	1529.7209	K	A	109	124
PSM	AEDEEELLR	3848	sp|Q27J81-2|INF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9109	9.8546	2	1102.5142	1102.5142	K	V	253	262
PSM	AEEELGELEAK	3849	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10313	10.96	3	1216.5823	1216.5823	K	L	685	696
PSM	AEQLAAEAER	3850	sp|Q9HCS7|SYF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4099	5.141	2	1086.5306	1086.5306	R	D	776	786
PSM	AESEQEAYLRED	3851	sp|Q9NR28-2|DBLOH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7118	8.0559	2	1438.6212	1438.6212	R	-	175	187
PSM	AHEAQDAGYR	3852	sp|P16298-2|PP2BB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=379	0.59196	2	1116.4948	1116.4948	R	M	307	317
PSM	AIDCLEDEK	3853	sp|O15061|SYNEM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4	ms_run[2]:scan=6090	7.0771	2	1091.4805	1091.4805	R	A	272	281
PSM	AKAEASSGDHPTDTEMK	3854	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2025	3.3823	4	1773.7839	1773.7839	K	E	425	442
PSM	AKPEPDILEEEK	3855	sp|Q8IY95-2|TM192_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7828	8.7035	3	1396.7086	1396.7086	K	I	196	208
PSM	ANQEEDIPVK	3856	sp|Q149N8-4|SHPRH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5393	6.2889	2	1141.5615	1141.5615	K	G	1500	1510
PSM	AQMVQEDLEK	3857	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:35	ms_run[2]:scan=4317	5.3351	2	1205.5598	1205.5598	K	T	449	459
PSM	AQQLREEQQR	3858	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=1916	3.2996	2	1284.6535	1284.6535	K	Q	2495	2505
PSM	ATDLGEPER	3859	sp|Q15714-4|T22D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3525	4.6054	2	986.46689	986.4669	R	S	162	171
PSM	ATEMVEVGADDDEGGAERGEAGDLR	3860	sp|Q6NZI2|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16775	17.274	3	2548.0984	2548.0984	K	R	338	363
PSM	ATEMVEVGADDDEGGAERGEAGDLR	3861	sp|Q6NZI2|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16968	17.488	3	2548.0984	2548.0984	K	R	338	363
PSM	ATSEEDVSIK	3862	sp|Q5UIP0-2|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4410	5.4104	2	1077.519	1077.5190	K	S	1606	1616
PSM	AVDPEDDFQR	3863	sp|Q99848|EBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8261	9.0901	3	1190.5204	1190.5204	K	E	95	105
PSM	CEVTEVSK	3864	sp|O95433-2|AHSA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:4	ms_run[2]:scan=2781	3.9912	2	950.4379	950.4379	K	L	56	64
PSM	CGDLEEELK	3865	sp|P67936|TPM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:4	ms_run[2]:scan=10509	11.138	2	1091.4805	1091.4805	K	N	154	163
PSM	CGEDDETIPSEYR	3866	sp|P20810-3|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:4	ms_run[2]:scan=14397	14.847	2	1569.6253	1569.6253	K	L	210	223
PSM	DDEVQVVR	3867	sp|Q9UNX3|RL26L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5715	6.7157	2	958.47197	958.4720	K	G	52	60
PSM	DEDPYVRK	3868	sp|P63010|AP2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2587	3.8268	2	1020.4876	1020.4876	K	T	132	140
PSM	DEILDGQK	3869	sp|Q15650|TRIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5145	6.0634	1	916.45018	916.4502	K	S	90	98
PSM	DGDAEEVRELGTVEEN	3870	sp|Q14699|RFTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13629	14.129	3	1760.7701	1760.7701	R	-	563	579
PSM	DGDGTITTK	3871	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2248	3.5549	2	906.42944	906.4294	K	E	23	32
PSM	DGQVINETSQHHDDLE	3872	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12661	13.209	2	1835.7922	1835.7922	R	-	451	467
PSM	DGQVINETSQHHDDLE	3873	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12817	13.355	3	1835.7922	1835.7922	R	-	451	467
PSM	DGQVINETSQHHDDLE	3874	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14589	15.028	3	1835.7922	1835.7922	R	-	451	467
PSM	DGSPLDDKDER	3875	sp|Q9Y6N7-6|ROBO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3229	4.3662	3	1245.5473	1245.5473	K	I	168	179
PSM	DHEDYDPQTVR	3876	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4102	5.1452	2	1373.5848	1373.5848	R	L	633	644
PSM	DHNNEIVK	3877	sp|Q13576-3|IQGA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=1595	2.6899	2	967.47231	967.4723	R	I	245	253
PSM	DISDIEGEK	3878	sp|P52789|HXK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7165	8.1008	2	1004.4662	1004.4662	K	D	338	347
PSM	DIVQETQREEDHR	3879	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4154	5.1914	3	1653.7707	1653.7707	R	R	354	367
PSM	DLDDTSVVEDGRK	3880	sp|Q9Y4D7-2|PLXD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6889	7.8516	3	1447.6791	1447.6791	R	K	1622	1635
PSM	DLMESEEK	3881	sp|Q14573|ITPR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4966	5.9043	1	979.41683	979.4168	K	L	1653	1661
PSM	DLQELGDSDK	3882	sp|P32004-3|L1CAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7303	8.2188	1	1118.5091	1118.5091	R	Y	554	564
PSM	DNFDEMDTSR	3883	sp|P23258|TBG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7573	8.4716	2	1228.4666	1228.4666	K	E	416	426
PSM	DNGNIELENK	3884	sp|Q9Y5T5-5|UBP16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5336	6.2335	2	1144.536	1144.5360	K	K	153	163
PSM	DSTEVEIVDEK	3885	sp|Q659C4-4|LAR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10170	10.833	2	1262.5878	1262.5878	K	M	81	92
PSM	DSYVGDEAQSK	3886	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4765	5.7298	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3887	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5491	6.4739	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3888	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6269	7.2318	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3889	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11591	12.11	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3890	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17812	18.468	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3891	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19005	19.984	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3892	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19368	20.491	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3893	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19679	20.994	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3894	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19983	21.5	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3895	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21329	24.017	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3896	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21577	24.522	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3897	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=23713	29.643	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3898	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=23879	30.147	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3899	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=24043	30.651	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3900	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6825	7.7919	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3901	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7425	8.326	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3902	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8500	9.3081	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3903	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9182	9.9331	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3904	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9857	10.56	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3905	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13540	14.047	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3906	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14620	15.058	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3907	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15118	15.562	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3908	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15981	16.47	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3909	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16941	17.456	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	3910	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17395	17.963	2	1197.515	1197.5150	K	R	51	62
PSM	DVMEDAVEDR	3911	sp|Q15833-2|STXB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10130	10.799	2	1177.4921	1177.4921	K	L	478	488
PSM	DVTEAEQAEEQARQEEQVVR	3912	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15324	15.775	3	2343.0939	2343.0939	K	Q	634	654
PSM	DWDELEEEAR	3913	sp|Q9Y5B9|SP16H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16393	16.873	2	1290.5364	1290.5364	K	K	989	999
PSM	EAAFDDAVEER	3914	sp|Q09028-3|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7451	8.3494	2	1250.5415	1250.5415	K	V	5	16
PSM	EAFDDAVEER	3915	sp|Q09028-2|RBBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8456	9.2673	2	1179.5044	1179.5044	K	V	5	15
PSM	EAGVEMGDEDDLSTPNEK	3916	sp|P14868-2|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	6-UNIMOD:35	ms_run[2]:scan=11384	11.92	2	1950.8	1950.8000	R	L	257	275
PSM	EASQPETEGGGNSQQEPVVGDEEPALH	3917	sp|A4D2B0|MBLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12602	13.154	3	2790.2216	2790.2216	R	-	240	267
PSM	EAVVQEPER	3918	sp|Q96GQ7|DDX27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3913	4.9706	2	1055.5247	1055.5247	K	S	642	651
PSM	EDALELTEK	3919	sp|P78316-2|NOP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9815	10.522	2	1046.5132	1046.5132	R	L	212	221
PSM	EDEEEDDDVVAPKPPIEPEEEK	3920	sp|Q13409-6|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14034	14.511	4	2537.1181	2537.1181	K	T	144	166
PSM	EDGVITASEDR	3921	sp|Q8IWB7|WDFY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5093	6.0152	2	1190.5415	1190.5415	K	T	36	47
PSM	EDLQELNDR	3922	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6116	7.0976	2	1130.5204	1130.5204	K	L	33	42
PSM	EDTEEYNLR	3923	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5906	6.9147	2	1167.5044	1167.5044	K	D	113	122
PSM	EEAEVKPEVK	3924	sp|O75822-2|EIF3J_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2865	4.0638	2	1156.5976	1156.5976	K	I	61	71
PSM	EEDIAVLAEEK	3925	sp|Q8TAF3-5|WDR48_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15177	15.63	2	1244.6136	1244.6136	K	I	353	364
PSM	EEDIAVLAEEK	3926	sp|Q8TAF3-5|WDR48_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15665	16.135	2	1244.6136	1244.6136	K	I	353	364
PSM	EEGIDELAK	3927	sp|P78330|SERB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8736	9.5198	2	1002.487	1002.4870	R	I	28	37
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	3928	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=22179	25.877	3	3657.4246	3657.4246	K	R	176	207
PSM	EEQEELMDFERDEER	3929	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14972	15.397	3	1982.8164	1982.8164	R	S	576	591
PSM	EEVVKEPK	3930	sp|Q8N163-2|CCAR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2364	3.6482	2	956.51786	956.5179	K	D	592	600
PSM	EFETIERDER	3931	sp|Q10570|CPSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5584	6.5825	2	1322.6103	1322.6103	K	Y	1056	1066
PSM	EFLEDYDDDRDDPK	3932	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11043	11.611	3	1770.7221	1770.7221	K	Y	498	512
PSM	EGEDDFLEK	3933	sp|Q99707-2|METH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9716	10.437	2	1080.4611	1080.4611	K	A	476	485
PSM	EGEIQAGAK	3934	sp|Q13409-6|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2225	3.5375	2	901.45051	901.4505	K	L	230	239
PSM	EHEDYCGAR	3935	sp|O14545-2|TRAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	6-UNIMOD:4	ms_run[2]:scan=1181	2.1044	2	1135.4353	1135.4353	K	T	104	113
PSM	EHGITDDDLR	3936	sp|Q5TAX3-2|TUT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4626	5.6079	3	1169.5313	1169.5313	K	V	365	375
PSM	EHTGKPTTSSSEACR	3937	sp|O75592-2|MYCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	14-UNIMOD:4	ms_run[2]:scan=976	1.7994	2	1646.7318	1646.7318	R	F	4340	4355
PSM	EIVEMNEIEEGK	3938	sp|Q9H2G2-2|SLK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	5-UNIMOD:35	ms_run[2]:scan=8321	9.1444	2	1434.6548	1434.6548	K	N	604	616
PSM	EKEPVVVETVEEK	3939	sp|Q8N5N7-2|RM50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9133	9.8764	3	1513.7876	1513.7876	K	K	33	46
PSM	ELAEQELEK	3940	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6342	7.2947	2	1087.5397	1087.5397	R	Q	1656	1665
PSM	ELNEDVSADVEER	3941	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10682	11.292	3	1503.6689	1503.6689	R	F	878	891
PSM	ELRDEEQTAESIK	3942	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6917	7.8763	3	1546.7475	1546.7475	K	N	314	327
PSM	EMASVGEPDK	3943	sp|Q7RTP6|MICA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4088	5.1309	2	1061.4699	1061.4699	K	L	600	610
PSM	ENVEYIEREESDGEYDEFGR	3944	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15445	15.899	3	2464.0303	2464.0303	R	K	110	130
PSM	EQYEALQEETR	3945	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7142	8.0797	2	1394.6314	1394.6314	K	V	1641	1652
PSM	ERVMEIVDADEK	3946	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:35	ms_run[2]:scan=5966	6.9713	2	1448.6817	1448.6817	K	V	200	212
PSM	ESEQESEEEILAQK	3947	sp|Q9BW71|HIRP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10414	11.054	2	1647.7475	1647.7475	K	K	222	236
PSM	ESQMTIEER	3948	sp|O95425-2|SVIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4884	5.8358	2	1121.5023	1121.5023	R	K	753	762
PSM	ESSEEEYDSGVEEEGWPR	3949	sp|O76031|CLPX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15167	15.616	3	2112.8396	2112.8396	K	Q	609	627
PSM	EVEVEVESMDK	3950	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13972	14.452	2	1292.5806	1292.5806	R	A	593	604
PSM	EVLNEEDEVQPNGK	3951	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7934	8.7981	2	1598.7424	1598.7424	R	I	109	123
PSM	FQESQEEIK	3952	sp|Q02224|CENPE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4486	5.4872	2	1136.535	1136.5350	K	S	1337	1346
PSM	GAVAEDGDELRTEPEAK	3953	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5936	6.943	4	1785.8381	1785.8381	K	K	8	25
PSM	GGVITDEEETSKK	3954	sp|Q07864|DPOE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2995	4.1712	3	1391.678	1391.6780	R	I	198	211
PSM	GLSEDTTEETLK	3955	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7395	8.2999	2	1321.6249	1321.6249	K	E	578	590
PSM	GLSEDTTEETLK	3956	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9448	10.197	2	1321.6249	1321.6249	K	E	578	590
PSM	GRPLAEESEQER	3957	sp|Q8N357|S35F6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2424	3.6945	3	1399.6692	1399.6692	R	L	347	359
PSM	GRYSENDVK	3958	sp|Q9Y6W3|CAN7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=1394	2.4091	2	1066.5043	1066.5043	K	N	487	496
PSM	GSEEELADIK	3959	sp|Q8WXX5|DNJC9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8651	9.4379	2	1089.519	1089.5190	K	Q	122	132
PSM	GTGDSLRESK	3960	sp|Q05519-2|SRS11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=359	0.55676	2	1048.5149	1048.5149	K	V	459	469
PSM	HAGSCAGTPEEPPGGESAEEEENFV	3961	sp|O95633-2|FSTL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	5-UNIMOD:4	ms_run[2]:scan=14332	14.788	3	2586.0453	2586.0453	R	-	213	238
PSM	HESCGQCTPCR	3962	sp|P49821-2|NDUV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4,7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=1007	1.8391	2	1390.5176	1390.5176	K	E	367	378
PSM	HPDDEMMK	3963	sp|O75718|CRTAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2525	3.7754	2	1001.3947	1001.3947	K	R	175	183
PSM	IENHEGVR	3964	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19	0.021772	2	952.47264	952.4726	K	R	256	264
PSM	KDECEEMLK	3965	sp|P50748|KNTC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4	ms_run[2]:scan=3478	4.5656	3	1180.5104	1180.5104	K	L	977	986
PSM	LDPADPENPR	3966	sp|Q9Y6M5|ZNT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5357	6.2525	2	1122.5306	1122.5306	K	S	204	214
PSM	LDTDDLDEIEK	3967	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15139	15.588	2	1304.5984	1304.5984	R	I	357	368
PSM	LEADFETDEK	3968	sp|Q7Z3T8|ZFY16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8640	9.4277	2	1195.5245	1195.5245	K	I	1416	1426
PSM	LEELDDFEEGSQK	3969	sp|Q7Z3J2-2|VP35L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14307	14.765	3	1537.6784	1537.6784	R	E	40	53
PSM	LQEEYYEEK	3970	sp|Q86UU0-3|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5604	6.6034	2	1229.5452	1229.5452	K	R	523	532
PSM	LQVEQEENR	3971	sp|Q9H1A4|APC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3402	4.5046	2	1143.552	1143.5520	K	F	906	915
PSM	MAGDETQPTR	3972	sp|Q8WXA9|SREK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2335	3.6264	2	1104.487	1104.4870	R	F	98	108
PSM	MEADPELSK	3973	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5179	6.0926	2	1018.4641	1018.4641	K	F	350	359
PSM	MQVDQEEGHQK	3974	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2102	3.4414	2	1327.5827	1327.5827	K	C	529	540
PSM	NDQCYDDIR	3975	sp|Q9ULV4|COR1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4	ms_run[2]:scan=4927	5.872	2	1197.4721	1197.4721	K	V	20	29
PSM	NDQCYEDIR	3976	sp|Q9BR76|COR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4	ms_run[2]:scan=5197	6.108	2	1211.4877	1211.4877	K	V	22	31
PSM	NDQEPPPEALDFSDDEK	3977	sp|Q96HR8-2|NAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15747	16.217	2	1944.8225	1944.8225	K	E	303	320
PSM	NIEEHASADVEK	3978	sp|P61006-2|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4459	5.4556	3	1340.6208	1340.6208	R	M	105	117
PSM	NIEEHASADVEK	3979	sp|P61006-2|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5034	5.9623	3	1340.6208	1340.6208	R	M	105	117
PSM	NIEEHASADVEK	3980	sp|P61006-2|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6737	7.7108	2	1340.6208	1340.6208	R	M	105	117
PSM	NLDDTIDDEK	3981	sp|Q13310-2|PABP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6961	7.9143	2	1176.5146	1176.5146	K	L	300	310
PSM	NLEDDTLSECK	3982	sp|Q14966-2|ZN638_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	10-UNIMOD:4	ms_run[2]:scan=7819	8.6972	2	1322.566	1322.5660	K	Q	643	654
PSM	NMEPEQPSTSK	3983	sp|Q9NQS1|AVEN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3076	4.238	2	1246.55	1246.5500	K	N	336	347
PSM	NPAAYENDK	3984	sp|O14949|QCR8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2235	3.544	2	1020.4512	1020.4512	K	-	74	83
PSM	NSFREQLEEEEEAK	3985	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=20031	21.59	3	1736.7853	1736.7853	K	H	1339	1353
PSM	NSYATTENK	3986	sp|Q9UQB8-3|BAIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=458	0.74327	2	1026.4618	1026.4618	K	T	351	360
PSM	PDELMDSK	3987	sp|Q9P0L0|VAPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4417	5.415	2	933.41135	933.4113	K	L	118	126
PSM	QDAQDLYEAGEK	3988	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12940	13.47	2	1365.6048	1365.6048	R	K	91	103
PSM	QDNYNEEVADLK	3989	sp|Q8N3C0-3|ASCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15217	15.67	2	1436.642	1436.6420	K	I	19	31
PSM	QELETELER	3990	sp|Q8TBA6-2|GOGA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8752	9.5338	2	1145.5564	1145.5564	K	L	529	538
PSM	QELGSPEER	3991	sp|Q92974-3|ARHG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3200	4.3445	2	1043.4884	1043.4884	R	L	900	909
PSM	QERLDFEETENK	3992	sp|Q9H0E9-3|BRD8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6515	7.495	3	1536.7056	1536.7056	K	G	376	388
PSM	QGEEEDAEIIVK	3993	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11066	11.631	3	1358.6565	1358.6565	K	I	443	455
PSM	QHCTEEDEEEDEEEEEESFMTSR	3994	sp|Q9NY27-3|PP4R2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:4	ms_run[2]:scan=16019	16.512	3	2903.0505	2903.0505	R	E	238	261
PSM	QHLENDPGSNEDTDIPK	3995	sp|O43396|TXNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10036	10.714	3	1907.8497	1907.8497	K	G	105	122
PSM	QKLEEDAEMK	3996	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	9-UNIMOD:35	ms_run[2]:scan=2159	3.4864	2	1235.5704	1235.5704	K	S	215	225
PSM	QLAEQEELER	3997	sp|Q9UH65|SWP70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13955	14.436	2	1243.6044	1243.6044	K	Q	330	340
PSM	QMEVQLEEEYEDK	3998	sp|Q92614-2|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14743	15.173	2	1668.7189	1668.7189	K	Q	1279	1292
PSM	QPCPSESDIITEEDK	3999	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:4	ms_run[2]:scan=10177	10.84	2	1746.7618	1746.7618	K	S	202	217
PSM	QSEQLDVEK	4000	sp|Q8IWJ2|GCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4038	5.0823	2	1074.5193	1074.5193	K	E	1029	1038
PSM	QSSEMTETDEESGILSEAEK	4001	sp|Q3T8J9|GON4L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15730	16.2	3	2198.9373	2198.9373	R	V	411	431
PSM	RAGGEESQFEMDI	4002	sp|Q13541|4EBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	11-UNIMOD:35	ms_run[2]:scan=12195	12.729	2	1483.6249	1483.6249	K	-	106	119
PSM	RDCNDTLEEENTNLETPTK	4003	sp|Q9BZE2|PUS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:4	ms_run[2]:scan=8582	9.3762	2	2278.0019	2278.0019	K	R	451	470
PSM	RDDGYEAAASSK	4004	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2236	3.5446	2	1268.5633	1268.5633	K	T	98	110
PSM	RDIQENDEEAVQVK	4005	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9342	10.097	3	1671.8064	1671.8064	K	E	33	47
PSM	RDIQENDEEAVQVK	4006	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7653	8.5486	2	1671.8064	1671.8064	K	E	33	47
