Majority protein IDs	Entry name	Protein names	Gene names	Organism	Gene ontology (biological process)	Gene ontology (cellular component)	Gene ontology (GO)	Gene ontology (molecular function)	Peptide sequences	Fasta headers	Q-value	Score	32RB	42RW	4F	4RW	4S	32RB1_BC5_01_23089	32RB1_BC5_01_23090	32RB1_BC5_01_23091	32RB2_BC6_01_23092	32RB2_BC6_01_23093	32RB2_BC6_01_23094	32RB3_BC7_01_23095	32RB3_BC7_01_23096	32RB3_BC7_01_23097	42RW1_BC2_01_23079	42RW1_BC2_01_23080	42RW1_BC2_01_23081	42RW2_BC3_01_23082	42RW2_BC3_01_23083	42RW2_BC3_01_23084	42RW3_BC4_01_23085	42RW3_BC4_01_23086	42RW3_BC4_01_23087	4F1_BD6_01_23119	4F1_BD6_01_23120	4F1_BD6_01_23121	4F2_BD7_01_23122	4F2_BD7_01_23123	4F2_BD7_01_23124	4F3_BD8_01_23125	4F3_BD8_01_23126	4F3_BD8_01_23127	4RW1_BC8_01_23099	4RW1_BC8_01_23100	4RW1_BC8_01_23101	4RW2_BD1_01_23102	4RW2_BD1_01_23103	4RW2_BD1_01_23104	4RW3_BD2_01_23105	4RW3_BD2_01_23106	4RW3_BD2_01_23107	4S1_BD3_01_23109	4S1_BD3_01_23110	4S1_BD3_01_23111	4S2_BD4_01_23112	4S2_BD4_01_23113	4S2_BD4_01_23114	4S3_BD5_01_23115	4S3_BD5_01_23116	4S3_BD5_01_23117
A0A7U0IXF0	A0A7U0IXF0_9APIA	DNA-directed RNA polymerase subunit beta' (EC 2.7.7.6) (PEP) (Plastid-encoded RNA polymerase subunit beta') (RNA polymerase subunit beta')	rpoC1	Angelica porphyrocaulis		chloroplast [GO:0009507]	chloroplast [GO:0009507]		VVLFKRR	tr|A0A7U0IXF0|A0A7U0IXF0_9APIA DNA-directed RNA polymerase subunit beta OS=Angelica porphyrocaulis OX=1202429 GN=rpoC1 PE=3 SV=1;tr|A0A7U0FUF7|A0A7U0FUF7_9APIA DNA-directed RNA polymerase subunit beta OS=Angelica dahurica OX=48101 GN=rpoC1 PE=3 SV=1	0.9332	1.378	0	0	0	3838.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3838.4	0	0	0	0	0	0	0	0	0	0	0	0
A0A346S7B0	A0A346S7B0_9APIA	Photosystem II protein D1	psbA	Angelica sinensis	photosynthetic electron transport in photosystem II [GO:0009772]; protein-chromophore linkage [GO:0018298]	chloroplast [GO:0009507]; integral component of membrane [GO:0016021]; photosystem II [GO:0009523]; plastid membrane [GO:0042170]	"chloroplast [GO:0009507]; integral component of membrane [GO:0016021]; photosystem II [GO:0009523]; plastid membrane [GO:0042170]; chlorophyll binding [GO:0016168]; electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity [GO:0045156]; metal ion binding [GO:0046872]; photosynthetic electron transport in photosystem II [GO:0009772]; protein-chromophore linkage [GO:0018298]"	"chlorophyll binding [GO:0016168]; electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity [GO:0045156]; metal ion binding [GO:0046872]"	GFDLLPR	tr|A0A346S7B0|A0A346S7B0_9APIA Photosystem II protein D1 OS=Angelica sinensis OX=165353 GN=psbA PE=3 SV=1	0.79018	1.378	44486	31350	30108	29816	27538	0	30586	0	31067	44486	0	0	0	0	0	0	0	31350	0	0	0	25774	0	0	0	0	0	0	0	30108	0	22467	0	12184	0	29816	0	0	0	0	0	0	0	25911	0	0	0	0	27538	0
A0A6L5B708	A0A6L5B708_APIGR	PMR5N domain-containing protein	AG4045_015599	Apium graveolens (Celery)	xyloglucan metabolic process [GO:0010411]	Golgi apparatus [GO:0005794]	Golgi apparatus [GO:0005794]; O-acetyltransferase activity [GO:0016413]; xyloglucan metabolic process [GO:0010411]	O-acetyltransferase activity [GO:0016413]	PGHGMCR	tr|A0A6L5B708|A0A6L5B708_APIGR PMR5N domain-containing protein OS=Apium graveolens OX=4045 GN=AG4045_015599 PE=3 SV=1	0.93317	1.378	0	0	0	13822	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13822	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L5B761	A0A6L5B761_APIGR	BTB domain-containing protein	AG4045_024199	Apium graveolens (Celery)	protein homooligomerization [GO:0051260]		protein homooligomerization [GO:0051260]		DDVFIYK	tr|A0A6L5B761|A0A6L5B761_APIGR BTB domain-containing protein OS=Apium graveolens OX=4045 GN=AG4045_024199 PE=4 SV=1;tr|A0A164XY35|A0A164XY35_DAUCS BTB domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_016963 PE=4 SV=1	0.80586	1.378	0	22813	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22813	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L5B8H3	A0A6L5B8H3_APIGR	Uncharacterized protein (Fragment)	AG4045_027549	Apium graveolens (Celery)			DNA-binding transcription factor activity [GO:0003700]	DNA-binding transcription factor activity [GO:0003700]	FGDVRPK	tr|A0A6L5B8H3|A0A6L5B8H3_APIGR Uncharacterized protein (Fragment) OS=Apium graveolens OX=4045 GN=AG4045_027549 PE=4 SV=1	0.94767	1.378	4688.4	11643	10894	0	0	0	0	0	0	4688.4	0	0	0	0	0	0	0	0	11643	0	0	0	0	0	0	0	0	0	0	10894	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L5B902	A0A6L5B902_APIGR	Uncharacterized protein (Fragment)	AG4045_021851	Apium graveolens (Celery)					QQQQQKR	tr|A0A6L5B902|A0A6L5B902_APIGR Uncharacterized protein (Fragment) OS=Apium graveolens OX=4045 GN=AG4045_021851 PE=4 SV=1	0.77867	1.378	117450	52028	26859	88833	0	117450	0	65794	23730	26900	0	0	0	0	0	0	0	0	45307	0	0	52028	0	0	0	0	0	0	0	0	26859	0	0	88833	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L5B907	A0A6L5B907_APIGR	Uncharacterized protein	AG4045_025085	Apium graveolens (Celery)	tRNA wobble uridine modification [GO:0002098]	cytoplasm [GO:0005737]; elongator holoenzyme complex [GO:0033588]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; elongator holoenzyme complex [GO:0033588]; nucleus [GO:0005634]; tRNA wobble uridine modification [GO:0002098]		HFLNGQR	tr|A0A6L5B907|A0A6L5B907_APIGR Uncharacterized protein OS=Apium graveolens OX=4045 GN=AG4045_025085 PE=3 SV=1	0.7783	1.378	0	0	12454	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12454	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L5B9R7	A0A6L5B9R7_APIGR	Uncharacterized protein	AG4045_009394	Apium graveolens (Celery)					NPMHGKK	tr|A0A6L5B9R7|A0A6L5B9R7_APIGR Uncharacterized protein OS=Apium graveolens OX=4045 GN=AG4045_009394 PE=4 SV=1	0.7868	1.378	0	0	0	12603	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12603	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L5B9X7	A0A6L5B9X7_APIGR	Uncharacterized protein (Fragment)	AG4045_019612	Apium graveolens (Celery)			"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	AHKREMK	tr|A0A6L5B9X7|A0A6L5B9X7_APIGR Uncharacterized protein (Fragment) OS=Apium graveolens OX=4045 GN=AG4045_019612 PE=3 SV=1	0.78717	1.378	9988.8	14182	11489	10361	8031.4	8089.8	8466.3	0	0	9988.8	0	0	7784.5	0	0	0	0	0	14182	0	0	13185	7461.3	0	8825.6	0	0	0	0	8868.7	11489	0	0	9181.6	0	10361	0	0	0	0	0	0	0	0	0	0	0	7741.9	8031.4	0
A0A6L5BAM5	A0A6L5BAM5_APIGR	Uncharacterized protein	AG4045_026285	Apium graveolens (Celery)					VFLKLNK	tr|A0A6L5BAM5|A0A6L5BAM5_APIGR Uncharacterized protein OS=Apium graveolens OX=4045 GN=AG4045_026285 PE=4 SV=1;tr|A0A6L5BBT7|A0A6L5BBT7_APIGR Uncharacterized protein OS=Apium graveolens OX=4045 GN=AG4045_029073 PE=4 SV=1;tr|A0A6L5B830|A0A6L5B830_APIGR Uncha	0.92934	1.378	0	0	17445	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17445	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L5BAV2	A0A6L5BAV2_APIGR	Uncharacterized protein	AG4045_008777	Apium graveolens (Celery)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		DGGGNCR	tr|A0A6L5BAV2|A0A6L5BAV2_APIGR Uncharacterized protein OS=Apium graveolens OX=4045 GN=AG4045_008777 PE=4 SV=1	0.78755	1.378	0	0	32125	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32125	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L5BAY9	A0A6L5BAY9_APIGR	Uncharacterized protein	AG4045_021934	Apium graveolens (Celery)		membrane [GO:0016020]	membrane [GO:0016020]		HAGENME	tr|A0A6L5BAY9|A0A6L5BAY9_APIGR Uncharacterized protein OS=Apium graveolens OX=4045 GN=AG4045_021934 PE=4 SV=1	0.92763	1.378	4330.9	0	0	0	0	0	0	0	0	4330.