PSM	REAENMAQR	4007	sp|Q9UBB9-2|TFP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=203	0.23767	2	1103.5142	1103.5142	R	G	111	120
PSM	REEEEDFIR	4008	sp|Q96A65|EXOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6091	7.0777	3	1221.5626	1221.5626	K	A	668	677
PSM	RESGEEFR	4009	sp|P30533|AMRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=1720	2.9612	2	1008.4625	1008.4625	K	M	48	56
PSM	RLEEPEEPK	4010	sp|O75822-2|EIF3J_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3062	4.2243	3	1125.5666	1125.5666	K	V	98	107
PSM	RVEIMEEESEQ	4011	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9084	9.8298	2	1377.6082	1377.6082	R	-	449	460
PSM	RYDDPEVQK	4012	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2501	3.7572	3	1148.5462	1148.5462	R	D	127	136
PSM	SAQEEVEVDIK	4013	sp|Q6PJG2|MDEAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10692	11.299	2	1245.6089	1245.6089	K	T	898	909
PSM	SDESSTDLEELK	4014	sp|Q08AE8-4|SPIR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9688	10.412	2	1351.5991	1351.5991	K	N	95	107
PSM	SDLLEEDRR	4015	sp|Q969Q5|RAB24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4656	5.633	3	1131.552	1131.5520	K	R	122	131
PSM	SDSGGSSSEPFDR	4016	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4534	5.5307	2	1326.5324	1326.5324	R	H	759	772
PSM	SEPELTTVAEVDESNGEEK	4017	sp|Q9HAU0-8|PKHA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14651	15.085	3	2061.9226	2061.9226	K	S	791	810
PSM	SGGSEAALK	4018	sp|Q8NFD5|ARI1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=554	0.92334	2	818.4134	818.4134	K	E	18	27
PSM	SIEGTADDEEEGVSPDTAIR	4019	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12977	13.514	4	2089.9288	2089.9288	K	S	638	658
PSM	SMSDPDQDFDK	4020	sp|Q9Y5S2|MRCKB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6998	7.9452	2	1283.4976	1283.4976	R	E	1657	1668
PSM	SMYEEEINETR	4021	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9522	10.262	2	1399.5926	1399.5926	K	R	210	221
PSM	SNGELSESPGAGK	4022	sp|Q12830-4|BPTF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2943	4.1285	2	1231.5681	1231.5681	K	G	756	769
PSM	SPQEVKPGEK	4023	sp|P78536|ADA17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=1575	2.6567	3	1097.5717	1097.5717	K	H	287	297
PSM	SQFQVEEEDIEK	4024	sp|Q15283-2|RASA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11952	12.436	2	1479.6729	1479.6729	K	L	239	251
PSM	SRDFNEECPR	4025	sp|Q13418-3|ILK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	8-UNIMOD:4	ms_run[2]:scan=2627	3.8629	3	1308.5517	1308.5517	K	L	98	108
PSM	STTQELMEDDRVK	4026	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	7-UNIMOD:35	ms_run[2]:scan=4010	5.0544	3	1566.7196	1566.7196	R	R	2205	2218
PSM	TDAPQPDVK	4027	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3218	4.3591	2	969.47673	969.4767	K	E	409	418
PSM	TEDESLVENNDNIDEEAREELR	4028	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16031	16.523	4	2618.158	2618.1580	K	E	123	145
PSM	TEVCQTCSK	4029	sp|Q9NW64|RBM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=1119	1.9951	2	1111.4638	1111.4638	K	L	68	77
PSM	TGEEDEEEFFCNR	4030	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	11-UNIMOD:4	ms_run[2]:scan=13842	14.334	3	1660.6311	1660.6311	K	A	1186	1199
PSM	TGISEEAAIEENK	4031	sp|Q5UIP0-2|RIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8724	9.5068	3	1389.6624	1389.6624	K	R	1935	1948
PSM	TGSQGQCTQVR	4032	sp|P62857|RS28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	7-UNIMOD:4	ms_run[2]:scan=1706	2.9343	2	1220.5568	1220.5568	R	V	21	32
PSM	TIDEELER	4033	sp|Q9Y320-2|TMX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6685	7.6585	2	1003.4822	1003.4822	K	D	107	115
PSM	TLTAEEAEEEWER	4034	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15468	15.928	3	1591.7002	1591.7002	R	R	154	167
PSM	TQEEIVAK	4035	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3182	4.3301	2	916.48656	916.4866	R	V	156	164
PSM	TSGRVAVEEVDEEGK	4036	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8378	9.1988	3	1603.7689	1603.7689	R	F	436	451
PSM	TSLEDEEVFEQK	4037	sp|O75648-5|MTU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13548	14.053	3	1452.662	1452.6620	R	H	131	143
PSM	TVDPETQAR	4038	sp|Q8IWZ3-5|ANKH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2640	3.8743	2	1015.4934	1015.4934	R	L	137	146
PSM	TVNESHGSVER	4039	sp|Q63HN8|RN213_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=1519	2.5709	3	1213.5687	1213.5687	K	S	1521	1532
PSM	VEIETSEEIQEK	4040	sp|Q14676-3|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10627	11.242	2	1432.6933	1432.6933	K	Q	892	904
PSM	VGGTSDVEVNEK	4041	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18687	19.516	2	1232.5885	1232.5885	K	K	406	418
PSM	VSGDDVIEK	4042	sp|O95197-7|RTN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4521	5.5191	2	960.47639	960.4764	K	D	121	130
PSM	WTEEEMETAK	4043	sp|Q9Y618-5|NCOR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7328	8.2406	2	1252.5282	1252.5282	R	K	615	625
PSM	YDDEEFEYR	4044	sp|P61024|CKS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10383	11.025	2	1264.4884	1264.4884	K	H	12	21
PSM	YTAQVDAEEK	4045	sp|O75947|ATP5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4097	5.1395	2	1152.5299	1152.5299	K	E	86	96
PSM	GGAAPEGPNEAEVTSGKPEQEVPDAEEEK	4046	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=10862	11.451632	3	2950.314702	2950.331584	K	S	215	244
PSM	LSVEESEAAGDGVDTK	4047	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=10041	10.719598	2	1605.737521	1605.736976	K	V	427	443
PSM	ENDKTEEMPNDSVLENK	4048	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=10382	11.024176	2	1991.852176	1990.878965	K	S	486	503
PSM	AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	4049	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=18696	19.527557	4	3774.603365	3773.619463	K	A	735	771
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	4050	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	23-UNIMOD:35	ms_run[1]:scan=9208	9.9604021	3	3592.500516	3590.482301	K	A	737	771
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	4051	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	23-UNIMOD:35	ms_run[1]:scan=8633	9.4223677	3	3590.502303	3590.482301	K	A	737	771
PSM	KDDENIPMETEETHLEETTESQQNGEEGTSTPEDK	4052	sp|Q969G3|SMCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:35	ms_run[1]:scan=10624	11.240115	4	3993.666144	3992.671284	K	E	333	368
PSM	EGLELPEDEEEK	4053	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=18972	19.938464	2	1415.616452	1415.630385	K	K	412	424
PSM	QTEEQVNDLK	4054	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28	ms_run[1]:scan=8966	9.7229519	2	1185.5512	1185.5508	R	E	943	953
PSM	GEDPFTSETVDPEMEGDDNLGGEDK	4055	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:35	ms_run[1]:scan=15205	15.659207	2	2699.090399	2698.071196	K	K	542	567
PSM	KWSLEDDDDDEDD	4056	sp|Q7L014|DDX46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0		ms_run[1]:scan=11369	11.906259	2	1595.5763	1595.5742	K	P	197	210
PSM	EAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS	4057	sp|O60936|NOL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0		ms_run[1]:scan=21483	24.30498	5	5140.1222	5140.1159	K	-	164	209
PSM	TAMSTPHVAEPAENEQDEQDENGAEASADLR	4058	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:35	ms_run[1]:scan=10524	11.149215	3	3328.397307	3327.406951	K	A	465	496
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	4059	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:35	ms_run[1]:scan=15139	15.588247	6	3916.678495	3915.650095	K	G	307	347
PSM	GGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	4060	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:35	ms_run[1]:scan=15394	15.843276	4	3389.414800	3388.379734	R	G	311	347
PSM	GGMNDDEDFYDEDMGDGGGGSYR	4061	sp|Q9UPT8|ZC3H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:35	ms_run[1]:scan=13847	14.337829	3	2473.857287	2473.854678	K	S	355	378
PSM	ELEEREIDDTYIEDAADVDAR	4062	sp|Q99459|CDC5L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=18908	19.833159	3	2466.107265	2466.103422	K	K	501	522
PSM	ESGASVDEVAR	4063	sp|P50579|MAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:27	ms_run[1]:scan=7764	8.6480889	2	1100.5096	1100.5093	K	Q	59	70
PSM	NEIDNYEEDYQK	4064	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=11674	12.190324	2	1559.627762	1558.642347	K	M	1109	1121
PSM	NKYEDEINK	4065	sp|P04264|K2C1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=2899	4.0925164	2	1151.546480	1151.545868	R	R	268	277
PSM	NFGEEVDDESLK	4066	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=13637	14.138698	2	1381.587804	1380.604505	K	E	197	209
PSM	NFGEEVDDESLK	4067	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=13573	14.07625	2	1381.587804	1380.604505	K	E	197	209
PSM	QTEDSLASERDR	4068	sp|Q86UP2|KTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28	ms_run[1]:scan=4930	5.8740044	2	1388.6192	1388.6163	K	L	618	630
PSM	EKLEEEENLTR	4069	sp|Q86V48|LUZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=5008	5.9380186	2	1388.681449	1388.678338	K	E	94	105
PSM	SSVDLEESSTK	4070	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=4337	5.3511102	2	1180.542524	1180.545927	R	S	537	548
PSM	KQEETAVLEEDSADWEK	4071	sp|Q96A49|SYAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=14046	14.52171	3	2005.910195	2005.911646	K	E	302	319
PSM	ENGVTDDLDAPK	4072	sp|Q9BQ39|DDX50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=8746	9.5293193	2	1273.567555	1272.583375	R	A	49	61
PSM	DLPNGDIDEYEK	4073	sp|Q9BQ39|DDX50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=16041	16.534893	2	1407.601358	1406.620155	K	K	95	107
PSM	STAGDTHLGGEDFDNR	4074	sp|P54652|HSP72_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=6583	7.5627486	2	1691.703386	1690.718306	K	M	224	240
PSM	HQGVMVGMGQKDSYVGDEAQSK	4075	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=3625	4.695214	2	2350.048458	2350.068180	R	R	42	64
PSM	EIESEIDSEEELINK	4076	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:27	ms_run[1]:scan=17568	18.168683	2	1757.8173	1757.8202	K	K	755	770
PSM	DGQVINETSQHHDDLE	4077	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=7841	8.717373	3	1836.782518	1835.792199	R	-	451	467
PSM	DGQVINETSQHHDDLE	4078	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=11040	11.609076	2	1836.785314	1835.792199	R	-	451	467
PSM	SNDSEEGLEDAVEGADEALQK	4079	sp|Q9NUJ3|T11L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=21199	23.707069	3	2204.948923	2204.955695	K	A	18	39
PSM	NRNEQESAVHPR	4080	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=781	1.4129692	4	1436.697143	1435.691637	R	E	247	259
PSM	EDAANNYAR	4081	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:27	ms_run[1]:scan=4269	5.2948477	2	1004.4297	1004.4306	K	G	97	106
PSM	DYEEVGVDSVEGEGEEEGEEY	4082	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=22530	26.657313	3	2347.901054	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	4083	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=22295	26.153753	3	2347.901054	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	4084	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=22972	27.663013	3	2347.901054	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	4085	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=23892	30.183635	3	2347.901054	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	4086	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=24055	30.68755	3	2347.901054	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	4087	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=23170	28.168372	3	2347.901054	2347.897571	K	-	431	452
PSM	EDLIREER	4088	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=4151	5.1894495	2	1058.535640	1058.535637	K	S	369	377
PSM	SEPELTTVAEVDESNGEEK	4089	sp|Q9HAU0|PKHA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=14913	15.340146	3	2062.905665	2061.922604	K	S	809	828
PSM	EAEMEEHREHIK	4090	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:27,4-UNIMOD:35	ms_run[1]:scan=1999	3.3630905	3	1535.6972	1534.6832	K	V	1008	1020
PSM	QEMQEVQSSR	4091	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28	ms_run[1]:scan=6196	7.1681903	2	1203.5183	1203.5185	R	S	191	201
PSM	QEMQEVQSSR	4092	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28	ms_run[1]:scan=6287	7.2468464	2	1203.5183	1203.5185	R	S	191	201
PSM	SHGKDEECVLEAENK	4093	sp|Q9UHQ4|BAP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:4	ms_run[1]:scan=3358	4.4707619	3	1743.774688	1743.773378	K	K	164	179
PSM	QLDDKDEEINQQSQLVEK	4094	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=9640	10.370325	3	2159.023420	2158.038971	K	L	431	449
PSM	KPEYDLEEDDQEVLK	4095	sp|Q13416|ORC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=13636	14.13794	3	1849.860297	1848.862904	K	D	52	67
PSM	TECAEPPRDEPPADGALK	4096	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:4	ms_run[1]:scan=6911	7.8717138	3	1951.893152	1951.894556	R	R	9	27
PSM	EHGQCADVDECSLAEK	4097	sp|Q6UXH1|CREL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:27,5-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=5674	6.6817502	3	1830.7512	1828.7352	R	T	284	300
PSM	SYSEDDIHR	4098	sp|Q9BYJ9|YTHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=2871	4.0683513	2	1121.481712	1120.478516	K	S	396	405
PSM	NGEPEPTPVVNGEK	4099	sp|P40222|TXLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=8525	9.3285578	2	1466.690368	1465.704888	R	E	120	134
PSM	NGEPEPTPVVNGEKEPSK	4100	sp|P40222|TXLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=6991	7.939999	3	1907.913652	1906.927236	R	G	120	138
PSM	LAEGEEEKPEPDISSEESVSTVEEQENETPPATSSEAEQPK	4101	sp|Q5SSJ5|HP1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=16105	16.596764	4	4442.989319	4441.978014	K	G	57	98
PSM	QLETDSSEEISR	4102	sp|Q96NL6|SCLT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28	ms_run[1]:scan=11894	12.385593	2	1375.6135	1375.6098	K	Y	476	488
PSM	SVTEQGAELSNEER	4103	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=10599	11.217328	2	1547.730845	1547.706344	K	N	28	42
PSM	AAVELEEPEDAR	4104	sp|O94906|PRP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=9734	10.452994	2	1327.625379	1327.625575	K	I	409	421
PSM	QLEESVSEK	4105	sp|O95239|KIF4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28	ms_run[1]:scan=9477	10.220196	1	1030.4814	1030.4813	K	E	947	956
PSM	EWQELDDAEK	4106	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:27	ms_run[1]:scan=18717	19.55648	2	1243.5350	1243.5352	K	V	169	179
PSM	NTNEEDDEVREAMTR	4107	sp|P49959|MRE11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=10600	11.218069	3	1808.746516	1807.764270	K	A	511	526
PSM	TEPEEVSIEDSAQSDLK	4108	sp|Q16666|IF16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=14563	15.002725	3	1875.857864	1875.858547	K	E	562	579
PSM	CGSTEHEITK	4109	sp|Q8N567|ZCHC9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=3448	4.5402742	2	1143.4860	1143.4861	R	C	160	170
PSM	SSSDDEEQLTELDEEMENEICR	4110	sp|Q96ER3|SAAL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	16-UNIMOD:35,21-UNIMOD:4	ms_run[1]:scan=22550	26.709596	3	2674.085165	2673.054166	K	V	54	76
PSM	DLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDK	4111	sp|Q15029|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:35,24-UNIMOD:35	ms_run[1]:scan=10418	11.057188	5	3698.356978	3698.354049	K	K	32	64
PSM	PDASKPEDWDER	4112	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0		ms_run[1]:scan=4944	5.8861716	3	1443.6271	1443.6261	D	A	211	223
PSM	TEIEEELK	4113	sp|Q9BXK5|B2L13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=7536	8.4365346	2	989.492194	989.491707	K	S	61	69
PSM	QEDEWDKPR	4114	sp|P13674|P4HA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28	ms_run[1]:scan=6474	7.4497985	2	1184.5093	1184.5093	K	I	328	337
PSM	AADISESSGADCK	4115	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=7265	8.1903835	2	1352.5542	1351.5552	M	G	2	15
PSM	NNASTDYDLSDK	4116	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=6404	7.3615799	2	1342.552667	1341.568454	K	S	301	313
PSM	MGDAPSPEEK	4117	sp|P54577|SYYC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1	ms_run[1]:scan=8264	9.0922723	2	1101.4643	1101.4643	-	L	1	11
PSM	DDEPDPLILEENDVDNMATNNK	4118	sp|Q92547|TOPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	17-UNIMOD:35	ms_run[1]:scan=19798	21.173789	3	2516.080185	2516.086058	K	E	1023	1045
PSM	QLAEQEELER	4119	sp|Q9UH65|SWP70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28	ms_run[1]:scan=14044	14.520208	2	1226.5780	1226.5774	K	Q	330	340
PSM	QGDITEDETIR	4120	sp|Q86VN1|VPS36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28	ms_run[1]:scan=12450	13.004726	2	1258.5671	1258.5672	K	F	206	217
PSM	QDEEINQIEEERTK	4121	sp|Q9H788|SH24A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28	ms_run[1]:scan=13084	13.613756	2	1742.7919	1742.7954	K	Q	207	221
PSM	ASEVEEILDGNDEK	4122	sp|Q12824|SNF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=13655	14.156142	2	1546.709050	1546.699862	K	Y	93	107
PSM	QSEQLDVEK	4123	sp|Q8IWJ2|GCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=4087	5.1301705	2	1074.519152	1074.519319	K	E	1029	1038
PSM	AASSKPEEIK	4124	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1622	2.7465801	3	1058.562554	1058.560789	K	M	472	482
PSM	MDGSGEQPR	4125	sp|Q07812|BAX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1	ms_run[1]:scan=4749	5.7142395	2	1017.4184	1017.4180	-	G	1	10
PSM	EMFEDTVEER	4126	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:35	ms_run[1]:scan=8157	9.0009264	2	1300.541523	1299.528897	K	V	5	15
PSM	EMFEDTVEER	4127	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:27	ms_run[1]:scan=17660	18.292857	2	1265.5207	1265.5229	K	V	5	15
PSM	NLEDDTLSECK	4128	sp|Q14966|ZN638_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:4	ms_run[1]:scan=7866	8.737562	2	1322.566335	1322.566011	K	Q	643	654
PSM	EALEQVAEEGR	4129	sp|Q8IWB1|IPRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=8528	9.3305079	2	1229.588872	1229.588795	K	Q	67	78
PSM	MEDLEEDVR	4130	sp|Q6PGN9|PSRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1	ms_run[1]:scan=19615	20.883699	2	1176.4950	1176.4963	-	F	1	10
PSM	MEDFEDDPR	4131	sp|Q9H1Z4-2|WDR13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1	ms_run[1]:scan=16468	16.94812	2	1194.4499	1194.4494	-	A	1	10
PSM	SYCNDQSTGDIK	4132	sp|P00492|HPRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:4	ms_run[1]:scan=3849	4.9067246	2	1387.556886	1386.572159	K	V	104	116
PSM	GEAEDILETEK	4133	sp|Q9HBL7|PLRKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=10963	11.541242	2	1232.586733	1232.577227	K	S	108	119
PSM	MTTDEGAK	4134	sp|Q13451|FKBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1	ms_run[1]:scan=4383	5.3869516	1	893.3813	893.3795	-	N	1	9
PSM	RLADSGDGAGPSPEEK	4135	sp|Q92917|GPKOW_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=2758	3.9710679	3	1585.740922	1584.737979	R	D	31	47
PSM	ATHGQTCAR	4136	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,7-UNIMOD:4	ms_run[1]:scan=184	0.20826607	2	1042.4616	1042.4609	M	P	2	11
PSM	VAAGASESTR	4137	sp|O15061|SYNEM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1555	2.6279779	2	948.474901	947.467223	K	S	479	489
PSM	QDAAGHIER	4138	sp|Q9H2Y7|ZN106_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1948	3.3250761	2	997.478020	995.478457	K	H	1865	1874
PSM	TIQGDEEDLR	4139	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=5328	6.2258544	2	1177.571461	1174.546596	K	-	286	296
PSM	VGGTSDVEVNEK	4140	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=11974	12.454264	2	1234.585316	1232.588461	K	K	406	418
PSM	ELGENMSDEELR	4141	sp|O15182|CETN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:35	ms_run[1]:scan=6353	7.3050279	2	1437.610650	1436.608939	R	A	129	141
PSM	EVNSQEEEEEELLRK	4142	sp|Q96RL1|UIMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=10532	11.157086	3	1859.875814	1859.874866	R	A	98	113
PSM	ENGINGELTSADRETAEEVSAR	4143	sp|P11137|MTAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=16687	17.185351	3	2349.058345	2347.088775	K	I	72	94
PSM	EEAGGGISEEEAAQYDR	4144	sp|Q9UBE0|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=13398	13.909696	2	1809.768911	1809.765316	K	Q	5	22
PSM	ADPPPEESQAPQAQTAAAEAP	4145	sp|O95785-2|WIZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10791	11.388	3	2074.9443	2074.9443	K	-	774	795
PSM	ADTIDTIEK	4146	sp|Q9Y4E8-4|UBP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6357	7.3079	2	1004.5026	1004.5026	K	E	155	164
PSM	AECSAEQCYK	4147	sp|P48163-2|MAOX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=2272	3.5732	2	1244.4802	1244.4802	K	I	338	348
PSM	AEEEFNIEK	4148	sp|P36543-3|VATE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8673	9.4603	2	1107.5084	1107.5084	K	G	34	43
PSM	AEEEFNIEK	4149	sp|P36543-3|VATE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9250	10	2	1107.5084	1107.5084	K	G	34	43
PSM	AEEELSIDK	4150	sp|O43432-4|IF4G3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6762	7.7333	2	1032.4975	1032.4975	K	V	251	260
PSM	AEEELSIDK	4151	sp|O43432-4|IF4G3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7155	8.0915	2	1032.4975	1032.4975	K	V	251	260
PSM	AESEQEAYLRED	4152	sp|Q9NR28-2|DBLOH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7885	8.7536	2	1438.6212	1438.6212	R	-	175	187
PSM	AMQGAGTQER	4153	sp|P20073-2|ANXA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1678	2.8748	2	1047.4767	1047.4767	K	V	247	257
PSM	ARNLADDSSENK	4154	sp|P35251-2|RFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1200	2.14	2	1318.6113	1318.6113	K	V	569	581
PSM	ARTSPDEDEDDLLPPEQK	4155	sp|P15923|TFE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10335	10.979	3	2053.944	2053.9440	R	A	526	544
PSM	ATEMVEVGADDDEGGAER	4156	sp|Q6NZI2|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9754	10.47	3	1849.7636	1849.7636	K	G	338	356
PSM	AVDPEDDFQR	4157	sp|Q99848|EBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8783	9.561	2	1190.5204	1190.5204	K	E	95	105
PSM	AVSAAEEVK	4158	sp|Q5JRA6|TGO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2882	4.0784	2	902.47091	902.4709	K	T	1559	1568
PSM	CAELEEELK	4159	sp|P09493-9|TPM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:4	ms_run[2]:scan=9296	10.047	1	1119.5118	1119.5118	K	T	190	199
PSM	CAELEEELK	4160	sp|P09493-9|TPM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:4	ms_run[2]:scan=9438	10.187	2	1119.5118	1119.5118	K	T	190	199
PSM	DAEGLDEIDHAEMELR	4161	sp|P23634-7|AT2B4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	13-UNIMOD:35	ms_run[2]:scan=18713	19.55	3	1857.8051	1857.8051	K	R	1060	1076
PSM	DAENHEAQLK	4162	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2138	3.47	2	1153.5364	1153.5364	K	N	124	134
PSM	DCEGLPREK	4163	sp|Q9H0D6-2|XRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	2-UNIMOD:4	ms_run[2]:scan=2932	4.1213	2	1102.5077	1102.5077	K	K	199	208
PSM	DCVGPEVEK	4164	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	2-UNIMOD:4	ms_run[2]:scan=5289	6.1895	2	1031.4594	1031.4594	K	A	70	79
PSM	DDETMYVESK	4165	sp|O15144|ARPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6888	7.851	2	1215.4965	1215.4965	R	K	148	158
PSM	DDFSSGTSSR	4166	sp|P43304|GPDM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2895	4.0877	2	1057.4312	1057.4312	R	S	101	111
PSM	DEGRWEHDK	4167	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1658	2.8309	2	1170.5054	1170.5054	K	F	214	223
PSM	DETELAELDR	4168	sp|Q15788-2|NCOA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13172	13.698	2	1189.5463	1189.5463	K	A	944	954
PSM	DGNCRDCIK	4169	sp|Q15785|TOM34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=983	1.8077	3	1136.4703	1136.4703	K	D	64	73
PSM	DGQVINETSQHHDDLE	4170	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14233	14.697	2	1835.7922	1835.7922	R	-	451	467
PSM	DGQVINETSQHHDDLE	4171	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12161	12.695	2	1835.7922	1835.7922	R	-	451	467
PSM	DHEDYDPQTVR	4172	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4171	5.2078	3	1373.5848	1373.5848	R	L	633	644
PSM	DHVDELEPER	4173	sp|O95613|PCNT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4891	5.8405	3	1237.5575	1237.5575	K	H	576	586
PSM	DLDEVEAPGPEEPAR	4174	sp|Q6T4R5-2|NHS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12272	12.816	3	1622.7424	1622.7424	R	A	45	60
PSM	DLDTGEEVTR	4175	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5980	6.9854	2	1133.52	1133.5200	R	D	231	241
PSM	DLQELGDSDK	4176	sp|P32004-3|L1CAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7252	8.1787	2	1118.5091	1118.5091	R	Y	554	564
PSM	DLTGEVEENER	4177	sp|Q9UMZ2-6|SYNRG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8767	9.5469	2	1289.5735	1289.5735	K	Y	910	921
PSM	DQALTEEHAR	4178	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2479	3.7394	2	1168.5473	1168.5473	R	Q	615	625
PSM	DQTPDENDQVVVK	4179	sp|O00425-2|IF2B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6533	7.5155	3	1485.6947	1485.6947	R	I	145	158
PSM	DRETMGHR	4180	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=22363	26.298	2	1000.4509	1000.4509	K	Y	74	82
PSM	DRETMGHR	4181	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=23201	28.249	2	1000.4509	1000.4509	K	Y	74	82
PSM	DSDKTDTDWR	4182	sp|P23588-2|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3318	4.4392	3	1237.5211	1237.5211	R	A	152	162
PSM	DSLSKPEK	4183	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=550	0.91468	2	902.47091	902.4709	K	L	459	467
PSM	DSYVGDEAQSK	4184	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=22722	27.036	2	1197.515	1197.5150	K	R	51	62
PSM	DVADGNVSDFDNEEEEQSVPPK	4185	sp|O43156|TTI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15012	15.437	3	2419.0299	2419.0299	K	V	821	843
PSM	DVAVAEEVR	4186	sp|Q8WUP2-3|FBLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7616	8.5168	2	986.50327	986.5033	R	Q	23	32
PSM	EAALEPSMEK	4187	sp|Q9H3K2|GHITM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	8-UNIMOD:35	ms_run[2]:scan=3545	4.6241	2	1119.5118	1119.5118	K	I	64	74
PSM	EDEVEEWQHR	4188	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6128	7.1085	3	1355.5742	1355.5742	K	A	439	449
PSM	EDIKLEEK	4189	sp|Q9C0J8|WDR33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3900	4.9573	2	1002.5233	1002.5233	K	K	527	535
PSM	EDSDEMPSECISR	4190	sp|Q96LT9-2|RNPC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	10-UNIMOD:4	ms_run[2]:scan=8079	8.9317	2	1553.5974	1553.5974	K	R	378	391
PSM	EDTEEHHLR	4191	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=106	0.096206	2	1164.516	1164.5160	K	D	109	118
PSM	EDTEEYNLR	4192	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5956	6.9636	3	1167.5044	1167.5044	K	D	113	122
PSM	EDVNFQDNEK	4193	sp|O15084|ANR28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4971	5.9078	2	1236.5259	1236.5259	K	R	32	42
PSM	EEAGGGISEEEAAQYDR	4194	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16205	16.689	2	1809.7653	1809.7653	K	Q	5	22
PSM	EEDIAVLAEEK	4195	sp|Q8TAF3-5|WDR48_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14738	15.169	3	1244.6136	1244.6136	K	I	353	364
PSM	EEDIEVPK	4196	sp|Q9UPY3-3|DICER_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7490	8.3923	2	957.46549	957.4655	K	A	697	705
PSM	EEETLDTIK	4197	sp|Q9UMR2-3|DD19B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7329	8.2413	2	1076.5237	1076.5237	R	Q	191	200
PSM	EEGEEGISFDTEEER	4198	sp|Q92620|PRP16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12680	13.227	2	1754.7119	1754.7119	R	Q	298	313
PSM	EELLEYEEK	4199	sp|P45974-2|UBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11838	12.336	2	1180.5499	1180.5499	K	K	500	509
PSM	EEPSQNDISPK	4200	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3804	4.8659	2	1242.5728	1242.5728	K	T	81	92
PSM	EEPSQNDISPK	4201	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3884	4.9435	2	1242.5728	1242.5728	K	T	81	92
PSM	EESSEFDVR	4202	sp|Q6NW34-2|NEPRO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6466	7.4419	2	1096.4673	1096.4673	K	A	235	244
PSM	EEVPMCSDAESR	4203	sp|Q96EK7-2|F120B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	6-UNIMOD:4	ms_run[2]:scan=6030	7.0291	2	1408.5599	1408.5599	R	Q	339	351
PSM	EFVADETER	4204	sp|O75582-2|KS6A5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5625	6.6376	2	1094.488	1094.4880	K	A	201	210
PSM	EGLELPEDEEEK	4205	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=19843	21.251	2	1415.6304	1415.6304	K	K	547	559
PSM	EGQHYPER	4206	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=829	1.5182	2	1014.4519	1014.4519	R	H	707	715
PSM	EHTGKPTTSSSEACR	4207	sp|O75592-2|MYCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	14-UNIMOD:4	ms_run[2]:scan=946	1.7479	3	1646.7318	1646.7318	R	F	4340	4355
PSM	EIGQSVDEVEK	4208	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6300	7.2584	2	1231.5932	1231.5932	R	L	2031	2042
PSM	EIVEVKEENIEDATEK	4209	sp|P82970|HMGN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12368	12.919	3	1873.9157	1873.9157	K	G	96	112
PSM	EKEELMER	4210	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	6-UNIMOD:35	ms_run[2]:scan=1702	2.9264	2	1078.4965	1078.4965	R	L	343	351
PSM	ELEAELEDERK	4211	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6588	7.5685	3	1359.6518	1359.6518	R	Q	1600	1611
PSM	ELEAHSAEAR	4212	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2081	3.4255	2	1111.5258	1111.5258	K	A	582	592
PSM	ELEIEERER	4213	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4882	5.8345	3	1201.5939	1201.5939	R	R	828	837
PSM	ELPIDEDEEMK	4214	sp|Q9UL01|DSE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12631	13.18	2	1346.5912	1346.5912	K	D	847	858
PSM	ELQEEVAR	4215	sp|O43896|KIF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4219	5.2485	2	972.48762	972.4876	R	L	365	373
PSM	EMAEDDDDSFP	4216	sp|O43242|PSMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14851	15.278	2	1269.4343	1269.4343	K	-	524	535
PSM	EMDDPSVGPK	4217	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4883	5.8352	2	1073.4699	1073.4699	R	I	259	269
PSM	EMEAELEDERK	4218	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4763	5.7283	3	1377.6082	1377.6082	R	Q	1593	1604
PSM	ENREAQMAAK	4219	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:35	ms_run[2]:scan=968	1.7854	2	1162.5401	1162.5401	K	L	110	120
PSM	EPEIEVPLDDEDEEGENEEGKPK	4220	sp|Q15542-2|TAF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15657	16.127	4	2625.1453	2625.1453	K	K	379	402
PSM	EQAELEAAR	4221	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3550	4.6298	2	1015.4934	1015.4934	K	Q	1931	1940
PSM	ESQDTVAENDDGGFSEEWEAQR	4222	sp|P49768-7|PSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16004	16.493	3	2498.0106	2498.0106	R	D	290	312
PSM	ESQSEREEFESEFK	4223	sp|Q5VT25-3|MRCKA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10486	11.116	3	1759.7537	1759.7537	R	Q	668	682
PSM	ESSSNSLSNSR	4224	sp|Q8NDT2-2|RB15B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1165	2.0823	2	1166.5164	1166.5164	K	H	320	331
PSM	ETLNQAETK	4225	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2400	3.6766	2	1032.5088	1032.5088	K	S	1481	1490
PSM	ETPPAEGEGHEAPIAK	4226	sp|Q5TCZ1-2|SPD2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4188	5.2201	3	1631.7791	1631.7791	K	K	167	183
PSM	ETSMTEPSEPGSK	4227	sp|Q9UKJ3-2|GPTC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3993	5.0399	2	1378.5922	1378.5922	K	A	389	402
PSM	ETTIDPEEDLNK	4228	sp|Q96LK0|CEP19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11008	11.581	2	1402.6464	1402.6464	R	L	96	108
PSM	EVEAAQGVK	4229	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2513	3.7652	2	929.48181	929.4818	K	I	924	933
PSM	EVTNASAAGNK	4230	sp|Q15054-3|DPOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1158	2.0732	2	1060.5149	1060.5149	K	A	111	122
PSM	EYSVEAEER	4231	sp|Q8IUF8-2|RIOX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4565	5.5592	2	1110.4829	1110.4829	R	I	208	217
PSM	FEGEDYREK	4232	sp|P28370-2|SMCA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2944	4.1292	2	1171.5146	1171.5146	K	Q	717	726
PSM	FQEDQEMAR	4233	sp|Q9BQ70|TCF25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4412	5.4117	2	1152.487	1152.4870	R	D	298	307
PSM	GADMSVPDEK	4234	sp|Q9P2R3|ANFY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5099	6.0216	2	1047.4543	1047.4543	R	G	678	688
PSM	GCPPDDIENPR	4235	sp|P05556-2|ITB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	2-UNIMOD:4	ms_run[2]:scan=5036	5.9639	2	1268.5455	1268.5456	K	G	74	85
PSM	GLEEPEMDPK	4236	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8278	9.1066	2	1143.5118	1143.5118	K	S	497	507
PSM	GLSEDTTEETLK	4237	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7819	8.6972	2	1321.6249	1321.6249	K	E	578	590
PSM	GQALEPTESK	4238	sp|Q92570|NR4A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3110	4.2661	2	1058.5244	1058.5244	K	V	573	583
PSM	GSVEEPKPEEPK	4239	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3086	4.2449	2	1324.6511	1324.6511	K	R	554	566
PSM	HDEEDYVEMK	4240	sp|Q9H7L9|SDS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5951	6.958	3	1293.5183	1293.5183	K	E	60	70
PSM	HESCGQCTPCR	4241	sp|P49821-2|NDUV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:4,7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=1025	1.8671	3	1390.5176	1390.5176	K	E	367	378
PSM	HPDIEAQER	4242	sp|P48449-2|ERG7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2505	3.7598	2	1093.5152	1093.5152	R	G	584	593
PSM	IDEPLEGSEDR	4243	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7167	8.1022	2	1258.5677	1258.5677	K	I	399	410
PSM	IEEEEQEPEPPEPFEYIDD	4244	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=22535	26.669	3	2332.9747	2332.9747	K	-	904	923
PSM	IEENSLKEEESIEGEK	4245	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8077	8.9302	3	1861.8793	1861.8793	K	E	1566	1582
PSM	IEVDDPPDKEDMR	4246	sp|Q9HCE3|ZN532_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6925	7.8841	3	1557.6981	1557.6981	K	S	144	157
PSM	KDEEVLK	4247	sp|Q13838|DX39B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1313	2.3034	2	859.4651	859.4651	K	K	156	163
PSM	KLVEDQEK	4248	sp|Q9UHQ4|BAP29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=581	0.98662	2	987.52368	987.5237	K	L	179	187
PSM	LANSEANTR	4249	sp|Q9H8W4|PKHF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1395	2.4099	2	974.47812	974.4781	R	R	5	14
PSM	LDPEEEDDSFNNYEVQSEAK	4250	sp|Q9Y6J0-2|CABIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15065	15.498	3	2356.9819	2356.9819	K	L	375	395
PSM	LDSLPEHEDSEK	4251	sp|Q8TDY2-2|RBCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4051	5.0958	2	1397.6311	1397.6311	R	A	220	232
PSM	LDTDDLDEIEK	4252	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14622	15.059	2	1304.5984	1304.5984	R	I	357	368
PSM	LEEEENLTR	4253	sp|Q86V48-2|LUZP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5245	6.1514	2	1131.5408	1131.5408	K	E	96	105
PSM	LPQTSDDEK	4254	sp|Q9GZT3-2|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2439	3.7071	2	1031.4771	1031.4771	K	K	96	105
PSM	LSQPESAEK	4255	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2293	3.5923	2	987.48729	987.4873	R	H	709	718
PSM	LTAEEMDER	4256	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4880	5.8332	2	1092.4757	1092.4757	R	R	26	35
PSM	MEDENNRLR	4257	sp|O94992|HEXI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2264	3.5679	2	1175.5353	1175.5353	R	L	301	310
PSM	MPLDDLDREDEVR	4258	sp|P57740-3|NU107_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:35	ms_run[2]:scan=10711	11.317	3	1617.7305	1617.7305	K	L	182	195
PSM	NFGEEVDDESLK	4259	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10316	10.963	2	1380.6045	1380.6045	K	E	197	209
PSM	NIEEHASADVEK	4260	sp|P61006-2|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9655	10.382	2	1340.6208	1340.6208	R	M	105	117
PSM	NKFEEAER	4261	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2099	3.4394	2	1021.4829	1021.4829	R	S	372	380
PSM	NPDTIEQCR	4262	sp|Q9Y282-2|ERGI3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	8-UNIMOD:4	ms_run[2]:scan=3078	4.2393	2	1131.4979	1131.4979	K	R	175	184
PSM	NYTDNELEK	4263	sp|P00367-2|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4550	5.5463	2	1124.4986	1124.4986	K	I	25	34
PSM	QCVENADLPEGEK	4264	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	2-UNIMOD:4	ms_run[2]:scan=11546	12.064	2	1487.6562	1487.6562	K	K	111	124
PSM	QDIEDSVSR	4265	sp|O60306|AQR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4736	5.703	2	1047.4833	1047.4833	R	M	483	492
PSM	QETHQQLADK	4266	sp|P82675|RT05_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=34	0.033916	3	1196.5786	1196.5786	R	K	356	366
PSM	QGEEEDAEIIVK	4267	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13196	13.722	3	1358.6565	1358.6565	K	I	443	455
PSM	QGEEEDAEIIVK	4268	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16731	17.227	2	1358.6565	1358.6565	K	I	443	455
PSM	QGPGPGGPK	4269	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=839	1.5396	2	793.40825	793.4083	K	G	200	209
PSM	QGPGPGGPK	4270	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1142	2.0407	2	793.40825	793.4083	K	G	200	209
PSM	QGTTETIEEVEAEQEEEAGSTAPEPR	4271	sp|Q9H5I5-2|PIEZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=17105	17.627	4	2816.2472	2816.2472	R	E	1762	1788
PSM	QHDQLEAQK	4272	sp|P80303-2|NUCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13	0.017887	3	1095.5309	1095.5309	R	L	378	387
PSM	QLQDEREAVQK	4273	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2661	3.8916	3	1342.6841	1342.6841	K	K	34	45
PSM	QLSEIEEEDK	4274	sp|Q8WXH0-2|SYNE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15849	16.335	2	1218.5616	1218.5616	R	L	2028	2038
PSM	QNDVFGEAEQ	4275	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10844	11.436	2	1135.4782	1135.4782	K	-	438	448
PSM	QNTQSDIGGSGK	4276	sp|O43166-3|SI1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1809	3.097	2	1190.5527	1190.5527	R	S	1188	1200
PSM	QPGVSEQQR	4277	sp|O94776|MTA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2042	3.3957	2	1027.5047	1027.5047	K	H	72	81
PSM	QQEELLAEENQR	4278	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7911	8.7768	3	1485.7059	1485.7059	R	L	2550	2562
PSM	QQEVETELK	4279	sp|P08621-2|RU17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4775	5.7391	2	1102.5506	1102.5506	R	M	79	88
PSM	QQVEAIEK	4280	sp|Q7Z6B0-2|CCD91_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3283	4.4104	2	943.49746	943.4975	K	Q	197	205
PSM	QSACNLEK	4281	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:4	ms_run[2]:scan=2036	3.3917	2	948.43348	948.4335	R	K	1434	1442
PSM	QVSDDLTER	4282	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4668	5.6438	2	1061.4989	1061.4989	R	A	149	158
PSM	QYTEDMDQK	4283	sp|Q9NXC5-2|MIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3170	4.32	2	1156.4707	1156.4707	K	S	435	444
PSM	RDIQENDEEAVQVK	4284	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14113	14.586	3	1671.8064	1671.8064	K	E	33	47
PSM	RGELDDPEPR	4285	sp|O00418|EF2K_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3232	4.3684	2	1182.5629	1182.5629	K	E	448	458
PSM	RSETVVER	4286	sp|O15031|PLXB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1480	2.5149	2	974.51451	974.5145	R	M	1392	1400
PSM	RVEIMEEESEQ	4287	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	5-UNIMOD:35	ms_run[2]:scan=4557	5.5515	2	1393.6031	1393.6031	R	-	449	460
PSM	RVEIMEEESEQ	4288	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10911	11.494	2	1377.6082	1377.6082	R	-	449	460
PSM	SEIDMNDIK	4289	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	5-UNIMOD:35	ms_run[2]:scan=4634	5.6154	2	1079.4805	1079.4805	R	A	304	313
PSM	SELTETQAEK	4290	sp|Q9HD26-3|GOPC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2902	4.0966	2	1134.5404	1134.5404	K	V	103	113
PSM	SEMEVQDAELK	4291	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9047	9.7943	3	1277.5809	1277.5809	K	A	345	356
PSM	SEMTPEELQK	4292	sp|P62316|SMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:35	ms_run[2]:scan=3919	4.9748	2	1206.5438	1206.5438	K	R	9	19
PSM	SIDDEITEAK	4293	sp|Q13131|AAPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8647	9.4349	2	1119.5295	1119.5295	R	S	476	486
PSM	SIVEEEEDDDYVELK	4294	sp|P50851-2|LRBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16840	17.343	3	1810.7996	1810.7996	K	V	1100	1115
PSM	SMDFEEAER	4295	sp|O43396|TXNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8277	9.1059	2	1112.4444	1112.4444	R	S	203	212
PSM	SMVDASEEK	4296	sp|Q9H3R5|CENPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3074	4.2367	2	994.42773	994.4277	K	T	59	68
PSM	SRSEQLTDR	4297	sp|P43304|GPDM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1514	2.563	2	1090.5367	1090.5367	K	S	607	616
PSM	SSQPDPDKNPASSK	4298	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2043	3.3963	3	1456.6794	1456.6794	K	R	1617	1631
PSM	SSTPRESPCGK	4299	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	9-UNIMOD:4	ms_run[2]:scan=1086	1.9528	2	1204.5506	1204.5506	R	I	2456	2467
PSM	SSVGAGEPR	4300	sp|P51610-2|HCFC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2063	3.4116	2	858.41954	858.4195	R	M	1176	1185
PSM	STQDEINQAR	4301	sp|Q9UBC2-4|EP15R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2927	4.1181	2	1160.5422	1160.5422	K	S	535	545
PSM	SYDDAESLK	4302	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4794	5.7547	2	1026.4506	1026.4506	K	T	537	546
PSM	TALETESQDSAEPSGSEEESDPVSLEREDK	4303	sp|P48681|NEST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12245	12.787	3	3250.4121	3250.4121	K	V	1483	1513
PSM	TEQEDVLAK	4304	sp|Q08499-5|PDE4D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4582	5.5736	2	1031.5135	1031.5135	K	E	86	95
PSM	TETKPSVTEK	4305	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1978	3.3471	3	1118.5819	1118.5819	K	E	596	606
PSM	TEYDAVAEK	4306	sp|Q9NTJ3-2|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3991	5.0386	2	1024.4713	1024.4713	K	A	868	877
PSM	TGTFREDTDDTER	4307	sp|P40818|UBP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2912	4.1033	2	1541.6594	1541.6594	R	N	616	629
PSM	TLGMAEEDEEE	4308	sp|Q13505-3|MTX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9812	10.52	2	1251.4813	1251.4813	R	-	307	318
PSM	TLSDVEDQK	4309	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3777	4.8403	2	1033.4928	1033.4928	K	E	166	175
PSM	TPVASDQR	4310	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1804	3.0901	2	872.43519	872.4352	K	R	588	596
PSM	TRDDGDEEGLLTHSEEELEHSQDTDADDGALQ	4311	sp|Q9UKM9-2|RALY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=18623	19.446	3	3526.4728	3526.4728	R	-	259	291
PSM	TRDDGDEEGLLTHSEEELEHSQDTDADDGALQ	4312	sp|Q9UKM9-2|RALY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=18653	19.48	5	3526.4728	3526.4728	R	-	259	291