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L5BBX8	A0A6L5BBX8_APIGR	NAD(P)-bd_dom domain-containing protein	AG4045_021516	Apium graveolens (Celery)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		WHSNLAK	tr|A0A6L5BBX8|A0A6L5BBX8_APIGR NAD(P)-bd_dom domain-containing protein OS=Apium graveolens OX=4045 GN=AG4045_021516 PE=4 SV=1	0.9281	1.378	0	0	22546	24780	15145	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22546	0	0	0	0	0	0	0	21325	0	19921	24780	0	0	0	0	0	0	15145	0	0	0
A0A6L5BC84	A0A6L5BC84_APIGR	RING-type domain-containing protein	AG4045_018326	Apium graveolens (Celery)					FVKRQNN	tr|A0A6L5BC84|A0A6L5BC84_APIGR RING-type domain-containing protein OS=Apium graveolens OX=4045 GN=AG4045_018326 PE=4 SV=1	0.79244	1.378	18260	17060	14180	14799	12384	0	0	0	18260	0	0	0	0	0	0	0	0	0	0	0	0	17060	0	0	0	0	0	0	0	14180	0	0	0	0	0	14799	0	0	0	0	0	0	0	0	0	0	0	12384	0	0
A0A6L5BDB6	A0A6L5BDB6_APIGR	Uncharacterized protein	AG4045_023678	Apium graveolens (Celery)					RLALLPK	tr|A0A6L5BDB6|A0A6L5BDB6_APIGR Uncharacterized protein OS=Apium graveolens OX=4045 GN=AG4045_023678 PE=4 SV=1	0.92848	1.378	687920	0	10606	0	52008	12635	0	687920	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10606	0	0	0	0	0	0	0	0	0	0	0	0	52008	0	0	4382.6	7666.8	0
A0A6L5BDJ1	A0A6L5BDJ1_APIGR	Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8)	AG4045_016364	Apium graveolens (Celery)	protein folding [GO:0006457]		peptidyl-prolyl cis-trans isomerase activity [GO:0003755]; protein folding [GO:0006457]	peptidyl-prolyl cis-trans isomerase activity [GO:0003755]	TGSDSGK	tr|A0A6L5BDJ1|A0A6L5BDJ1_APIGR Peptidyl-prolyl cis-trans isomerase OS=Apium graveolens OX=4045 GN=AG4045_016364 PE=3 SV=1	0.92736	1.378	0	0	2400.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2400.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A0B5D2M9	A0A0B5D2M9_ARTAN	Terpene cyclase/mutase family member (EC 5.4.99.-)		Artemisia annua (Sweet wormwood)	triterpenoid biosynthetic process [GO:0016104]	lipid droplet [GO:0005811]	lipid droplet [GO:0005811]; beta-amyrin synthase activity [GO:0042300]; lanosterol synthase activity [GO:0000250]; triterpenoid biosynthetic process [GO:0016104]	beta-amyrin synthase activity [GO:0042300]; lanosterol synthase activity [GO:0000250]	ELFQRMWLVDSSKPVER	tr|A0A0B5D2M9|A0A0B5D2M9_ARTAN Terpene cyclase/mutase family member OS=Artemisia annua OX=35608 PE=2 SV=1;tr|A0A2U1MWA8|A0A2U1MWA8_ARTAN Oxidosqualene cyclase 3 OS=Artemisia annua OX=35608 GN=CTI12_AA329600 PE=3 SV=1	0.80375	1.378	0	18448	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18448	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1KH03	A0A2U1KH03_ARTAN	Zinc-finger domain of monoamine-oxidase A repressor R1	CTI12_AA604280	Artemisia annua (Sweet wormwood)	"regulation of transcription, DNA-templated [GO:0006355]"	cytoplasm [GO:0005737]; nucleus [GO:0005634]	"cytoplasm [GO:0005737]; nucleus [GO:0005634]; regulation of transcription, DNA-templated [GO:0006355]"		PKPVKPLR	tr|A0A2U1KH03|A0A2U1KH03_ARTAN Zinc-finger domain of monoamine-oxidase A repressor R1 OS=Artemisia annua OX=35608 GN=CTI12_AA604280 PE=4 SV=1;tr|A0A2U1PBR0|A0A2U1PBR0_ARTAN High mobility group box domain-containing protein OS=Artemisia annua OX=35608 GN=CT	0.80556	2.4305	13219	19293	16795	5109.8	7590.5	7223.1	5127.4	13219	8767.8	0	0	0	7479.3	7408.7	8282.5	0	0	19293	0	0	0	12168	0	0	0	0	0	0	0	0	0	16795	0	2727	0	0	5109.8	0	0	0	3530.1	0	0	6963	0	4648.6	0	3366.8	7590.5	0