PSM	TVTEIDEK	4313	sp|P61289|PSME3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3458	4.5496	2	933.46549	933.4655	R	E	205	213
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	4314	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=21410	24.166	4	3368.4764	3368.4764	K	E	312	341
PSM	VCQGEREMAGDNK	4315	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	2-UNIMOD:4	ms_run[2]:scan=2007	3.3683	2	1492.6399	1492.6399	K	L	486	499
PSM	VEDVEALDR	4316	sp|P11216|PYGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7570	8.4695	2	1044.5088	1044.5088	R	K	716	725
PSM	VETQTEELK	4317	sp|Q6KC79-3|NIPBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3445	4.5381	2	1075.5397	1075.5397	K	Q	644	653
PSM	VEYSEEELK	4318	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6341	7.294	2	1124.5237	1124.5237	K	T	516	525
PSM	VGNTPETR	4319	sp|Q9Y3B4|SF3B6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1529	2.5831	2	872.43519	872.4352	R	G	50	58
PSM	VQAELDETK	4320	sp|O15498-2|YKT6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3871	4.932	2	1031.5135	1031.5135	K	I	142	151
PSM	YEDQELTGK	4321	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4119	5.1618	2	1081.4928	1081.4928	R	N	580	589
PSM	YYETPEEEREK	4322	sp|Q9Y2K7-3|KDM2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2988	4.166	3	1471.6467	1471.6467	R	L	129	140
PSM	QEEEMMAKEEELVK	4323	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:35	ms_run[1]:scan=7528	8.4287096	3	1738.784117	1737.780103	R	V	843	857
PSM	ELDDATEANEGLSR	4324	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:27	ms_run[1]:scan=14060	14.536231	2	1501.6582	1500.6692	R	E	1906	1920
PSM	TEDESLVENNDNIDEEAREELR	4325	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=17000	17.525617	3	2619.156091	2618.157977	K	E	123	145
PSM	QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR	4326	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28	ms_run[1]:scan=19500	20.702711	4	3557.4620	3557.4603	K	A	737	771
PSM	EVEEDSEDEEMSEDEEDDSSGEEVVIPQK	4327	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:35	ms_run[1]:scan=10817	11.409678	3	3328.331571	3328.294392	K	K	23	52
PSM	EDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	4328	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	33-UNIMOD:35	ms_run[1]:scan=14305	14.763563	3	4007.3722	4006.3352	K	A	143	177
PSM	GLSEDTTEETLK	4329	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=9705	10.427036	2	1321.625519	1321.624906	K	E	578	590
PSM	EIPLSETERGEVEEDK	4330	sp|Q14789|GOGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=9434	10.184179	3	1858.881875	1858.879617	K	E	1026	1042
PSM	CGDLEEELK	4331	sp|P67936-2|TPM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=19389	20.526972	2	1075.4612	1074.4532	K	N	190	199
PSM	CGDLEEELK	4332	sp|P07951|TPM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:4	ms_run[1]:scan=13062	13.59514	2	1092.487640	1091.480490	K	I	190	199
PSM	EDQTEYLEER	4333	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:27	ms_run[1]:scan=7314	8.2284241	2	1293.5772	1292.5512	K	R	187	197
PSM	EDQTEYLEER	4334	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:27	ms_run[1]:scan=11967	12.448947	2	1292.5490	1292.5516	K	R	187	197
PSM	EGLELPEDEEEK	4335	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=20153	21.770312	2	1416.632494	1415.630385	K	K	412	424
PSM	EGLELPEDEEEK	4336	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=16566	17.059298	2	1415.631038	1415.630385	K	K	412	424
PSM	EGLELPEDEEEK	4337	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:27	ms_run[1]:scan=17160	17.689414	2	1397.6190	1397.6193	K	K	539	551
PSM	EDRYEEEIK	4338	sp|P09493-3|TPM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:27	ms_run[1]:scan=6305	7.2616275	2	1191.5396	1191.5403	K	V	218	227
PSM	CAELEEELK	4339	sp|P09493|TPM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:4	ms_run[1]:scan=9315	10.065506	2	1119.511136	1119.511791	K	T	190	199
PSM	GMVAEEIEEEPAAGDDEELEEEAVPQDESSQK	4340	sp|O75691|UTP20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35	ms_run[1]:scan=19283	20.378439	4	3505.500731	3504.473359	K	K	873	905
PSM	EQLGEEIDSK	4341	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:27	ms_run[1]:scan=11710	12.221386	2	1128.5307	1128.5294	K	V	659	669
PSM	EDLQELNDR	4342	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=7220	8.1511843	2	1130.520509	1130.520381	K	L	33	42
PSM	DEPGEQVELKEEAEAPVEDGSQPPPPEPK	4343	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=15238	15.690341	3	3127.455509	3126.451700	K	G	614	643
PSM	EAAQLREER	4344	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:27	ms_run[1]:scan=2124	3.4583614	3	1082.5456	1082.5463	K	L	170	179
PSM	CGCLDEDTQR	4345	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:4	ms_run[1]:scan=8586	9.3810627	2	1235.4539	1235.4542	R	Q	421	431
PSM	MQDIPEETESRDGEAVASES	4346	sp|Q92974|ARHG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35	ms_run[1]:scan=8929	9.6892413	2	2194.919203	2194.917202	R	-	967	987
PSM	EEVQSLREEAEK	4347	sp|Q14980|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:27	ms_run[1]:scan=9355	10.110408	2	1427.6855	1427.6887	R	Q	1292	1304
PSM	TGISEEAAIEENK	4348	sp|Q5UIP0|RIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=8596	9.3884413	2	1389.664056	1389.662354	K	R	1935	1948
PSM	NSGQNLEEDMGQSEQK	4349	sp|Q9HAV7|GRPE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=9174	9.9251793	2	1793.738939	1792.753371	K	A	35	51
PSM	EPVADEEEEDSDDDVEPITEFR	4350	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:27	ms_run[1]:scan=19361	20.484203	3	2548.0642	2546.0452	K	F	92	114
PSM	EREAELGAK	4351	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:27	ms_run[1]:scan=3438	4.5332473	2	983.5053	983.5031	K	A	178	187
PSM	GEDLTEEEDGGIIR	4352	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=15597	16.065365	2	1531.710715	1531.700196	K	R	139	153
PSM	EREAELGAR	4353	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:27	ms_run[1]:scan=3800	4.8609557	2	1011.5085	1011.5092	K	A	178	187
PSM	NFGEDMDDER	4354	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=10367	11.010907	2	1227.435166	1226.450981	K	L	197	207
PSM	DSALVEESNGTLEEK	4355	sp|Q9UJA5|TRM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=12120	12.644716	3	1620.735642	1619.752626	K	Q	281	296
PSM	QGEEEDAEIIVK	4356	sp|Q9UHX1|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28	ms_run[1]:scan=15230	15.682274	2	1341.6290	1341.6295	K	I	503	515
PSM	EKLNGDTEEGFNR	4357	sp|Q9BQ39|DDX50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=5204	6.1150382	2	1508.673512	1507.690300	K	L	68	81
PSM	HQGVMVGMGQKDSYVGDEAQSK	4358	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:35,8-UNIMOD:35	ms_run[1]:scan=3472	4.5615877	2	2382.084352	2382.058010	R	R	42	64
PSM	SQDTEVDMK	4359	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1	ms_run[1]:scan=6541	7.5233696	2	1093.4595	1093.4592	M	E	2	11
PSM	DPEPEDEVPDVK	4360	sp|P82675|RT05_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=11054	11.62153	2	1367.609430	1367.609256	K	L	394	406
PSM	NDFTEEEEAQVRK	4361	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=10566	11.186782	2	1594.727456	1593.727080	K	E	143	156
PSM	DGQVINETSQHHDDLE	4362	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=12116	12.638545	2	1836.793797	1835.792199	R	-	451	467
PSM	DGQVINETSQHHDDLE	4363	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=14166	14.632233	3	1836.795080	1835.792199	R	-	451	467
PSM	DGQVINETSQHHDDLE	4364	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=10848	11.439027	2	1836.785314	1835.792199	R	-	451	467
PSM	VEEVLEEEEEEYVVEK	4365	sp|P83916|CBX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=18748	19.612204	3	1980.883768	1979.909914	K	V	10	26
PSM	PETEEPLWASR	4366	sp|Q9Y2U8|MAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0		ms_run[1]:scan=12805	13.343724	2	1313.6253	1313.6247	D	T	232	243
PSM	DYEEVGVDSVEGEGEEEGEEY	4367	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=23543	29.174726	3	2347.901054	2347.897571	K	-	431	452
PSM	ELEPEAAEEALENGPK	4368	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=17643	18.272528	3	1725.793225	1724.810475	K	E	348	364
PSM	QEQLETARK	4369	sp|P43304|GPDM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28	ms_run[1]:scan=3971	5.0224247	2	1084.5507	1084.5508	K	F	589	598
PSM	QITEEDLEGK	4370	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28	ms_run[1]:scan=14611	15.048971	2	1143.5283	1143.5290	R	T	87	97
PSM	QYMEEENYDK	4371	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28	ms_run[1]:scan=11267	11.811382	2	1330.5018	1330.5018	K	I	303	313
PSM	GGSGSGPTIEEVD	4372	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=10434	11.071332	1	1203.526711	1203.525526	K	-	629	642
PSM	QLDDKDEEINQQSQLVEK	4373	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=9660	10.387294	3	2159.023420	2158.038971	K	L	431	449
PSM	NPDTIEQCR	4374	sp|Q9Y282|ERGI3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:4	ms_run[1]:scan=3065	4.2285185	2	1131.497886	1131.497872	K	R	175	184
PSM	AAPTAASDQPDSAATTEK	4375	sp|Q9BRP8|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=3408	4.5084514	3	1732.801464	1730.795888	R	A	133	151
PSM	DGRYCQEPR	4376	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:4	ms_run[1]:scan=2118	3.4543866	2	1180.511155	1179.509105	K	G	567	576
PSM	NGHDPGRGHQDLDPDNEGELR	4377	sp|Q9ULF5|S39AA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=5216	6.1260509	3	2328.016633	2327.027512	R	H	286	307
PSM	QEEASGGPTAPK	4378	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28	ms_run[1]:scan=4412	5.411735	2	1153.5264	1153.5246	K	A	241	253
PSM	EALQEADVAK	4379	sp|Q8TDM6|DLG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=5272	6.1753646	2	1072.541435	1072.540054	K	C	511	521
PSM	QAAEVAAEK	4380	sp|Q9NW64|RBM22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28	ms_run[1]:scan=5335	6.2328086	2	898.4397	898.4391	R	S	278	287
PSM	EAALVQQEEEK	4381	sp|Q15020|SART3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:27	ms_run[1]:scan=11639	12.157799	2	1254.6074	1254.6087	K	A	587	598
PSM	AAPPEPGEPEER	4382	sp|Q5RI15|COX20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1	ms_run[1]:scan=8648	9.4356351	2	1319.5989	1319.5988	M	K	2	14
PSM	EVMSDLEESK	4383	sp|Q01433|AMPD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:27	ms_run[1]:scan=15011	15.436711	2	1147.5119	1147.5062	K	Y	524	534
PSM	VGGTSDVEVNEK	4384	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=14880	15.309317	2	1232.587639	1232.588461	K	K	406	418
PSM	GDVEEDETIPDSEQDIRPR	4385	sp|Q92973|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=12212	12.746205	2	2199.983240	2198.992750	K	F	328	347
PSM	MMEDDGQPR	4386	sp|Q01085|TIAR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1	ms_run[1]:scan=9438	10.18709	2	1119.4317	1119.4320	-	T	1	10
PSM	NENGAPEDEENFEEAIK	4387	sp|Q13564|ULA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=16019	16.51176	2	1934.802968	1933.817745	K	N	254	271
PSM	YDYEEVEAEGANK	4388	sp|P36871|PGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=10685	11.294007	2	1515.646659	1515.636533	R	M	428	441
PSM	ANDDVAQEIAER	4389	sp|Q8NBL1|PGLT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=10043	10.721098	2	1329.616198	1329.616073	K	G	330	342
PSM	DINESDEVEVYSR	4390	sp|Q06787|FMR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=14026	14.502825	2	1553.686359	1553.684546	K	A	58	71
PSM	AVANYDSVEEGEK	4391	sp|P51659|DHB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=6938	7.895601	2	1410.616086	1409.631054	K	V	69	82
PSM	EVCPSAIDPEDGEK	4392	sp|Q9H1Y0|ATG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:27,3-UNIMOD:4	ms_run[1]:scan=15322	15.772971	2	1527.6582	1526.6552	K	K	221	235
PSM	MEEDEFIGEK	4393	sp|Q9H0Y0|ATG10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=18709	19.543919	2	1284.5532	1283.5222	-	T	1	11
PSM	GATRPNGPNTGNK	4394	sp|P20339|RAB5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1337	2.3391233	2	1283.622181	1282.637811	R	I	5	18
PSM	SATAAARK	4395	sp|O43818|U3IP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1	ms_run[1]:scan=389	0.61058145	2	816.4451	816.4448	M	R	2	10
PSM	SSGPGGQNVNK	4396	sp|Q14197|ICT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=184	0.20826607	2	1043.501237	1043.499586	R	V	84	95
PSM	YDDEEFEYR	4397	sp|P61024|CKS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=10961	11.539822	2	1265.491772	1264.488412	K	H	12	21
PSM	EAAFDDAVEER	4398	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:27	ms_run[1]:scan=9107	9.8511264	2	1232.5300	1232.5304	K	V	5	16
PSM	CEDLETQTQSEK	4399	sp|O00592|PODXL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=9600	10.334329	2	1449.5772	1449.5922	K	Q	344	356
PSM	EYLEAEENGDLER	4400	sp|Q96DF8|ESS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=11318	11.856076	2	1565.681766	1565.684546	K	M	67	80
PSM	MTSEVIEDEK	4401	sp|Q9BV86|NTM1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=15211	15.665726	2	1238.5692	1237.5382	-	Q	1	11
PSM	QSEQLDVEK	4402	sp|Q8IWJ2|GCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28	ms_run[1]:scan=8835	9.6050478	2	1057.4918	1057.4922	K	E	1029	1038
PSM	MDTAEEDICR	4403	sp|O60337|MARH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:4	ms_run[1]:scan=14741	15.171302	2	1297.5252	1296.4952	-	V	1	11
PSM	RNTLNEDDMEK	4404	sp|Q9P2D3|HTR5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=2875	4.0713721	2	1363.628223	1363.603793	K	E	1680	1691
PSM	CLDENLEDASQCK	4405	sp|Q5JTJ3|COA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=10693	11.300051	2	1581.629917	1580.644672	K	K	68	81
PSM	CEVFDDEEESK	4406	sp|Q96G28|CFA36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=15007	15.431728	2	1368.5034	1368.5022	K	L	37	48
PSM	EYDELAETQGK	4407	sp|O60341|KDM1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:27	ms_run[1]:scan=12907	13.438789	2	1263.5610	1263.5614	K	L	493	504
PSM	EMFEDTVEER	4408	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35	ms_run[1]:scan=9831	10.536182	2	1299.530000	1299.528897	K	V	5	15
PSM	LCSSSSSDTSSR	4409	sp|Q86WB0|NIPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4	ms_run[1]:scan=239	0.29913919	2	1273.529087	1272.525209	R	S	405	417
PSM	AVDPEDDFQR	4410	sp|Q99848|EBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=8472	9.2833961	2	1190.520497	1190.520381	K	E	95	105
PSM	DADIGVAEAER	4411	sp|Q14254|FLOT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=8086	8.9389662	2	1145.543772	1144.536031	R	D	178	189
PSM	EEEAIALAEK	4412	sp|P51159|RB27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:27	ms_run[1]:scan=16934	17.448351	2	1083.5448	1083.5443	K	Y	145	155
PSM	MEGVEEK	4413	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1	ms_run[1]:scan=7696	8.5868243	1	862.3738	862.3737	-	K	1	8
PSM	TEADVNPK	4414	sp|P55769|NH2L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1	ms_run[1]:scan=4820	5.7773004	2	914.4343	914.4340	M	A	2	10
PSM	KEESLTER	4415	sp|Q9Y2R4|DDX52_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=819	1.4966665	2	990.498970	990.498189	K	K	74	82
PSM	LNHQEVVEEDK	4416	sp|O95926|SYF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=2584	3.8246115	3	1339.637386	1338.641559	K	R	50	61
PSM	ACEAFEAQECER	4417	sp|Q9H939|PPIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=5675	6.6824877	2	1498.562526	1498.581678	K	I	212	224
PSM	LGDSESVSK	4418	sp|Q13576|IQGA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=2463	3.7261511	2	921.446419	920.445091	K	V	506	515
PSM	AMAAEAEASR	4419	sp|P27105|STOM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35	ms_run[1]:scan=1662	2.8399771	2	1023.464904	1021.449859	R	E	206	216
PSM	KVIEEEQR	4420	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1923	3.3041552	2	1030.548959	1029.545474	K	L	1088	1096
PSM	DGGNQEVEIAR	4421	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=6339	7.2925951	2	1187.541108	1186.557829	K	C	319	330
PSM	EREGLENDLK	4422	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=4204	5.2354206	3	1202.577858	1201.593881	K	S	565	575
PSM	TNEAQAIETAR	4423	sp|P61088|UBE2N_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=6287	7.2468464	2	1203.570604	1202.589129	K	A	131	142
PSM	NGYEYEESTK	4424	sp|O75717|WDHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=5153	6.0691897	2	1219.487391	1218.504062	K	N	745	755
PSM	AAAPAPEEEMDECEQALAAEPK	4425	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[1]:scan=12973	13.51142	3	2372.015323	2372.014808	K	A	254	276
PSM	ENRDIEISTEEEK	4426	sp|Q4G0J3|LARP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=5041	5.967325	3	1591.741018	1590.737310	K	D	330	343
PSM	ENGINGELTSADRETAEEVSAR	4427	sp|P11137|MTAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=16726	17.221216	3	2349.058345	2347.088775	K	I	72	94
PSM	NSFREQLEEEEEAK	4428	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=15965	16.454091	2	1736.786466	1736.785323	K	H	1339	1353
PSM	ADAENAMR	4429	sp|A6PVI3|NCB2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2145	3.4748	2	876.37597	876.3760	R	F	90	98
PSM	ADTNQLADK	4430	sp|O43493|TGON2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2382	3.6624	2	974.46689	974.4669	K	G	278	287
PSM	ADVDMVDK	4431	sp|Q9P2R3|ANFY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4757	5.722	2	891.40078	891.4008	K	S	280	288
PSM	AEAHHAEL	4432	sp|Q99470|SDF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=77	0.069155	2	876.40898	876.4090	K	-	204	212
PSM	AEVHPAGDTAK	4433	sp|Q14789-4|GOGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=414	0.66046	2	1094.5356	1094.5356	R	E	1626	1637
PSM	AGKVEAEVK	4434	sp|Q9NTJ3-2|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=1232	2.1963	2	929.5182	929.5182	K	R	877	886
PSM	ASELAETPKEEK	4435	sp|Q9H6E5|STPAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2778	3.987	2	1330.6616	1330.6616	K	A	323	335
PSM	ATEMVEVGADDDEGGAERGEAGDLR	4436	sp|Q6NZI2|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16258	16.743	3	2548.0984	2548.0984	K	R	338	363
PSM	ATEMVEVGADDDEGGAERGEAGDLR	4437	sp|Q6NZI2|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14578	15.018	3	2548.0984	2548.0984	K	R	338	363
PSM	ATLEQDSAK	4438	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2151	3.4786	2	961.47164	961.4716	K	K	1085	1094
PSM	ATNNSLER	4439	sp|P45974-2|UBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=201	0.23633	2	903.44101	903.4410	R	A	724	732
PSM	AVDPEDDFQR	4440	sp|Q99848|EBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8221	9.0561	2	1190.5204	1190.5204	K	E	95	105
PSM	AVEEMNGK	4441	sp|Q13310-2|PABP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2023	3.381	2	876.40112	876.4011	K	E	247	255
PSM	CDTEDDCGDHSDEPPDCPEFK	4442	sp|Q07954|LRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:4,7-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=8235	9.0669	3	2523.8737	2523.8737	K	C	3353	3374
PSM	CNMFDDCGDGSDEEDCSIDPK	4443	sp|Q07954|LRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:4,7-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=14309	14.767	3	2464.84	2464.8400	R	L	3761	3782
PSM	DAINQGMDEELERDEK	4444	sp|P11177-3|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12599	13.152	3	1890.8265	1890.8265	R	V	37	53
PSM	DALEPGQR	4445	sp|P07741-2|APT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3345	4.4597	2	884.43519	884.4352	K	V	115	123
PSM	DDDDEEIGGPKEELIPEK	4446	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14246	14.709	4	2026.9219	2026.9219	K	L	629	647
PSM	DDDDVVIGK	4447	sp|O15144|ARPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7199	8.1318	2	974.45566	974.4557	K	V	171	180
PSM	DDDIDIDAI	4448	sp|P55010|IF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=20958	23.212	1	1003.4346	1003.4346	K	-	423	432
PSM	DDDLVEFSDLESEDDERPR	4449	sp|Q9HCK8-2|CHD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=19559	20.789	3	2279.9666	2279.9666	K	S	1134	1153
PSM	DDEEMDIDTVK	4450	sp|O95149|SPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11200	11.751	3	1308.5391	1308.5391	K	K	82	93
PSM	DDEVAQLK	4451	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5990	6.9968	2	916.45018	916.4502	K	K	311	319
PSM	DDNPHLK	4452	sp|Q9HAV7|GRPE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=639	1.0864	2	837.39808	837.3981	K	N	132	139
PSM	DDQLLDDGK	4453	sp|Q15370-2|ELOB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6782	7.752	2	1017.4615	1017.4615	K	T	47	56
PSM	DEEMGSLQDR	4454	sp|Q6ZU80-1|CE128_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6107	7.0914	2	1178.4874	1178.4874	K	V	945	955
PSM	DEISSVQK	4455	sp|Q2KHR3-2|QSER1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3391	4.4949	2	904.45018	904.4502	K	K	1449	1457
PSM	DELEQELQK	4456	sp|Q9Y4B5|MTCL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9685	10.41	2	1130.5455	1130.5455	K	Y	531	540
PSM	DELPERQPR	4457	sp|P60983|GMFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3027	4.198	3	1138.5731	1138.5731	K	F	59	68
PSM	DEPGEQVELK	4458	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7532	8.4336	2	1142.5455	1142.5455	K	E	614	624
PSM	DGDAEEVRELGTVEEN	4459	sp|Q14699|RFTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13647	14.146	3	1760.7701	1760.7701	R	-	563	579
PSM	DGEDLMDESVLK	4460	sp|Q13616|CUL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:35	ms_run[2]:scan=12406	12.959	2	1365.597	1365.5970	K	F	106	118
PSM	DGETLTTK	4461	sp|P10109|ADX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2686	3.9134	2	863.42363	863.4236	R	G	75	83
PSM	DGQVINETSQHHDDLE	4462	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17779	18.43	3	1835.7922	1835.7922	R	-	451	467
PSM	DGQVINETSQHHDDLE	4463	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16172	16.658	3	1835.7922	1835.7922	R	-	451	467
PSM	DGRYTDATSK	4464	sp|Q13217|DNJC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=1351	2.3579	3	1112.5098	1112.5098	R	Y	281	291
PSM	DIEISTEEEK	4465	sp|Q4G0J3|LARP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8472	9.2834	2	1191.5507	1191.5507	R	D	333	343
PSM	DIMEDTIEDK	4466	sp|P61764|STXB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13283	13.804	2	1207.5278	1207.5278	K	L	484	494
PSM	DITQDNSELK	4467	sp|Q6NXT6-2|TAPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5753	6.7469	2	1161.5513	1161.5513	K	H	536	546
PSM	DLEGSDIDTR	4468	sp|P55060|XPO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6450	7.426	2	1119.5044	1119.5044	R	R	373	383
PSM	DLSEVSETTESTDVK	4469	sp|P41227-2|NAA10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11641	12.159	3	1638.7472	1638.7472	K	D	196	211
PSM	DPEPEDEVPDVK	4470	sp|P82675|RT05_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10923	11.505	3	1367.6093	1367.6093	K	L	394	406
PSM	DQALTEEHAR	4471	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2481	3.7407	3	1168.5473	1168.5473	R	Q	615	625
PSM	DSLDPDPR	4472	sp|O43379|WDR62_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4905	5.8523	2	913.41412	913.4141	K	C	818	826
PSM	DTEEMLSK	4473	sp|Q9H444|CHM4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5292	6.1916	2	951.42191	951.4219	R	K	31	39
PSM	DVGSLDEK	4474	sp|Q99584|S10AD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4004	5.048	1	861.40798	861.4080	K	M	52	60
PSM	DWTEEDRAR	4475	sp|Q8N3F8|MILK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3958	5.009	2	1176.516	1176.5160	K	E	772	781
PSM	EAEIEYRER	4476	sp|Q6PML9|ZNT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3393	4.4964	2	1193.5677	1193.5677	K	L	196	205
PSM	EAETQRLK	4477	sp|Q7Z4Q2-3|HEAT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=246	0.31233	2	973.51926	973.5193	K	T	211	219
PSM	EAGGGGVGGPGAK	4478	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2006	3.3676	2	1012.4938	1012.4938	K	S	40	53
PSM	EATPAENVAK	4479	sp|Q7L8L6|FAKD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2911	4.1025	2	1028.5138	1028.5138	R	L	606	616
PSM	EAVAMESYAK	4480	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:35	ms_run[2]:scan=3320	4.4405	2	1113.5012	1113.5012	K	A	385	395
PSM	ECVQPATK	4481	sp|P16615-4|AT2A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	2-UNIMOD:4	ms_run[2]:scan=2060	3.4097	2	931.44332	931.4433	K	S	969	977
PSM	EDQLEYQEEMK	4482	sp|Q9BZ29-3|DOCK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9104	9.8469	2	1440.6079	1440.6079	K	A	2032	2043
PSM	EDTSNINPR	4483	sp|Q99550-2|MPP9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2802	4.0081	2	1044.4836	1044.4836	K	Q	918	927
PSM	EEDGVDTIEEDLTR	4484	sp|Q86X53|ERIC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=19565	20.797	3	1619.7162	1619.7162	R	A	271	285
PSM	EEEAIALAEK	4485	sp|P51159|RB27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9497	10.237	2	1101.5554	1101.5554	K	Y	145	155
PSM	EEEISNLK	4486	sp|Q13464|ROCK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5148	6.0654	2	960.47639	960.4764	K	A	978	986
PSM	EEEMEGDYQETWK	4487	sp|Q14241|ELOA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11793	12.296	3	1672.6563	1672.6563	K	A	131	144
PSM	EEFVEEIK	4488	sp|Q15326-4|ZMY11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11910	12.401	2	1021.4968	1021.4968	K	K	483	491
PSM	EEGEAFAR	4489	sp|Q8WUD1-2|RAB2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3568	4.6471	2	907.40356	907.4036	R	E	67	75
PSM	EELEEICK	4490	sp|Q15020-4|SART3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:4	ms_run[2]:scan=6780	7.7506	2	1048.4747	1048.4747	K	A	779	787
PSM	EENNHLQEELER	4491	sp|Q15643-2|TRIPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6089	7.0764	3	1538.6961	1538.6961	K	L	831	843
PSM	EEQIEELK	4492	sp|Q15643-2|TRIPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6476	7.4511	2	1016.5026	1016.5026	K	R	1715	1723
PSM	EEQREELLHEPQDVDK	4493	sp|Q5T5Y3-2|CAMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7121	8.0581	4	1992.9389	1992.9389	K	E	683	699
PSM	EFQSPDEEMK	4494	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	9-UNIMOD:35	ms_run[2]:scan=3893	4.9502	2	1254.5074	1254.5074	R	K	776	786
PSM	EFQSPDEEMK	4495	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6987	7.937	2	1238.5125	1238.5125	R	K	776	786
PSM	EGEDSSVIHYDDK	4496	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5758	6.7539	3	1492.6318	1492.6318	K	A	1240	1253
PSM	EGLELPEDEEEK	4497	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12398	12.951	3	1415.6304	1415.6304	K	K	547	559
PSM	EGQPIPESGDPK	4498	sp|Q96FS4|SIPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4598	5.5864	2	1252.5935	1252.5935	R	G	949	961
PSM	EGSDHSSSFESK	4499	sp|Q92576-2|PHF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=1650	2.8139	2	1295.5266	1295.5266	R	Y	612	624
PSM	ELEAELEDERK	4500	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7144	8.0812	3	1359.6518	1359.6518	R	Q	1600	1611
PSM	EMDYETEVEMEK	4501	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	2-UNIMOD:35	ms_run[2]:scan=10354	10.999	2	1547.6007	1547.6007	R	G	678	690
PSM	EMFEDTVEER	4502	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	2-UNIMOD:35	ms_run[2]:scan=7455	8.3523	2	1299.5289	1299.5289	K	V	5	15
PSM	EMFEDTVEER	4503	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	2-UNIMOD:35	ms_run[2]:scan=8001	8.8593	2	1299.5289	1299.5289	K	V	5	15
PSM	EMFEDTVEER	4504	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	2-UNIMOD:35	ms_run[2]:scan=11192	11.745	2	1299.5289	1299.5289	K	V	5	15
PSM	ENASQCFEK	4505	sp|Q6PD62|CTR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:4	ms_run[2]:scan=2958	4.1404	2	1111.4604	1111.4604	K	V	358	367
PSM	ENLEDEYEPR	4506	sp|P49643-2|PRI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9046	9.7935	2	1292.5521	1292.5521	R	R	87	97
PSM	EPAGLEEEEVSR	4507	sp|P10074|TZAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7277	8.1985	2	1343.6205	1343.6205	K	T	144	156
PSM	EPQLSEACGPTEEGAGER	4508	sp|Q8TER5-4|ARH40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	8-UNIMOD:4	ms_run[2]:scan=8113	8.9624	2	1915.8218	1915.8218	K	E	455	473
PSM	EQLGEEIDSK	4509	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6301	7.259	2	1146.5404	1146.5404	K	V	659	669
PSM	ERIALEEDER	4510	sp|Q8N3D4|EH1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5147	6.0648	3	1258.6153	1258.6153	K	L	1489	1499
PSM	ERPDVGR	4511	sp|Q96MW5|COG8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=746	1.333	2	827.42496	827.4250	R	Y	42	49
PSM	ESIESEIR	4512	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7371	8.2781	2	961.47164	961.4716	R	R	701	709
PSM	ESMQMQVEAER	4513	sp|Q9UJZ1|STML2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:35	ms_run[2]:scan=4946	5.8877	2	1352.57	1352.5701	K	R	188	199
PSM	ETVEGLQDK	4514	sp|Q9UDT6-2|CLIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4418	5.4157	2	1017.4979	1017.4979	K	L	788	797
PSM	EVEDTSFDK	4515	sp|Q9BVV6-2|TALD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4728	5.6951	2	1068.4611	1068.4611	K	Q	325	334
PSM	EVMSDLEESK	4516	sp|Q01433-3|AMPD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7515	8.417	2	1165.5173	1165.5173	K	Y	405	415
PSM	EVMVDDR	4517	sp|P51149|RAB7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3633	4.7029	1	862.38547	862.3855	K	L	49	56
PSM	EWQELDDAEK	4518	sp|Q13200-2|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10219	10.878	2	1261.5463	1261.5463	K	V	10	20
PSM	FDVDAADEK	4519	sp|Q9H0D6-2|XRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6670	7.6459	2	1008.44	1008.4400	K	F	449	458
PSM	FEEQGDFESEK	4520	sp|Q9BZF1-3|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6932	7.8913	2	1343.5517	1343.5517	K	L	633	644
PSM	GADINAPDK	4521	sp|P58546|MTPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2929	4.1194	2	899.43486	899.4349	K	H	58	67
PSM	GAEGDLAPER	4522	sp|O95428-4|PPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4081	5.1259	2	1013.4778	1013.4778	R	L	258	268
PSM	GNDIDPEAVK	4523	sp|P08581|MET_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5941	6.9487	2	1056.5088	1056.5088	K	G	862	872
PSM	GQALEPTESK	4524	sp|Q92570|NR4A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3124	4.2774	2	1058.5244	1058.5244	K	V	573	583
PSM	GQGPGEVDPK	4525	sp|P17568|NDUB7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2609	3.8463	2	982.47197	982.4720	K	V	125	135
PSM	GQREEVEQMK	4526	sp|Q9NZL4-2|HPBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2386	3.665	3	1232.5819	1232.5819	R	S	85	95
PSM	GSDEENLDSETSASTESLLEER	4527	sp|Q13459-2|MYO9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17895	18.552	3	2397.0303	2397.0303	R	A	1991	2013
PSM	HIAEEADR	4528	sp|P06753|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=660	1.1343	2	939.44101	939.4410	K	K	154	162
PSM	HTIPEEETHR	4529	sp|Q70J99-2|UN13D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2119	3.4551	2	1247.5895	1247.5895	R	T	163	173
PSM	IEEEEQEPEPPEPFEYIDD	4530	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=22778	27.172	3	2332.9747	2332.9747	K	-	904	923
PSM	IEEELGSK	4531	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3630	4.7008	2	903.45493	903.4549	R	A	320	328
PSM	IESEEFK	4532	sp|Q53S33|BOLA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4353	5.3642	1	880.41781	880.4178	K	E	67	74
PSM	KDDENIPMETEETHLEETTESQQNGEEGTSTPEDK	4533	sp|Q969G3-3|SMCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13241	13.764	4	3976.6764	3976.6764	K	E	263	298
PSM	KHDNETNLSTEK	4534	sp|O60333-3|KIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=64	0.057749	2	1414.6688	1414.6688	K	V	229	241
PSM	KTDVAECGPGGS	4535	sp|Q9NPI1|BRD7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:4	ms_run[2]:scan=2601	3.8366	2	1176.5081	1176.5081	K	-	640	652
PSM	KVGEIEDK	4536	sp|Q14789-4|GOGB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=1518	2.569	2	916.48656	916.4866	K	L	2597	2605
PSM	KVSENNETIK	4537	sp|P30414|NKTR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=1893	3.2643	2	1160.6037	1160.6037	K	D	1043	1053
PSM	LDTDDLDEIEK	4538	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14608	15.047	3	1304.5984	1304.5984	R	I	357	368
PSM	LEAIEDDSVK	4539	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8969	9.7252	2	1117.5503	1117.5503	K	E	180	190
PSM	LEEFEEK	4540	sp|Q9NSV4-2|DIAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5208	6.1181	1	922.42838	922.4284	K	A	239	246
PSM	LEVAEAEEEETSIK	4541	sp|O15213|WDR46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17170	17.701	2	1575.7516	1575.7516	R	A	132	146
PSM	LQEELSENDK	4542	sp|O95347-2|SMC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4467	5.4666	2	1203.5619	1203.5619	K	K	263	273
PSM	LSVEESEAAGDGVDTK	4543	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9193	9.9433	3	1605.737	1605.7370	K	V	427	443
PSM	MEGGTENDLR	4544	sp|Q9BXP5-5|SRRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:35	ms_run[2]:scan=2499	3.756	2	1136.4768	1136.4768	K	I	221	231
PSM	MEQELEAR	4545	sp|Q92805|GOGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3974	5.0244	2	1004.4597	1004.4597	K	T	198	206
PSM	MKEQEDLAK	4546	sp|Q9NP61-2|ARFG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:35	ms_run[2]:scan=1255	2.2232	2	1106.5278	1106.5278	K	V	211	220
PSM	MLAEDELR	4547	sp|P61204-2|ARF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:35	ms_run[2]:scan=6321	7.2773	2	991.46445	991.4644	R	D	73	81
PSM	NEEDDMVEMEEERLR	4548	sp|P80303-2|NUCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	9-UNIMOD:35	ms_run[2]:scan=14810	15.234	3	1938.7935	1938.7935	K	M	282	297
PSM	NFGEDMDDER	4549	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:35	ms_run[2]:scan=3659	4.7283	2	1242.4459	1242.4459	K	L	197	207
PSM	NFGEDMDDERLK	4550	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:35	ms_run[2]:scan=5089	6.0123	3	1483.6249	1483.6249	K	D	197	209
PSM	NIEEHASADVEK	4551	sp|P61006-2|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3807	4.8681	3	1340.6208	1340.6208	R	M	105	117
PSM	NLEELEEK	4552	sp|Q9UN86-2|G3BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6969	7.9223	2	1002.487	1002.4870	K	S	217	225
PSM	NPDEIDETTELSS	4553	sp|P17301|ITA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13128	13.661	2	1448.6155	1448.6155	K	-	1169	1182
PSM	NSEDLVNAEEK	4554	sp|P54750-8|PDE1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5214	6.1226	2	1246.5677	1246.5677	K	H	495	506
PSM	NSFREQLEEEEEAK	4555	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21215	23.741	3	1736.7853	1736.7853	K	H	1339	1353
PSM	QEMQEVQSSR	4556	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:35	ms_run[2]:scan=1727	2.9694	2	1236.5405	1236.5405	R	S	179	189
PSM	QEMQEVQSSR	4557	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2667	3.896	3	1220.5455	1220.5456	R	S	179	189
PSM	QGTEIDGR	4558	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2222	3.5355	2	874.41446	874.4145	K	S	450	458
PSM	QISNEVDSEDLK	4559	sp|Q8NEZ4-3|KMT2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7596	8.4977	2	1375.6467	1375.6467	K	M	618	630
PSM	QQQEQQLAR	4560	sp|Q9UPQ9|TNR6B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2261	3.5638	2	1127.5683	1127.5683	R	M	1307	1316
PSM	QSDLVDDTSEELK	4561	sp|Q96QT4|TRPM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17759	18.408	2	1477.6784	1477.6784	K	Q	668	681
PSM	QTKPAEAPR	4562	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14	0.01853	2	996.53524	996.5352	K	L	1522	1531
PSM	RATVEETAR	4563	sp|Q9UK23|NAGPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=230	0.27849	2	1031.536	1031.5360	R	A	120	129
PSM	RGELDDPEPR	4564	sp|O00418|EF2K_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3299	4.4236	3	1182.5629	1182.5629	K	E	448	458
PSM	RPAEDMEEEQAFK	4565	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7845	8.72	3	1578.6984	1578.6984	K	R	22	35
PSM	RVEIMEEESEQ	4566	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9686	10.411	2	1377.6082	1377.6082	R	-	449	460
PSM	RVEIMEEESEQ	4567	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12826	13.363	2	1377.6082	1377.6082	R	-	449	460
PSM	RVEIMEEESEQ	4568	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9641	10.371	2	1377.6082	1377.6082	R	-	449	460
PSM	SAAETVTK	4569	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=20139	21.75	2	805.41815	805.4181	R	G	21	29
PSM	SASELTAGAEAEAEEVK	4570	sp|Q9H0U9|TSYL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14573	15.012	2	1690.7897	1690.7897	R	T	140	157
PSM	SDEEDFVK	4571	sp|Q15154-4|PCM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5722	6.7203	2	967.41346	967.4135	K	V	1794	1802
PSM	SDLGPCEK	4572	sp|O95232|LC7L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:4	ms_run[2]:scan=2764	3.9774	2	904.39603	904.3960	R	I	53	61
PSM	SDTNNSGPEINK	4573	sp|P42694|HELZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2635	3.8686	2	1274.5739	1274.5739	K	I	1282	1294
PSM	SEQDQAENEGEDSAVLMER	4574	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13052	13.586	3	2135.8913	2135.8913	K	L	522	541
PSM	SNGQTVIEEK	4575	sp|Q14155-1|ARHG7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3261	4.3928	2	1103.5459	1103.5459	K	S	579	589
PSM	SRDLGTQQDSSGK	4576	sp|Q9Y2F5|ICE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=1154	2.0653	3	1377.6484	1377.6484	K	R	1822	1835
PSM	SRGSNLR	4577	sp|P18621|RL17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=22472	26.552	2	788.4253	788.4253	K	V	17	24
PSM	STRSEELTR	4578	sp|Q99933-3|BAG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=1522	2.5751	2	1077.5415	1077.5415	R	S	9	18
PSM	SVEHVSPDTADAESGK	4579	sp|Q8TDY2-2|RBCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3355	4.4687	2	1627.7326	1627.7326	K	E	261	277
PSM	TAGPGTTGQDR	4580	sp|P09629|HXB7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=1455	2.4846	2	1059.4945	1059.4945	K	A	198	209
PSM	TELATQEK	4581	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2267	3.5699	2	918.46583	918.4658	R	V	2388	2396
PSM	TEMIDQEEGIS	4582	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12455	13.013	1	1250.5336	1250.5336	K	-	280	291
PSM	TEMIDQEEGIS	4583	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:35	ms_run[2]:scan=8712	9.4958	2	1266.5286	1266.5286	K	-	280	291
PSM	TGEDEDEEDNDALLK	4584	sp|Q96FV9|THOC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9205	9.9561	3	1691.701	1691.7010	K	E	542	557
PSM	TGYTPDEK	4585	sp|O95139-2|NDUB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2529	3.778	2	909.40798	909.4080	M	L	2	10
PSM	TIDDLEDK	4586	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5555	6.5384	2	947.44476	947.4448	K	L	216	224
PSM	TKPQMQEER	4587	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=1431	2.4595	2	1145.5499	1145.5499	R	R	59	68
PSM	TPEAVQK	4588	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=436	0.70259	2	771.41267	771.4127	R	L	430	437
PSM	TPEAVQK	4589	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=694	1.2086	2	771.41267	771.4127	R	L	430	437
PSM	TSENRAELR	4590	sp|P54760-2|EPHB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=1440	2.4699	2	1074.5418	1074.5418	K	G	487	496
PSM	TVDVAAEK	4591	sp|P82979|SARNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2846	4.0481	2	831.4338	831.4338	K	K	81	89
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	4592	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21177	23.661	4	3368.4764	3368.4764	K	E	312	341
PSM	VDNEFDQR	4593	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3936	4.9913	2	1021.4465	1021.4465	R	L	4256	4264
PSM	VENMSSNQDGNDSDEFM	4594	sp|Q86WR0-2|CCD25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14645	15.081	2	1917.6993	1917.6993	K	-	124	141
PSM	VEVEEDGQLK	4595	sp|Q8NHS0|DNJB8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5318	6.2166	2	1144.5612	1144.5612	R	S	207	217
PSM	VEVEEDGQLK	4596	sp|Q8NHS0|DNJB8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7238	8.1663	2	1144.5612	1144.5612	R	S	207	217
PSM	VEYSEEELK	4597	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6902	7.8611	2	1124.5237	1124.5237	K	T	516	525
PSM	VGGTSDVEVNEK	4598	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15367	15.817	2	1232.5885	1232.5885	K	K	406	418
PSM	VGGTSDVEVNEK	4599	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=19774	21.134	2	1232.5885	1232.5885	K	K	406	418
PSM	YPNPEEGK	4600	sp|Q96G03-2|PGM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3185	4.3321	2	932.42396	932.4240	K	G	154	162
PSM	ELAEQELEK	4601	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:27	ms_run[1]:scan=13037	13.57041	2	1069.5286	1069.5286	R	Q	1825	1834
PSM	EQAELEAAR	4602	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:27	ms_run[1]:scan=8846	9.6153975	2	997.4832	997.4823	K	Q	2100	2109
PSM	QLAAENR	4603	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=774	1.3997439	1	800.414945	800.414066	K	L	861	868
PSM	LSVEESEAAGDGVDTK	4604	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=13679	14.180187	2	1605.738048	1605.736976	K	V	427	443
PSM	ENDKTEEMPNDSVLENK	4605	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=10323	10.968088	3	1991.861410	1990.878965	K	S	486	503
PSM	EVEEDSEDEEMSEDEEDDSSGEEVVIPQKK	4606	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=13691	14.191206	3	3441.399031	3440.394440	K	G	23	53
PSM	NRPDYVSEEEEDDEDFETAVK	4607	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=13063	13.5959	3	2516.058249	2515.051052	K	K	2662	2683
PSM	EQVEEDNEVSSGLK	4608	sp|Q14789|GOGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=7495	8.3980764	2	1563.718526	1561.710761	K	Q	947	961
PSM	CGDLEEELK	4609	sp|P67936-2|TPM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=17300	17.852	2	1074.4528	1074.4534	K	N	190	199
PSM	CGDLEEELK	4610	sp|P67936-2|TPM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=16844	17.347704	2	1074.4528	1074.4534	K	N	190	199
PSM	CGDLEEELK	4611	sp|P67936-2|TPM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=18147	18.855475	2	1074.4525	1074.4534	K	N	190	199
PSM	CGDLEEELK	4612	sp|P67936-2|TPM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=17156	17.686326	2	1074.4528	1074.4534	K	N	190	199
PSM	EDQTEYLEER	4613	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=8332	9.1544787	2	1310.564260	1310.562640	K	R	166	176
PSM	YQGDGIVEDEEETMENNEEK	4614	sp|Q9NYF8|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=15491	15.948928	3	2356.950240	2356.948895	K	K	892	912
PSM	QREEMLEK	4615	sp|Q32MZ4|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=5018	5.9488937	2	1044.4909	1044.4905	K	H	243	251
PSM	EFLEDYDDDRDD	4616	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0		ms_run[1]:scan=13708	14.208007	2	1545.5742	1545.5738	K	P	498	510
PSM	QLEEEQQALQK	4617	sp|P07951|TPM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=16211	16.69725	2	1326.6292	1325.6462	K	K	38	49
PSM	MEVEQEQR	4618	sp|O95613|PCNT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1	ms_run[1]:scan=8165	9.0069848	2	1089.4763	1089.4755	-	R	1	9
PSM	SGMLQAEK	4619	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:35	ms_run[1]:scan=813	1.4840065	2	878.412054	878.416768	K	K	1318	1326
PSM	NEDEEEEEEEKDEAEDLLGR	4620	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=17124	17.64896	3	2406.984296	2405.983032	K	G	434	454
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	4621	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	27-UNIMOD:35	ms_run[1]:scan=20790	22.945448	5	3772.462737	3772.433739	K	A	469	503
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	4622	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	27-UNIMOD:35	ms_run[1]:scan=19073	20.089982	3	3772.447971	3772.433739	K	A	469	503
PSM	QEEEEEEELLPVNGSQEEAKPQVR	4623	sp|Q9NZ53|PDXL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=15229	15.681515	3	2796.299935	2795.309727	K	D	181	205
PSM	NTDEMVELR	4624	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:35	ms_run[1]:scan=8015	8.8716471	2	1122.485567	1121.502289	R	I	38	47
PSM	EAAQLREER	4625	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:27	ms_run[1]:scan=4318	5.3357456	2	1082.5465	1082.5463	K	L	170	179
PSM	DIDIEDLEELD	4626	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0		ms_run[1]:scan=23761	29.784929	2	1317.5827	1317.5818	K	P	655	666
PSM	EELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	4627	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:35	ms_run[1]:scan=14556	14.997471	3	3916.723796	3915.650095	K	G	307	347
PSM	GGMNDDEDFYDEDMGDGGGGSYR	4628	sp|Q9UPT8|ZC3H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:35	ms_run[1]:scan=12754	13.297091	3	2473.854441	2473.854678	K	S	355	378
PSM	GGMNDDEDFYDEDMGDGGGGSYR	4629	sp|Q9UPT8|ZC3H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:35	ms_run[1]:scan=15723	16.194699	3	2474.885722	2473.854678	K	S	355	378
PSM	EKNDIHLDADDPNSADK	4630	sp|Q99590|SCAFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=4619	5.6027103	4	1896.850679	1895.849714	K	H	999	1016
PSM	QELGSPEER	4631	sp|Q92974|ARHG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=7413	8.31322	2	1026.4611	1026.4613	R	L	928	937
PSM	NDQCYDDIR	4632	sp|Q9ULV4|COR1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:4	ms_run[1]:scan=7320	8.2326595	2	1198.456982	1197.472051	K	V	20	29
PSM	ERVEELEHR	4633	sp|Q08379|GOGA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:27	ms_run[1]:scan=4755	5.720661	3	1177.5834	1177.5835	K	C	824	833
PSM	EQISDIDDAVR	4634	sp|P53999|TCP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=12289	12.83406	2	1260.583503	1259.599360	K	K	115	126
PSM	RVQSEEMLEDK	4635	sp|Q8IY37|DHX37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=4113	5.1553359	3	1362.646761	1362.644930	R	W	940	951
PSM	EIGQSVDEVEK	4636	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:27	ms_run[1]:scan=12945	13.478344	2	1213.5818	1213.5821	R	L	2031	2042
PSM	NKYEDEINK	4637	sp|P04264|K2C1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=2785	3.9940262	3	1151.546583	1151.545868	R	R	268	277
PSM	HGDDLRR	4638	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=22752	27.115715	2	867.431119	867.431113	K	T	296	303
PSM	EPVADEEEEDSDDDVEPITEFR	4639	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:27	ms_run[1]:scan=19327	20.428657	3	2548.0642	2546.0452	K	F	92	114
PSM	NFGEEVDDESLK	4640	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=10369	11.012423	2	1380.608281	1380.604505	K	E	197	209
PSM	GEDLTEEEDGGIIR	4641	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=15547	16.00739	2	1531.710715	1531.700196	K	R	139	153
PSM	AADEEAFEDNSEEYIRR	4642	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=11723	12.235074	3	2043.864846	2042.881742	R	D	356	373
PSM	NFGEDMDDER	4643	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=6622	7.6026864	2	1226.448061	1226.450981	K	L	197	207
PSM	QKLEEDAEMK	4644	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=7589	8.4874575	2	1202.5493	1202.5484	K	S	215	225
PSM	GDRSEDFGVNEDLADSDAR	4645	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=13358	13.874019	3	2067.859127	2066.877720	K	A	186	205
PSM	CDDPEEELCHR	4646	sp|Q7Z333|SETX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=10891	11.477372	2	1441.5237	1441.5233	K	R	2622	2633
PSM	HQGVMVGMGQKDSYVGDEAQSK	4647	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=6345	7.2969882	3	2350.033634	2350.068180	R	R	42	64
PSM	QLHDEAR	4648	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=2731	3.9504823	2	850.3926	850.3928	R	K	904	911
PSM	EVEVEVESMDK	4649	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:27	ms_run[1]:scan=17844	18.501642	2	1274.5680	1274.5695	R	A	593	604
PSM	EVEVEVESMDK	4650	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:35	ms_run[1]:scan=10917	11.498911	2	1309.565243	1308.575513	R	A	593	604
PSM	ELRDEEQTAESIK	4651	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=6293	7.2512132	3	1547.752272	1546.747481	K	N	314	327
PSM	PCCAVDPIENEEDR	4652	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,3-UNIMOD:4	ms_run[1]:scan=9934	10.625527	2	1702.694955	1702.692685	K	K	3719	3733
PSM	EPEQLRK	4653	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:27	ms_run[1]:scan=3518	4.6004994	2	880.4763	880.4761	K	L	8	15
PSM	SNDSEEGLEDAVEGADEALQK	4654	sp|Q9NUJ3|T11L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=21696	24.778709	3	2205.939027	2204.955695	K	A	18	39
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	4655	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=14993	15.415171	4	3368.479260	3368.476411	K	E	312	341
PSM	VEYSEEELK	4656	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=7869	8.7397827	2	1124.528395	1124.523735	K	T	557	566
PSM	EDLIREER	4657	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=4138	5.1778768	3	1058.535857	1058.535637	K	S	369	377
PSM	EGVIEPDTDAPQEMGDENAEITEEMMDQANDKK	4658	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	25-UNIMOD:35,26-UNIMOD:35	ms_run[1]:scan=15628	16.096807	3	3710.543888	3710.539348	K	V	86	119
PSM	VEEDDYPSEELLEDENAINAK	4659	sp|Q5JRA6|TGO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=20407	22.195658	3	2422.056691	2421.070725	K	R	720	741
PSM	SYDDAESLK	4660	sp|Q02880|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=4772	5.737027	2	1026.451698	1026.450570	K	T	542	551
PSM	EMDYETEVEMEK	4661	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:35	ms_run[1]:scan=10599	11.217328	2	1547.602679	1547.600742	R	G	678	690
PSM	QEENVDPDYWEK	4662	sp|Q12873|CHD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=17250	17.790548	2	1551.636763	1550.652518	K	L	1309	1321
PSM	MNGDQNSDVYAQEK	4663	sp|P14324-2|FPPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1	ms_run[1]:scan=9880	10.579075	2	1640.6622	1639.6782	-	Q	1	15
PSM	CTEDMTEDELR	4664	sp|Q13148|TADBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=15999	16.48772	2	1380.5162	1380.5168	R	E	198	209
PSM	QQSNEHLR	4665	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=2227	3.5387635	2	993.4629	993.4623	K	R	644	652
PSM	QCADLPEEDEELRK	4666	sp|Q9P253|VPS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,2-UNIMOD:4	ms_run[1]:scan=12259	12.80458	3	1714.7502	1713.7512	K	K	740	754
PSM	QLEVEPEEPEAENK	4667	sp|P36776|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=15729	16.199265	3	1622.7300	1622.7306	R	H	219	233
PSM	EHTGKPTTSSSEACR	4668	sp|O75592|MYCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:4	ms_run[1]:scan=1021	1.8591418	3	1646.735146	1646.731848	R	F	4343	4358
PSM	NGPLNESQEDEEDSEHGTSLNR	4669	sp|Q9H2K8|TAOK3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=8530	9.33206	3	2458.047480	2456.032383	R	E	318	340
PSM	SEMEVQDAELK	4670	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=10568	11.188301	2	1278.576340	1277.580933	K	A	345	356
PSM	TEVCQTCSK	4671	sp|Q9NW64|RBM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1353	2.3594753	2	1111.463947	1111.463795	K	L	68	77
PSM	MADKEAFDDAVEER	4672	sp|Q09028-2|RBBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1	ms_run[1]:scan=9187	9.9388	2	1668.7242	1666.7142	-	V	1	15
PSM	VGGTSDVEVNEK	4673	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=16368	16.850114	2	1232.587589	1232.588461	K	K	406	418
PSM	DQTVSDNELQEMSNQGSK	4674	sp|P10909-6|CLUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0		ms_run[1]:scan=10834	11.426376	2	2009.8562	2008.8642	G	Y	3	21
PSM	EGQGSQTLR	4675	sp|Q6PML9|ZNT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1756	3.0104363	2	974.481314	974.478122	K	V	74	83
PSM	EGVVAAAEK	4676	sp|P37840|SYUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:27	ms_run[1]:scan=7387	8.2899947	2	854.4503	854.4493	K	T	13	22
PSM	DGPGETDAFGNSEGK	4677	sp|O94925|GLSK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=7098	8.0370865	2	1480.597333	1479.611381	K	E	107	122
PSM	EQEETINELR	4678	sp|Q02224|CENPE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=7762	8.6465722	2	1259.598786	1259.599360	K	V	1488	1498
PSM	MESGSTAASEEAR	4679	sp|P10644|KAP0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1	ms_run[1]:scan=6983	7.9341698	2	1366.5652	1366.5665	-	S	1	14
PSM	DAVLDDSTAK	4680	sp|Q9P219|DAPLE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=4777	5.7403811	2	1033.484240	1033.492769	K	L	852	862
PSM	EDIKLEEK	4681	sp|Q9C0J8|WDR33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=3862	4.9203002	2	1002.523997	1002.523341	K	K	527	535
PSM	CSQEDHCLTSDLEDDRK	4682	sp|Q9NZU5|LMCD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=5642	6.6541317	3	2107.859579	2106.858247	K	I	52	69
PSM	QDPQLHPEDPER	4683	sp|Q13084|RM28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=8066	8.9199328	2	1442.6411	1442.6421	R	R	172	184
PSM	DLEPESEPQLESETAGK	4684	sp|Q8TE68|ES8L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=12784	13.325689	2	1857.853357	1857.847983	R	W	465	482
PSM	ETKPEPMEEDLPENK	4685	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:35	ms_run[1]:scan=3051	4.2163743	4	1800.829318	1800.808761	K	K	208	223
PSM	VREEEIEVDSR	4686	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0		ms_run[1]:scan=7973	8.8325014	3	1359.6549	1359.6625	R	V	628	639
PSM	VREEEIEVDSR	4687	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=7857	8.7289743	3	1359.655447	1359.663023	R	V	628	639
PSM	MTDEEIMEK	4688	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35,7-UNIMOD:35	ms_run[1]:scan=6715	7.6885345	2	1156.469775	1156.462792	K	L	227	236
PSM	EAGEDEEGFLSK	4689	sp|Q96EY1|DNJA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:27	ms_run[1]:scan=15171	15.62367	2	1291.5598	1291.5563	R	L	462	474
PSM	CEMEQQNQEYK	4690	sp|P02533|K1C14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4	ms_run[1]:scan=3163	4.3148325	2	1486.572098	1485.586429	R	I	389	400
PSM	CEMEQQNQEYK	4691	sp|P02533|K1C14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=8128	8.975567	2	1468.5597	1468.5594	R	I	389	400
PSM	TAEAGGVTGK	4692	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1114	1.9864002	2	889.451158	889.450511	K	G	88	98
PSM	EETPGTEWEK	4693	sp|P09497|CLCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:27	ms_run[1]:scan=11454	11.98239	2	1186.5130	1186.5137	K	V	185	195
PSM	AESEQEAYLRED	4694	sp|Q9NR28|DBLOH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=7041	7.9828446	2	1438.623093	1438.621218	R	-	228	240
PSM	AEAELHK	4695	sp|Q9Y2D5-4|AKAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1	ms_run[1]:scan=3721	4.7923265	2	838.4184	838.4180	M	E	2	9
PSM	AAAAPDSR	4696	sp|Q9Y3B9|RRP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1	ms_run[1]:scan=3353	4.4672647	2	799.3827	799.3819	M	V	2	10
PSM	EEGLAEETLK	4697	sp|Q2M389|WASC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:27	ms_run[1]:scan=15310	15.761788	2	1099.5405	1099.5392	K	A	959	969
PSM	LPQTSDDEK	4698	sp|Q9GZT3|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=2400	3.6765552	2	1031.478005	1031.477119	K	K	98	107
PSM	SDFDEFER	4699	sp|P26368|U2AF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1	ms_run[1]:scan=14087	14.562696	2	1085.4297	1085.4296	M	Q	2	10
PSM	AETVADTR	4700	sp|O60493|SNX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1	ms_run[1]:scan=6128	7.1084506	2	903.4293	903.4293	M	R	2	10
PSM	AETVADTR	4701	sp|O60493|SNX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1	ms_run[1]:scan=6076	7.0651299	2	903.4293	903.4293	M	R	2	10
PSM	CEDGETFSK	4702	sp|O00622|CCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=8223	9.0576203	2	1054.3912	1054.3908	R	N	337	346
PSM	LEVEREAEK	4703	sp|Q96AG4|LRC59_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=2637	3.8701658	2	1101.567238	1101.566603	R	K	163	172
PSM	LTAEEMDER	4704	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:35	ms_run[1]:scan=4936	5.8782771	2	1108.469700	1108.470654	R	R	26	35
PSM	EAEAAEAEEPWGEEAR	4705	sp|O00255|MEN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=11692	12.205838	2	1774.776347	1772.748937	R	E	466	482
PSM	ERQTALDNEK	4706	sp|Q8TD16|BICD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1730	2.9765762	2	1202.595195	1202.589129	K	D	405	415
PSM	NNFEGEVTK	4707	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=7125	8.0630181	2	1037.467346	1036.482539	R	E	214	223
PSM	NSDEADLVPAK	4708	sp|P83916|CBX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=8631	9.4188809	2	1159.542360	1157.556432	K	E	140	151
PSM	DGGNQEVEIAR	4709	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=6402	7.3600734	2	1187.541108	1186.557829	K	C	319	330
PSM	EGALCEENMR	4710	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:4	ms_run[1]:scan=6496	7.4749173	2	1208.480424	1207.496157	K	G	689	699
PSM	SEMEVQDAELK	4711	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:35	ms_run[1]:scan=9289	10.042024	2	1296.584655	1293.575848	K	A	345	356
PSM	RVEIMEEESEQ	4712	sp|P54578|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:35	ms_run[1]:scan=5144	6.0625947	2	1393.599119	1393.603125	R	-	484	495
PSM	SMYEEEINETR	4713	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=9917	10.610913	2	1400.600085	1399.592560	K	R	210	221
PSM	EMDYETEVEMEK	4714	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:35	ms_run[1]:scan=10775	11.373715	2	1548.602671	1547.600742	R	G	678	690
PSM	AVDLVEEESGAPGEEQR	4715	sp|O60231|DHX16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=11568	12.08642	2	1816.833470	1813.833001	R	R	311	328
PSM	EMFEDTVEER	4716	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:35	ms_run[1]:scan=8395	9.2116121	2	1301.538232	1299.528897	K	V	5	15
PSM	EFLEDYDDDRDDPK	4717	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=11265	11.809926	2	1770.723502	1770.722054	K	Y	498	512
PSM	AALEEVER	4718	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5015	5.947	2	915.46616	915.4662	K	L	1974	1982
PSM	AAQEEYVK	4719	sp|P04075-2|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2610	3.8469	2	936.45526	936.4553	K	R	377	385
PSM	AASDELSK	4720	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2014	3.3752	2	819.39741	819.3974	K	T	785	793
PSM	ADLATDQK	4721	sp|Q13895|BYST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2098	3.4388	1	860.42396	860.4240	K	E	391	399
PSM	ADPQGPELGEACEK	4722	sp|P13682|ZNF35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	12-UNIMOD:4	ms_run[2]:scan=6316	7.2697	2	1499.6562	1499.6562	K	G	145	159
PSM	ADSEQLAR	4723	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2295	3.5936	2	888.43011	888.4301	K	S	922	930
PSM	AEIPCEDEQEQEHNGPLDNK	4724	sp|Q96SB4-4|SRPK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:4	ms_run[2]:scan=7999	8.8559	4	2350.9972	2350.9972	R	G	435	455
PSM	AENSHNAGQVDTR	4725	sp|Q8IWZ3-5|ANKH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=627	1.0702	3	1397.6284	1397.6284	K	S	195	208
PSM	AGTVMEEK	4726	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2318	3.6121	2	863.40587	863.4059	R	D	2243	2251
PSM	ALGQEADK	4727	sp|O94762-4|RECQ5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1177	2.0964	2	830.4134	830.4134	K	G	222	230
PSM	AMQDAEVSK	4728	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:35	ms_run[2]:scan=71	0.064879	2	993.44371	993.4437	K	S	369	378
PSM	ANAEEMTK	4729	sp|Q13547|HDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1284	2.2589	2	892.39603	892.3960	K	Y	59	67
PSM	ANSEHNGPMDGQSGTETK	4730	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	9-UNIMOD:35	ms_run[2]:scan=1352	2.3587	3	1874.7701	1874.7701	K	S	802	820
PSM	AVDEMNGK	4731	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1610	2.7216	2	862.38547	862.3855	K	E	247	255
PSM	AVDQSIEK	4732	sp|Q14108-2|SCRB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2626	3.8623	2	888.45526	888.4553	K	K	32	40
PSM	AVEIDGER	4733	sp|Q9H082|RB33B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3972	5.0231	2	887.43486	887.4349	R	I	74	82
PSM	DAEMNELR	4734	sp|Q8WXE1-2|ATRIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6023	7.0244	2	976.42839	976.4284	K	T	196	204
PSM	DAGREGLR	4735	sp|Q8IX01|SUGP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=328	0.49485	2	872.44643	872.4464	R	S	74	82
PSM	DAMENEMR	4736	sp|Q16891-2|MIC60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4359	5.3683	2	994.38482	994.3848	R	T	462	470
PSM	DEENHEESESLQEDMLGNR	4737	sp|Q8IX12-2|CCAR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13571	14.075	3	2259.9186	2259.9186	K	L	970	989
PSM	DFQEETVK	4738	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5225	6.1327	2	994.46074	994.4607	K	D	973	981
PSM	DGDQGLPK	4739	sp|Q14CZ7|FAKD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3284	4.4111	2	828.39775	828.3977	K	E	144	152
PSM	DGGNQEVEIAR	4740	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6778	7.7493	2	1186.5578	1186.5578	K	C	297	308
PSM	DGQPCMDHDR	4741	sp|Q9P2J5-2|SYLC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:4	ms_run[2]:scan=2111	3.4473	2	1229.4554	1229.4554	K	Q	190	200
PSM	DGQVINETSQHHDDLE	4742	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=17360	17.92	3	1835.7922	1835.7922	R	-	451	467
PSM	DIDENAYAK	4743	sp|Q13200-2|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4969	5.9065	2	1037.4666	1037.4666	K	V	61	70
PSM	DINESDEVEVYSR	4744	sp|Q06787-11|FMR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13986	14.467	2	1553.6845	1553.6845	K	A	58	71
PSM	DIQEDSGMEPR	4745	sp|O75844|FACE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6538	7.5212	2	1275.5401	1275.5401	K	N	293	304
PSM	DISAMEEEK	4746	sp|Q8WYA0-3|IFT81_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6403	7.3608	2	1050.4539	1050.4539	K	D	174	183
PSM	DIVDDNEVR	4747	sp|Q68CP9-3|ARID2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7279	8.2	2	1073.4989	1073.4989	K	D	239	248
PSM	DLADAPAEELQEK	4748	sp|Q96RY5|CRML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13670	14.169	3	1427.678	1427.6780	K	G	631	644
PSM	DLDEDANGITDEGK	4749	sp|Q5QJE6|TDIF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9711	10.432	3	1490.6373	1490.6373	K	E	298	312
PSM	DMEIAQTQK	4750	sp|P27816-6|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:35	ms_run[2]:scan=2557	3.7997	2	1078.4965	1078.4965	K	G	591	600
PSM	DQDEMNLER	4751	sp|A1X283|SPD2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6383	7.3334	2	1148.4768	1148.4768	R	G	236	245
PSM	DSYVGDEAQSK	4752	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20586	22.504	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	4753	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=23309	28.549	2	1197.515	1197.5150	K	R	51	62
PSM	DSYVGDEAQSK	4754	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24213	31.155	2	1197.515	1197.5150	K	R	51	62
PSM	DTEVETLK	4755	sp|Q9H900|ZWILC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5281	6.1817	2	933.46549	933.4655	K	H	319	327
PSM	DTGNIGQER	4756	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2521	3.7728	2	988.45739	988.4574	R	V	1733	1742
PSM	DTQEVPLEK	4757	sp|Q9Y5A9-2|YTHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6621	7.602	2	1057.5292	1057.5292	R	A	478	487
PSM	DVGSLDEK	4758	sp|Q99584|S10AD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4230	5.2588	1	861.40798	861.4080	K	M	52	60
PSM	DYELEAEK	4759	sp|O60437|PEPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6493	7.4728	2	995.44476	995.4448	K	L	800	808
PSM	DYIEEEVIDEK	4760	sp|Q15042-4|RB3GP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16175	16.662	3	1380.6297	1380.6297	R	G	662	673
PSM	DYNDADMAR	4761	sp|Q14696-2|MESD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4380	5.3848	2	1069.4135	1069.4135	R	L	57	66
PSM	EAELDVNEELDK	4762	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12904	13.436	3	1402.6464	1402.6464	K	K	34	46
PSM	EALSEEIK	4763	sp|Q16774|KGUA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6495	7.4742	2	917.47058	917.4706	K	K	183	191
PSM	ECDESGFPK	4764	sp|Q7Z3J2-2|VP35L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4	ms_run[2]:scan=4655	5.6323	2	1067.423	1067.4230	K	H	303	312
PSM	EDAEAPGIR	4765	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4377	5.3829	2	956.45632	956.4563	K	D	227	236
PSM	EDEGVDDVNFRK	4766	sp|O95243-3|MBD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6505	7.4836	3	1421.6423	1421.6423	K	V	216	228
PSM	EDINAIEMEEDK	4767	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12342	12.891	3	1434.6184	1434.6184	K	R	262	274
PSM	EDLEPEIR	4768	sp|Q07687-2|DLX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9493	10.234	2	999.48729	999.4873	K	I	136	144
PSM	EDLVEEIK	4769	sp|P12081-3|HARS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12186	12.72	2	973.49679	973.4968	R	R	432	440
PSM	EDQTEYLEER	4770	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7409	8.3101	3	1310.5626	1310.5626	K	R	192	202
PSM	EEAEIQAELER	4771	sp|Q9UKI8-3|TLK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11815	12.314	2	1315.6256	1315.6256	K	L	196	207
PSM	EEEAIALAEK	4772	sp|P51159|RB27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10081	10.754	2	1101.5554	1101.5554	K	Y	145	155
PSM	EEEAYFER	4773	sp|Q99633|PRP18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7107	8.0438	2	1071.4509	1071.4509	K	C	37	45
PSM	EEEIAELK	4774	sp|Q13136-2|LIPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8039	8.8954	2	959.48114	959.4811	R	A	108	116
PSM	EEGNELVK	4775	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3491	4.5771	2	916.45018	916.4502	K	K	198	206
PSM	EEIQDEEDDDDYVEEGEEEEEEEEGGLRGEK	4776	sp|Q9BTT0-3|AN32E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=22506	26.597	3	3657.4246	3657.4246	K	R	176	207
PSM	EELLEYEEK	4777	sp|P45974-2|UBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11261	11.807	2	1180.5499	1180.5499	K	K	500	509
PSM	EELLHEPQDVDK	4778	sp|Q5T5Y3-2|CAMP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8105	8.9544	3	1450.694	1450.6940	R	E	687	699
PSM	EELSEVPK	4779	sp|Q53SF7|COBL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5716	6.7163	2	929.47058	929.4706	K	V	424	432
PSM	EEMEGVVK	4780	sp|Q9UHD2|TBK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4924	5.87	2	919.43208	919.4321	K	E	695	703
PSM	EEQELMEEINEDEPVK	4781	sp|O14776-2|TCRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	6-UNIMOD:35	ms_run[2]:scan=14283	14.743	3	1975.8568	1975.8568	K	A	588	604
PSM	EEVEDLCR	4782	sp|P54886-2|P5CS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	7-UNIMOD:4	ms_run[2]:scan=5603	6.6027	2	1048.4495	1048.4495	R	L	538	546
PSM	EGCDPVNR	4783	sp|P48147|PPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:4	ms_run[2]:scan=2430	3.6989	2	945.39743	945.3974	R	L	253	261
PSM	EGLELPEDEEEK	4784	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12819	13.356	3	1415.6304	1415.6304	K	K	547	559
PSM	EKEELMER	4785	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2905	4.0986	2	1062.5016	1062.5016	R	L	343	351
PSM	ELAEEAAR	4786	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2971	4.1515	2	887.43486	887.4349	R	L	1766	1774
PSM	ELALEEER	4787	sp|Q14457|BECN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7712	8.6008	2	987.48729	987.4873	K	L	186	194
PSM	ELEQELAEQK	4788	sp|Q8NF91-4|SYNE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7598	8.4992	2	1215.5983	1215.5983	K	S	6165	6175
PSM	ELQEMEAR	4789	sp|Q5F1R6|DJC21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4652	5.6303	2	1004.4597	1004.4597	K	Y	267	275
PSM	ELRDEEQTAESIK	4790	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8169	9.01	3	1546.7475	1546.7475	K	N	314	327
PSM	ELRDEEQTAESIK	4791	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7785	8.6679	3	1546.7475	1546.7475	K	N	314	327
PSM	EMDYETEVEMEK	4792	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13060	13.592	3	1531.6058	1531.6058	R	G	678	690
PSM	EMFEDTVEER	4793	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:35	ms_run[2]:scan=9540	10.279	2	1299.5289	1299.5289	K	V	5	15
PSM	EMFEDTVEER	4794	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11190	11.744	3	1283.534	1283.5340	K	V	5	15
PSM	EMFEDTVEER	4795	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12811	13.35	2	1283.534	1283.5340	K	V	5	15
PSM	EMFEDTVEER	4796	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13355	13.87	2	1283.534	1283.5340	K	V	5	15
PSM	EMFEDTVEER	4797	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12298	12.843	2	1283.534	1283.5340	K	V	5	15
PSM	ENGVNSPR	4798	sp|Q13625-3|ASPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1499	2.5388	2	871.41479	871.4148	K	M	122	130
PSM	EQGDRICR	4799	sp|Q9BR76|COR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	7-UNIMOD:4	ms_run[2]:scan=183	0.20657	2	1032.4771	1032.4771	K	L	469	477
PSM	EQLGEEIDSK	4800	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5703	6.705	2	1146.5404	1146.5404	K	V	659	669
PSM	EQLQRELEEK	4801	sp|Q9NQS7-2|INCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4688	5.6601	3	1300.6623	1300.6623	K	K	745	755
PSM	EQPGEEYSEEEESVLK	4802	sp|Q96PY6-4|NEK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14051	14.525	3	1880.8163	1880.8163	R	N	1050	1066
PSM	ESPQEEEIDPFDVDSGR	4803	sp|Q9UJK0|TSR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=19037	20.038	3	1947.8334	1947.8334	K	E	227	244
PSM	ETQTDSISR	4804	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2385	3.6644	2	1035.4833	1035.4833	K	Y	794	803
PSM	EVEVEVESMDK	4805	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14361	14.814	2	1292.5806	1292.5806	R	A	593	604
PSM	EVEVEVESMDK	4806	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10726	11.331	2	1292.5806	1292.5806	R	A	593	604
PSM	EVSMDDHK	4807	sp|P05023-2|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=360	0.5574	2	959.40185	959.4018	K	L	38	46
PSM	EYFDDSTEER	4808	sp|Q8NEF9|SRFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6900	7.8596	2	1289.5048	1289.5048	K	F	259	269
PSM	FEDEPDLK	4809	sp|Q9UNH6-2|SNX7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7911	8.7768	2	991.44984	991.4498	K	D	23	31
PSM	FEDESFDR	4810	sp|Q7Z304|MAMC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6926	7.8849	2	1043.4196	1043.4196	R	L	106	114
PSM	FEEEELQR	4811	sp|Q8TDD1|DDX54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6302	7.2597	2	1078.4931	1078.4931	R	L	552	560
PSM	FNPDGEEEDVTVQE	4812	sp|Q5SW79-2|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13581	14.084	2	1606.6635	1606.6635	R	-	1447	1461
PSM	FPDEDEILEKDEALEDEDNK	4813	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=18378	19.139	3	2392.0442	2392.0442	K	K	133	153
PSM	GCLDEETSR	4814	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4	ms_run[2]:scan=2925	4.1168	2	1065.4397	1065.4397	R	A	3129	3138
PSM	GDAEKPEEELEEDDDEELDETLSER	4815	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=21464	24.268	3	2920.2105	2920.2105	K	L	23	48
PSM	GDDGPDIADEESRGLEGK	4816	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9977	10.663	3	1858.8181	1858.8181	K	A	1823	1841
PSM	GEEVGELSR	4817	sp|P09543-2|CN37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4698	5.6692	2	974.46689	974.4669	R	G	341	350
PSM	GEIEQERLDK	4818	sp|Q16720-8|AT2B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3181	4.3295	3	1215.6095	1215.6095	K	V	731	741
PSM	GPEADIK	4819	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2645	3.8779	2	728.37047	728.3705	K	G	4752	4759
PSM	GRQEALER	4820	sp|P09884|DPOLA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=486	0.7901	2	957.49919	957.4992	K	L	30	38
PSM	GYDSDPVK	4821	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3321	4.4412	2	879.39741	879.3974	R	A	1081	1089
PSM	HIAEEADR	4822	sp|P06753|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=890	1.6375	2	939.44101	939.4410	K	K	154	162
PSM	HLEPEPEEEIIAEDYDDDPVDYEATR	4823	sp|O60828-10|PQBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20316	22.026	5	3088.3309	3088.3309	K	L	19	45
PSM	IDRTDAISEEK	4824	sp|Q9NR31-2|SAR1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3291	4.4183	2	1275.6307	1275.6307	K	L	93	104
PSM	IEEELGSK	4825	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7727	8.6141	2	903.45493	903.4549	R	A	320	328
PSM	IEEELGSK	4826	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15204	15.658	2	903.45493	903.4549	R	A	320	328
PSM	IGDEDVGR	4827	sp|P23284|PPIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3096	4.254	2	859.40356	859.4036	R	V	52	60
PSM	INPDEREEMK	4828	sp|P48507|GSH0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2747	3.9636	3	1259.5816	1259.5816	K	V	81	91
PSM	INQELEDK	4829	sp|Q9BUH8|BEGIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3125	4.278	2	987.48729	987.4873	R	L	70	78
PSM	IPDPDSDDVSEVDAR	4830	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10983	11.558	3	1628.7166	1628.7166	K	H	690	705
PSM	IQEEELQR	4831	sp|Q9NQZ5|STAR7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4248	5.2756	2	1043.5247	1043.5247	R	S	90	98
PSM	KGYNVNDEK	4832	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1109	1.9769	2	1065.5091	1065.5091	K	A	10	19
PSM	KLEDGPK	4833	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1093	1.9599	2	785.42832	785.4283	K	F	365	372
PSM	KLEDGPK	4834	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=397	0.62668	2	785.42832	785.4283	K	F	365	372
PSM	KLEDGPK	4835	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8952	9.7106	2	785.42832	785.4283	K	F	365	372
PSM	KTPVTEQEEK	4836	sp|Q9NTI5|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1712	2.9449	3	1187.6034	1187.6034	K	L	1219	1229
PSM	LEEMYEER	4837	sp|Q9NS87-2|KIF15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6211	7.1809	2	1097.4699	1097.4699	K	E	1215	1223
PSM	LGREVEEK	4838	sp|P36776-3|LONM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2017	3.3772	2	958.50836	958.5084	R	I	183	191
PSM	LHDELEEAK	4839	sp|O43432-4|IF4G3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3348	4.4618	3	1082.5244	1082.5244	R	D	594	603
PSM	LIDAEEEK	4840	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3951	5.0044	2	945.46549	945.4655	K	R	895	903
PSM	LQAQEHGAER	4841	sp|Q9H5N1-2|RABE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1089	1.955	3	1137.5527	1137.5527	R	L	400	410
PSM	LRAETEQGEQQR	4842	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1995	3.3605	2	1443.7066	1443.7066	R	Q	1686	1698
PSM	MAAETDPHK	4843	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:35	ms_run[2]:scan=1468	2.4981	2	1014.444	1014.4440	K	S	1142	1151
PSM	MEDTLEHTDK	4844	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2951	4.1359	3	1217.5234	1217.5234	K	E	1134	1144
PSM	MGANNLER	4845	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:35	ms_run[2]:scan=2093	3.4332	2	919.41816	919.4182	R	M	519	527
PSM	MQDIPEETESR	4846	sp|Q92974-3|ARHG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:35	ms_run[2]:scan=4548	5.545	2	1349.5769	1349.5769	R	D	939	950
PSM	MVTEDQSK	4847	sp|Q9NYK5|RM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1187	2.1141	2	936.42225	936.4222	K	A	323	331
PSM	MVTEDQSK	4848	sp|Q9NYK5|RM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1191	2.1226	2	936.42225	936.4222	K	A	323	331
PSM	MVTEDQSK	4849	sp|Q9NYK5|RM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1319	2.3129	2	936.42225	936.4222	K	A	323	331
PSM	NAEDMEVR	4850	sp|Q7KYR7-6|BT2A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3542	4.6219	2	962.41274	962.4127	K	W	58	66
PSM	NDFTEEEEAQVR	4851	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9854	10.557	2	1465.6321	1465.6321	K	K	143	155
PSM	NDIHLDADDPNSADK	4852	sp|Q99590-2|SCAFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5998	7.0028	2	1638.7122	1638.7122	K	H	686	701
PSM	NGADPDFK	4853	sp|O60610-2|DIAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3282	4.4098	2	862.3821	862.3821	K	C	437	445
PSM	NGDTMEYR	4854	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3056	4.2198	2	984.39709	984.3971	R	K	75	83
PSM	NIEEHASADVEK	4855	sp|P61006-2|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7235	8.1621	3	1340.6208	1340.6208	R	M	105	117
PSM	NIEEHASADVEK	4856	sp|P61006-2|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8214	9.049	3	1340.6208	1340.6208	R	M	105	117
PSM	NIEEHASADVEK	4857	sp|P61006-2|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5791	6.7895	3	1340.6208	1340.6208	R	M	105	117
PSM	NIEEHASADVEK	4858	sp|P61006-2|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5278	6.1794	3	1340.6208	1340.6208	R	M	105	117
PSM	NLEEAVEK	4859	sp|Q6ZRQ5|MMS22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5017	5.9482	2	930.46583	930.4658	K	E	840	848
PSM	NQLNEDYK	4860	sp|Q86UV5-2|UBP48_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3241	4.3765	2	1022.4669	1022.4669	K	T	569	577
PSM	NRDLQGEEIK	4861	sp|Q9BXW9|FACD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3023	4.1951	3	1200.6099	1200.6099	K	S	1391	1401
PSM	NVSEELDR	4862	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4393	5.396	2	960.45124	960.4512	K	T	1192	1200
PSM	PMDLEEEK	4863	sp|O14967-2|CLGN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5352	6.249	2	989.43756	989.4376	K	K	328	336
PSM	QAELEAAR	4864	sp|Q99543-2|DNJC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2947	4.1333	2	886.45084	886.4508	R	L	314	322
PSM	QANNNIDAR	4865	sp|Q9Y5I4-2|PCDC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1468	2.4981	2	1014.4843	1014.4843	K	I	759	768
PSM	QCADLPEEDEELRK	4866	sp|Q9P253|VPS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4	ms_run[2]:scan=7480	8.383	3	1730.7781	1730.7781	K	K	740	754
PSM	QDDMEITR	4867	sp|Q8NG31-3|KNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5021	5.9509	2	1006.439	1006.4390	R	S	911	919
PSM	QDEGVLK	4868	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3091	4.2505	2	787.40758	787.4076	K	V	29	36
PSM	QEAIDEVK	4869	sp|Q15276-2|RABE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4195	5.2291	2	930.46583	930.4658	K	R	100	108
PSM	QEDEWDKPR	4870	sp|P13674-3|P4HA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3220	4.3604	3	1201.5364	1201.5364	K	I	328	337
PSM	QELNEPPK	4871	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2956	4.1391	2	953.48181	953.4818	K	Q	204	212
PSM	QETQGLQK	4872	sp|Q9NTJ3-2|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1232	2.1963	2	930.47706	930.4771	K	E	469	477
PSM	QGLETDNK	4873	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1342	2.3447	2	903.42977	903.4298	K	E	1227	1235
PSM	QGVDDIEK	4874	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3969	5.0211	2	902.43453	902.4345	K	F	918	926
PSM	QITEEVER	4875	sp|O95140-2|MFN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4118	5.1611	2	1002.4982	1002.4982	K	Q	119	127
PSM	QKLEEDAEMK	4876	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	9-UNIMOD:35	ms_run[2]:scan=3105	4.2604	2	1235.5704	1235.5704	K	S	215	225
PSM	QLAAENR	4877	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=768	1.383	2	800.41407	800.4141	K	L	861	868
PSM	QLEVEPEEPEAENK	4878	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15679	16.151	2	1639.7577	1639.7577	R	H	23	37
PSM	QLQEEDLK	4879	sp|Q8IVM0-2|CCD50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4477	5.4758	2	1001.5029	1001.5029	K	A	61	69
PSM	QNEDLQVK	4880	sp|Q53GS7-2|GLE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3457	4.549	2	972.48762	972.4876	K	V	374	382
PSM	QQEELLAEENQR	4881	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8791	9.5686	2	1485.7059	1485.7059	R	L	2550	2562
PSM	QSCATVQR	4882	sp|O00273-2|DFFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:4	ms_run[2]:scan=226	0.27559	2	948.44471	948.4447	R	L	163	171
PSM	QTDVTGEEELTK	4883	sp|Q14676-3|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6820	7.7883	2	1348.6358	1348.6358	R	G	843	855
PSM	QTIHEEGCNSR	4884	sp|O60565-2|GREM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	8-UNIMOD:4	ms_run[2]:scan=1456	2.4853	3	1329.5732	1329.5732	K	T	60	71
PSM	QVELQEER	4885	sp|Q9BW19|KIFC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4015	5.0578	2	1029.5091	1029.5091	K	R	234	242
PSM	QVEQLEK	4886	sp|Q14152-2|EIF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2715	3.938	2	872.46035	872.4603	K	E	639	646
PSM	RPAEDMEEEQAFK	4887	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10657	11.267	3	1578.6984	1578.6984	K	R	22	35
PSM	RVEIMEEESEQ	4888	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10330	10.975	2	1377.6082	1377.6082	R	-	449	460
PSM	SAAETVTK	4889	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8	0.01466	2	805.41815	805.4181	R	G	21	29
PSM	SAAETVTK	4890	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7870	8.7405	2	805.41815	805.4181	R	G	21	29
PSM	SAAETVTK	4891	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9292	10.044	2	805.41815	805.4181	R	G	21	29
PSM	SAAETVTK	4892	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12585	13.139	2	805.41815	805.4181	R	G	21	29
PSM	SAAETVTK	4893	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14293	14.752	2	805.41815	805.4181	R	G	21	29
PSM	SAAETVTK	4894	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15666	16.137	2	805.41815	805.4181	R	G	21	29
PSM	SAAETVTK	4895	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16160	16.647	2	805.41815	805.4181	R	G	21	29
PSM	SAAETVTK	4896	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=17592	18.205	2	805.41815	805.4181	R	G	21	29
PSM	SAAETVTK	4897	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=18065	18.768	2	805.41815	805.4181	R	G	21	29
PSM	SAAETVTK	4898	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=405	0.64083	2	805.41815	805.4181	R	G	21	29
PSM	SAAETVTK	4899	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12110	12.632	2	805.41815	805.4181	R	G	21	29
PSM	SAAETVTK	4900	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13339	13.856	2	805.41815	805.4181	R	G	21	29
PSM	SAAETVTK	4901	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15132	15.581	2	805.41815	805.4181	R	G	21	29
PSM	SAAETVTK	4902	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=18593	19.401	2	805.41815	805.4181	R	G	21	29
PSM	SAAETVTK	4903	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20782	22.933	2	805.41815	805.4181	R	G	21	29
PSM	SAAETVTK	4904	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=21910	25.23	2	805.41815	805.4181	R	G	21	29
PSM	SAAETVTK	4905	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=22883	27.461	2	805.41815	805.4181	R	G	21	29
PSM	SAAETVTK	4906	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=23117	28.046	2	805.41815	805.4181	R	G	21	29
PSM	SAFEEEGK	4907	sp|Q15042-4|RB3GP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2702	3.9266	2	895.39233	895.3923	R	E	304	312
PSM	SAHQVAR	4908	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=22471	26.551	2	767.40383	767.4038	R	Y	422	429
PSM	SAHQVAR	4909	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=22753	27.116	2	767.40383	767.4038	R	Y	422	429
PSM	SAHQVAR	4910	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=22962	27.639	2	767.40383	767.4038	R	Y	422	429
PSM	SAHQVAR	4911	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=23363	28.691	2	767.40383	767.4038	R	Y	422	429
PSM	SAHQVAR	4912	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=23563	29.228	2	767.40383	767.4038	R	Y	422	429
PSM	SCDSLNNR	4913	sp|P07996-2|TSP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4	ms_run[2]:scan=846	1.5498	2	964.40324	964.4032	R	C	320	328
PSM	SDIPEPER	4914	sp|Q8NI27-2|THOC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4983	5.9162	2	941.44543	941.4454	R	E	219	227
PSM	SEIEVISEPPEEK	4915	sp|O75044|SRGP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13405	13.915	2	1484.7246	1484.7246	K	V	799	812
PSM	SEPQSPTEELSEAETESKPQTEGK	4916	sp|Q92543-2|SNX19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11714	12.224	3	2617.1879	2617.1879	R	K	695	719
PSM	SESLESPRGER	4917	sp|Q92974-3|ARHG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2440	3.7078	3	1245.5949	1245.5949	R	L	615	626
PSM	SHGKDEECVLEAENK	4918	sp|Q9UHQ4|BAP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	8-UNIMOD:4	ms_run[2]:scan=3403	4.5052	3	1743.7734	1743.7734	K	K	164	179
PSM	SLEAQAEK	4919	sp|P06753|TPM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2340	3.6296	2	874.43961	874.4396	K	Y	207	215
PSM	SLQEANAEK	4920	sp|Q14126|DSG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2121	3.4564	2	988.48254	988.4825	K	V	893	902
PSM	SLSEAPEDTSTR	4921	sp|P41214|EIF2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3874	4.934	2	1291.5892	1291.5892	K	G	237	249
PSM	SNGRPNETDIK	4922	sp|P26358-2|DNMT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2111	3.4473	2	1229.6	1229.6000	K	I	1021	1032
PSM	SPEDLER	4923	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3113	4.2703	2	844.39266	844.3927	K	L	455	462
PSM	SRAEAALEEESR	4924	sp|Q969G3-3|SMCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3411	4.5105	2	1346.6426	1346.6426	K	Q	77	89
PSM	SRCTELEK	4925	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:4	ms_run[2]:scan=191	0.2236	2	1021.4862	1021.4862	K	E	46	54
PSM	SRSEQLTDR	4926	sp|P43304|GPDM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1554	2.6272	3	1090.5367	1090.5367	K	S	607	616
PSM	STDPVTTK	4927	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2142	3.4728	2	847.42871	847.4287	R	E	1906	1914
PSM	SVMESSDR	4928	sp|Q8NFH5-3|NUP35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2089	3.4307	2	909.3862	909.3862	K	C	112	120
PSM	TDEYLEK	4929	sp|Q9NXE4-5|NSMA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3679	4.7503	2	896.41273	896.4127	K	A	225	232
PSM	TDTGEPMGR	4930	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	7-UNIMOD:35	ms_run[2]:scan=72	0.065522	2	978.40766	978.4077	R	G	174	183
PSM	TEEQIAAEEAWNETEK	4931	sp|Q92614-2|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16822	17.323	3	1876.8327	1876.8327	K	V	5	21
PSM	TIDDLEEK	4932	sp|P67936|TPM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5394	6.2896	2	961.46041	961.4604	K	L	216	224
PSM	TPEAVQK	4933	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=508	0.82874	2	771.41267	771.4127	R	L	430	437
PSM	TPEEIRK	4934	sp|P63208|SKP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1062	1.9262	2	871.47633	871.4763	K	T	131	138
PSM	TPPLEEQAEDKK	4935	sp|O75167-5|PHAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3510	4.5927	2	1383.6882	1383.6882	K	A	129	141
PSM	TRTGSNIDCEK	4936	sp|P55211-4|CASP9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	9-UNIMOD:4	ms_run[2]:scan=1155	2.066	3	1279.5827	1279.5827	R	L	96	107
PSM	TSDDEVFK	4937	sp|O75976-2|CBPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5078	6.0022	2	939.41854	939.4185	K	Y	35	43
PSM	TTGEENGVEAEEWGK	4938	sp|O00429-4|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10331	10.976	2	1634.706	1634.7060	K	F	78	93
PSM	TYSDDHVK	4939	sp|O43592|XPOT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=39	0.037491	2	963.42977	963.4298	R	F	46	54
PSM	VAQREEELEETGNQHNDVEIEEAGEEEEK	4940	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20916	23.154	4	3368.4764	3368.4764	K	E	312	341
PSM	VGAVDADK	4941	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2120	3.4558	2	773.39193	773.3919	K	H	75	83
PSM	VGGTSDVEVNEK	4942	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=19446	20.626	2	1232.5885	1232.5885	K	K	406	418
PSM	VQTANEVK	4943	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1932	3.3124	2	887.47125	887.4712	K	Q	691	699
PSM	VRELEEK	4944	sp|Q9P0K7-4|RAI14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1393	2.4085	2	901.4869	901.4869	K	L	524	531
PSM	VVDDEDLVDQR	4945	sp|Q76M96|CCD80_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9364	10.119	3	1301.6099	1301.6099	R	L	686	697
PSM	YDDEEFEYR	4946	sp|P61024|CKS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9610	10.344	2	1264.4884	1264.4884	K	H	12	21
PSM	YNSMEDAK	4947	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2249	3.5555	2	956.39095	956.3909	K	V	106	114
PSM	YTAQVDAEEK	4948	sp|O75947|ATP5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6170	7.147	2	1152.5299	1152.5299	K	E	86	96
PSM	ELAEEAAR	4949	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=2947	4.1332826	2	887.435559	887.434861	R	L	1935	1943
PSM	QLAEEDAAR	4950	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=7821	8.6984827	2	984.4513	984.4507	R	Q	1955	1964
PSM	EQAELEAAR	4951	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=3596	4.671887	2	997.4855	997.4823	K	Q	2100	2109
PSM	QEEEMMAKEEELVK	4952	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=14610	15.048227	2	1721.758762	1721.785188	R	V	843	857
PSM	QSACNLEK	4953	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,4-UNIMOD:4	ms_run[1]:scan=4711	5.6805188	2	931.4078	931.4064	R	K	1434	1442
PSM	VQIAANEETQEREEQMK	4954	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=7024	7.9682323	3	2032.939239	2031.953133	K	E	456	473
PSM	EDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	4955	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	33-UNIMOD:35	ms_run[1]:scan=8711	9.4950456	3	4006.357136	4006.335660	K	A	143	177
PSM	CVSELEEEK	4956	sp|Q14789|GOGB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=16472	16.951139	2	1104.4646	1104.4640	K	Q	1964	1973
PSM	CGDLEEELK	4957	sp|P67936-2|TPM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=16358	16.838579	2	1074.4528	1074.4534	K	N	190	199
PSM	CGDLEEELK	4958	sp|P67936-2|TPM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=17711	18.354322	2	1074.4525	1074.4534	K	N	190	199
PSM	MQVDQEEPHVEEQQQQTPAENK	4959	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35	ms_run[1]:scan=6897	7.857353	3	2637.161721	2637.161289	K	A	522	544
PSM	EDQTEYLEER	4960	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=8801	9.5759268	2	1310.553382	1310.562640	K	R	166	176
PSM	YQGDGIVEDEEETMENNEEK	4961	sp|Q9NYF8|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=13754	14.251035	2	2357.936914	2356.948895	K	K	892	912
PSM	SIDDLEEK	4962	sp|P09493-2|TPM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=6673	7.6477967	2	947.440614	947.444757	K	V	196	204
PSM	EFLEDYDDDRDDPK	4963	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=11171	11.727282	3	1752.7136	1752.7110	K	Y	498	512
PSM	EFLEDYDDDRDDPK	4964	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=17234	17.770618	2	1752.7102	1752.7110	K	Y	498	512
PSM	CGQEAAELK	4965	sp|O95613|PCNT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=9153	9.8975017	2	987.4325	987.4326	R	E	321	330
PSM	QVTEEVRK	4966	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=3914	4.9712583	2	970.5083	970.5078	K	N	981	989
PSM	EGEIQAGAK	4967	sp|Q13409|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=2223	3.53618	2	883.4512	883.4392	K	L	256	265
PSM	QHAAVSEK	4968	sp|Q9NTI5|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=1732	2.9778658	2	851.4145	851.4132	K	L	975	983
PSM	YKLDEDEDEDDADLSK	4969	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=9371	10.124513	3	1899.793536	1898.790527	K	Y	167	183
PSM	YNLDASEEEDSNK	4970	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=6836	7.8040289	2	1512.594994	1512.621611	K	K	183	196
PSM	EDLQELNDR	4971	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=7867	8.7382931	2	1131.508545	1130.520381	K	L	33	42
PSM	EDLQELNDR	4972	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=13391	13.904646	2	1112.5088	1112.5093	K	L	33	42
PSM	DEPGEQVELKEEAEAPVEDGSQPPPPEPK	4973	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=15214	15.668074	3	3127.455509	3126.451700	K	G	614	643
PSM	RPAEDMEEEQAFK	4974	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	6-UNIMOD:35	ms_run[1]:scan=6143	7.120959	3	1594.6890	1594.6928	K	R	22	35
PSM	RPAEDMEEEQAFK	4975	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=10767	11.367628	3	1578.699784	1578.698422	K	R	22	35
PSM	EKEELMER	4976	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=5644	6.6555189	2	1044.4916	1044.4905	R	L	343	351
PSM	DMDLWEQQEEER	4977	sp|Q14152|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=17085	17.608181	2	1607.640543	1606.656951	K	I	721	733
PSM	SIEGTADDEEEGVSPDTAIR	4978	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=12772	13.312652	2	2089.910795	2089.928752	K	S	638	658
PSM	NFEDRER	4979	sp|Q92974|ARHG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1897	3.272229	2	964.432085	964.436258	R	Q	921	928
PSM	QELTSQAER	4980	sp|Q14980|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=6307	7.2630276	2	1043.4891	1043.4878	R	A	1313	1322
PSM	TIDDLEDK	4981	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=6992	7.9407406	2	947.444481	947.444757	K	L	216	224
PSM	LEEVLSTEGAEENGNSDK	4982	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=10533	11.157863	2	1920.845104	1919.859610	K	K	522	540
PSM	ERTSTSSSSVQAR	4983	sp|Q9UKV3|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=1154	2.065269	3	1377.6482	1376.6642	K	R	695	708
PSM	GSTDNLMDDIER	4984	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=16556	17.044689	2	1365.570546	1364.587809	R	A	379	391
PSM	DVDEAYMNK	4985	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:35	ms_run[1]:scan=3389	4.4935618	2	1099.449098	1099.449190	K	V	199	208
PSM	HGDDLRR	4986	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=23612	29.34288	2	867.430822	867.431113	K	T	296	303
PSM	EQRDCEVIER	4987	sp|O00429|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:4	ms_run[1]:scan=3017	4.1886827	2	1332.608661	1332.609213	R	L	640	650
PSM	QESSESLPK	4988	sp|Q6VMQ6|MCAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=6425	7.389186	2	986.4566	986.4551	K	E	481	490
PSM	ELLQESQEEEEEEEEEMPSKDPSPEPPSR	4989	sp|Q8IVL6|P3H3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=14593	15.033365	3	3412.465322	3412.462400	K	R	689	718
PSM	NFGEEVDDESLK	4990	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=13493	14.001539	2	1381.587804	1380.604505	K	E	197	209
PSM	NFGEEVDDESLK	4991	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=15039	15.466853	2	1381.585869	1380.604505	K	E	197	209
PSM	QDEGVLK	4992	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=7972	8.8317742	2	770.3807	770.3805	K	V	29	36
PSM	CNMFDDCGDGSDEEDCSIDPK	4993	sp|Q07954|LRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,7-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=14372	14.824386	3	2464.839173	2464.839956	R	L	3761	3782
PSM	EREAELGAR	4994	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=3856	4.9139056	2	1011.5085	1011.5092	K	A	178	187
PSM	EDEVEEWQHR	4995	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=6162	7.1390069	3	1337.5629	1337.5631	K	A	439	449
PSM	EAQDDLVK	4996	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=3908	4.965233	2	898.4399	898.4391	K	T	451	459
PSM	DLPNGDIDEYEK	4997	sp|Q9BQ39|DDX50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=13552	14.056304	2	1407.603975	1406.620155	K	K	95	107
PSM	DLPNGDIDEYEK	4998	sp|Q9BQ39|DDX50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=14105	14.57825	2	1407.603531	1406.620155	K	K	95	107
PSM	CDDPEEELCHR	4999	sp|Q7Z333|SETX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=5704	6.7057421	3	1459.534762	1458.550378	K	R	2622	2633
PSM	HQGVMVGMGQKDSYVGDEAQSK	5000	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=6385	7.3349505	2	2351.045571	2350.068180	R	R	42	64
PSM	DSYVGDEAQSK	5001	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=8138	8.9846558	2	1198.518688	1197.514961	K	R	53	64
PSM	EVEVEVESMDK	5002	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:35	ms_run[1]:scan=9223	9.9735895	2	1308.566195	1308.575513	R	A	593	604
PSM	QETHQQLADK	5003	sp|P82675|RT05_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=50	0.047261788	3	1196.579921	1196.578565	R	K	356	366
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	5004	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4	ms_run[1]:scan=10443	11.078234	2	2338.945292	2338.945542	R	R	42	68
PSM	CGEDDETIPSEYR	5005	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=13986	14.466848	2	1552.5937	1552.5982	K	L	328	341
PSM	NDFTEEEEAQVR	5006	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=10904	11.488965	2	1466.620799	1465.632117	K	K	143	155
PSM	NDFTEEEEAQVR	5007	sp|P63208|SKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=12980	13.516829	2	1465.639160	1465.632117	K	K	143	155
PSM	LEVDEDFEEDNAAK	5008	sp|Q92620|PRP16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=13988	14.468348	2	1623.704546	1622.694776	R	V	391	405
PSM	MEGHDPK	5009	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1	ms_run[1]:scan=2542	3.7893821	2	854.3583	854.3587	-	E	1	8
PSM	NHDEESLECLCR	5010	sp|Q04637|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=9524	10.263442	3	1561.616778	1560.629691	K	L	926	938
PSM	KHDSGAADLER	5011	sp|Q9NX55|HYPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1100	1.9669214	3	1197.573865	1197.573814	R	V	35	46
PSM	SLDPENSETELER	5012	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=9985	10.669317	2	1518.667534	1517.684546	K	I	467	480
PSM	CEAQQELR	5013	sp|Q5M775|CYTSB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=7403	8.3055866	2	1015.4389	1015.4388	K	T	740	748
PSM	DYEEVGVDSVEGEGEEEGEEY	5014	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=20643	22.631636	3	2347.901054	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	5015	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=23725	29.679027	3	2347.901054	2347.897571	K	-	431	452
PSM	DDETMYVESK	5016	sp|O15144|ARPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=7062	8.0042513	2	1215.496729	1215.496534	R	K	148	158
PSM	QDIEDSVSR	5017	sp|O60306|AQR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=9737	10.455271	2	1030.4559	1030.4562	R	M	483	492
PSM	KVEEDLK	5018	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1482	2.5162922	2	859.465752	859.465098	K	A	64	71
PSM	SMYEEEINETR	5019	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35	ms_run[1]:scan=7986	8.8441203	2	1415.585552	1415.587475	K	R	210	221
PSM	EMDYETEVEMEK	5020	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35	ms_run[1]:scan=11293	11.83318	2	1548.628402	1547.600742	R	G	678	690
PSM	CSLPAEEDSVLEK	5021	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4	ms_run[1]:scan=15263	15.716226	2	1476.666080	1475.681375	K	L	635	648
PSM	AGPGADNGEEGEIEEEMENPEMVDLPEK	5022	sp|Q13330|MTA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	17-UNIMOD:35,22-UNIMOD:35	ms_run[1]:scan=13170	13.696604	3	3046.291646	3046.254322	K	L	71	99
PSM	GLEEPEMD	5023	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=10848	11.439027	1	918.3651	918.3635	K	P	497	505
PSM	ETAQALK	5024	sp|Q9Y4G6|TLN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=4203	5.2346935	2	741.4016	741.4016	R	T	1125	1132
PSM	SVTEQGAELSNEER	5025	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=5748	6.7433219	2	1547.704436	1547.706344	K	N	28	42
PSM	NGDTMEYR	5026	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:35	ms_run[1]:scan=1248	2.2160525	2	1000.397546	1000.392010	R	K	75	83
PSM	NGHDPGRGHQDLDPDNEGELR	5027	sp|Q9ULF5|S39AA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=4848	5.8036709	4	2328.012327	2327.027512	R	H	286	307
PSM	SEMEVQDAELK	5028	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:35	ms_run[1]:scan=6872	7.8369364	2	1293.584792	1293.575848	K	A	345	356
PSM	AADCEVEQWDSDEPIPAK	5029	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:4	ms_run[1]:scan=17442	18.011102	3	2059.867792	2058.884051	R	E	26	44
PSM	DSSSSGSGSDNDVEVIK	5030	sp|P46100|ATRX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=7450	8.3486286	2	1683.733616	1681.727868	K	V	1940	1957
PSM	EWQELDDAEK	5031	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=10808	11.40278	2	1261.547246	1261.546262	K	V	169	179
PSM	EGQGSQTLR	5032	sp|Q6PML9|ZNT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=1740	2.9887777	2	974.4808	974.4776	K	V	74	83
PSM	EGVVAAAEK	5033	sp|P37840|SYUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=7369	8.2746762	1	854.4490	854.4493	K	T	13	22
PSM	QVSDDLTER	5034	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=10547	11.170432	2	1044.4732	1044.4718	R	A	149	158
PSM	YSEEANNLIEECEQAER	5035	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:4	ms_run[1]:scan=15658	16.12748	3	2083.868023	2082.880028	K	L	120	137
PSM	QVAEVEAQK	5036	sp|Q13439|GOGA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=8251	9.0807035	2	983.4914	983.4919	K	K	841	850
PSM	ALDGPEQMELEEGK	5037	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1	ms_run[1]:scan=19962	21.468268	2	1587.6982	1586.7132	M	A	2	16
PSM	TYASTEQEQDAEENGVTGVSGPGK	5038	sp|P33527|MRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=9852	10.553978	2	2455.069431	2453.083021	R	E	868	892
PSM	NSRPEANEALER	5039	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=4297	5.318956	3	1385.655914	1384.669505	K	G	131	143
PSM	ELEVAEGGK	5040	sp|Q16543|CDC37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=11270	11.813659	2	912.4540	912.4547	K	A	70	79
PSM	NGEEPLPSEEEHCSVVEVTEEEVK	5041	sp|Q8N5S9|KKCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:4	ms_run[1]:scan=18942	19.890072	3	2755.203457	2754.217800	K	N	412	436
PSM	MEDEVVR	5042	sp|P23193|TCEA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6323	7.2786966	2	934.4057	934.4061	-	F	1	8
PSM	EVLNEEDEVQPNGK	5043	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=8044	8.899287	3	1600.730765	1598.742395	R	I	109	123
PSM	QELNEPPK	5044	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=2863	4.0624658	2	953.482244	953.481811	K	Q	204	212
PSM	RSEEEEAPPDGAVAEYR	5045	sp|Q6UX04|CWC27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=7260	8.1846678	3	1903.855508	1903.854799	K	R	345	362
PSM	CMMDTDDEVRDR	5046	sp|Q9UBF2|COPG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=11976	12.457714	2	1524.5630	1524.5638	R	A	516	528
PSM	SQAEFEK	5047	sp|P07108|ACBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1	ms_run[1]:scan=6171	7.1476195	1	879.4004	879.3969	M	A	2	9
PSM	TATPQQAQEVHEK	5048	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=2448	3.7135865	3	1466.700558	1465.716121	K	L	213	226
PSM	QKADEEEMLDNLPEAGDSR	5049	sp|Q9NPD8|UBE2T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:35	ms_run[1]:scan=10050	10.72643	3	2161.940364	2161.943357	K	V	155	174
PSM	EFETIERDER	5050	sp|Q10570|CPSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=13106	13.638141	2	1304.5990	1304.5992	K	Y	1056	1066
PSM	SVTVDSMDEEK	5051	sp|P29084|T2EB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=5934	6.9415003	2	1238.532531	1238.533648	R	I	222	233
PSM	EVQQGEEFERR	5052	sp|P00568|KAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=7459	8.3552991	2	1387.6460	1387.6475	R	I	98	109
PSM	ENVTMDEIEK	5053	sp|P08183|MDR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=9033	9.7818416	2	1206.549274	1206.543819	R	A	493	503
PSM	EAVAMESYAK	5054	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:35	ms_run[1]:scan=3297	4.4223286	2	1113.502046	1113.501226	K	A	432	442
PSM	QLLEENEEK	5055	sp|Q14643|ITPR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=12369	12.919364	2	1113.5182	1113.5185	K	L	1671	1680
PSM	EEMDRAVAEGK	5056	sp|Q13057|COASY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=2919	4.1084261	3	1233.569086	1233.565951	R	R	454	465
PSM	DVNERNTVK	5057	sp|P42224|STAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1075	1.9407836	2	1073.549908	1073.546536	K	G	367	376
PSM	DVMEDAVEDR	5058	sp|Q15833|STXB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=10462	11.094348	2	1177.498880	1177.492118	K	L	481	491
PSM	AVEDEGLR	5059	sp|Q14644|RASA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1	ms_run[1]:scan=9856	10.55892	2	929.4456	929.4449	M	V	2	10
PSM	ERLDEELK	5060	sp|Q9Y3D7|TIM16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=9043	9.7912832	2	1012.5186	1012.5184	K	I	103	111
PSM	SYTEEDLR	5061	sp|Q8IUH3|RBM45_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=4960	5.8978479	2	1011.458902	1011.450905	K	E	130	138
PSM	AASVEQR	5062	sp|Q96IU4|ABHEB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1	ms_run[1]:scan=4026	5.0675435	2	801.3984	801.3976	M	E	2	9
PSM	QPLEESASR	5063	sp|Q9HC36|MRM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=7362	8.2674032	2	998.4674	998.4664	K	A	74	83
PSM	QVDGDNSHVEMK	5064	sp|P02786|TFR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=7305	8.222254	2	1341.5492	1340.5662	R	L	28	40
PSM	QVDGDNSHVEMK	5065	sp|P02786|TFR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=6737	7.710806	2	1341.5502	1340.5662	R	L	28	40
PSM	IEEELGSK	5066	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=4527	5.5255628	2	903.455574	903.454927	R	A	413	421
PSM	EIVEMNEIEEGK	5067	sp|Q9H2G2|SLK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=15389	15.839509	2	1419.645076	1418.659911	K	N	604	616
PSM	ESGNGRELGEDGLK	5068	sp|P30837|AL1B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=5793	6.7907525	3	1460.671860	1459.690300	K	A	487	501
PSM	SEGTTSTSYK	5069	sp|Q9C0B5|ZDHC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1876	3.2270633	2	1059.469673	1059.472034	R	S	448	458
PSM	GEPQGSMR	5070	sp|Q13630|FCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1	ms_run[1]:scan=3602	4.6761305	2	902.3916	902.3911	M	I	2	10
PSM	EEQERDLLEK	5071	sp|Q9HCM7|FBSL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=4727	5.6943645	2	1287.628118	1287.630660	K	T	773	783
PSM	AEEPDNFSSK	5072	sp|Q9NPE2|NGRN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=3612	4.6854099	2	1122.485019	1122.482933	K	V	263	273
PSM	MEEAELVK	5073	sp|Q9NP74|PALMD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=11296	11.83544	2	1005.4685	1005.4683	-	G	1	9
PSM	TLHSDDEGTVLDDSR	5074	sp|O00170|AIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=6133	7.1116923	3	1658.738349	1658.738373	R	A	40	55
PSM	QIEAQEKPR	5075	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1988	3.3535843	3	1099.573660	1097.582922	R	D	1933	1942
PSM	NGSLDSPGK	5076	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=2909	4.101145	2	875.425542	873.419211	K	Q	134	143
PSM	TIDDLEEK	5077	sp|P67936|TPM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=15197	15.65116	2	962.456365	961.460407	K	L	216	224
PSM	NGDEENPLK	5078	sp|P52756|RBM5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=6210	7.1801588	2	1015.447135	1014.461804	R	R	605	614
PSM	CGDLEEELK	5079	sp|P07951|TPM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4	ms_run[1]:scan=11506	12.029465	2	1092.464036	1091.480490	K	I	190	199
PSM	CNELQDIEK	5080	sp|P28370|SMCA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4	ms_run[1]:scan=10394	11.035134	2	1148.503547	1147.517939	R	I	906	915
PSM	SEDFGVNEDLADSDAR	5081	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=14801	15.226671	3	1741.731792	1738.728202	R	A	189	205
PSM	TGEEDEEEFFCNR	5082	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:4	ms_run[1]:scan=14104	14.57749	2	1660.632231	1660.631131	K	A	1186	1199
PSM	ELEPEAAEEALENGPK	5083	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=17688	18.325055	2	1725.794047	1724.810475	K	E	348	364
PSM	EEAGGGISEEEAAQYDR	5084	sp|Q9UBE0|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=11003	11.575486	2	1812.810819	1809.765316	K	Q	5	22
PSM	QLAEQEELER	5085	sp|Q9UH65|SWP70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=6781	7.7512676	2	1245.586839	1243.604445	K	Q	330	340
PSM	TECAEPPRDEPPADGALK	5086	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:4	ms_run[1]:scan=6896	7.8565946	2	1951.902310	1951.894556	R	R	9	27
PSM	EEAEAPVEDGSQPPPPEPK	5087	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=8111	8.9608183	3	2004.936531	2001.916731	K	G	624	643
PSM	EDEKGDDVDDPENQNSALADTDASGGLTK	5088	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=11556	12.075272	3	3005.288796	3005.285756	K	E	1697	1726