A0A2U1KHX1	A0A2U1KHX1_ARTAN	Chaperone DnaJ	CTI12_AA580770	Artemisia annua (Sweet wormwood)	protein folding [GO:0006457]		Hsp70 protein binding [GO:0030544]; protein folding [GO:0006457]	Hsp70 protein binding [GO:0030544]	NIWEFLLFLR	tr|A0A2U1KHX1|A0A2U1KHX1_ARTAN Chaperone DnaJ OS=Artemisia annua OX=35608 GN=CTI12_AA580770 PE=4 SV=1;tr|A0A2U1PQ24|A0A2U1PQ24_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA126660 PE=4 SV=1	0.81667	2.1446	2515.5	0	0	0	0	0	0	0	0	0	2515.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1KIS0	A0A2U1KIS0_ARTAN	Minichromosome maintenance (MCM2/3/5) family protein	CTI12_AA598240	Artemisia annua (Sweet wormwood)			GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	CTARSRK	tr|A0A2U1KIS0|A0A2U1KIS0_ARTAN Minichromosome maintenance (MCM2/3/5) family protein OS=Artemisia annua OX=35608 GN=CTI12_AA598240 PE=4 SV=1	0.89005	1.378	18536	16734	0	0	13657	0	0	0	13043	11886	0	18536	0	0	0	0	0	6956.2	16734	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13657	0	0	0	0
A0A2U1KMF1	A0A2U1KMF1_ARTAN	"Modifier of snc1,4"	CTI12_AA585870	Artemisia annua (Sweet wormwood)	mRNA processing [GO:0006397]; RNA splicing [GO:0008380]	nucleus [GO:0005634]	nucleus [GO:0005634]; mRNA processing [GO:0006397]; RNA splicing [GO:0008380]		SMEEEIR	"tr|A0A2U1KMF1|A0A2U1KMF1_ARTAN Modifier of snc1,4 OS=Artemisia annua OX=35608 GN=CTI12_AA585870 PE=4 SV=1;tr|A0A251VD28|A0A251VD28_HELAN Putative modifier of snc1,4 OS=Helianthus annuus OX=4232 GN=MOS4 PE=4 SV=1;tr|A0A2U1MDR1|A0A2U1MDR1_ARTAN Pre-mRNA-spli"	0.78251	1.378	0	48326	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	48326	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1KMV0	A0A2U1KMV0_ARTAN	"Pheromone shutdown, TraB"	CTI12_AA585120	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		PLLHKAK	"tr|A0A2U1KMV0|A0A2U1KMV0_ARTAN Pheromone shutdown, TraB OS=Artemisia annua OX=35608 GN=CTI12_AA585120 PE=4 SV=1"	0.83413	1.378	21775	0	0	0	0	0	0	0	0	21775	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1KMX8	A0A2U1KMX8_ARTAN	"Zinc finger, FYVE/PHD-type"	CTI12_AA584150	Artemisia annua (Sweet wormwood)			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	LLPKPPK	"tr|A0A2U1KMX8|A0A2U1KMX8_ARTAN Zinc finger, FYVE/PHD-type OS=Artemisia annua OX=35608 GN=CTI12_AA584150 PE=4 SV=1;tr|A0A2U1NX02|A0A2U1NX02_ARTAN Zinc finger, FYVE/PHD-type OS=Artemisia annua OX=35608 GN=CTI12_AA218850 PE=4 SV=1;tr|A0A6L2J1V9|A0A6L2J1V9_TAN"	0.86726	1.3821	42739000	78537000	1067000	40917000	42216000	42739000	384670	694990	424800	446800	984940	253150	583840	721200	540540	631950	78537000	43747000	661090	1333800	1133900	490010	762270	819950	322120	854630	934800	828550	1067000	955890	636290	417730	574150	504720	38360000	825340	978810	1004000	40917000	32939000	1010600	42216000	1409000	537030	503970	316720	671060	494020	36848000	29466000
A0A2U1KMZ7	A0A2U1KMZ7_ARTAN	Seven transmembrane MLO family protein	CTI12_AA584060	Artemisia annua (Sweet wormwood)	defense response [GO:0006952]; response to biotic stimulus [GO:0009607]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; defense response [GO:0006952]; response to biotic stimulus [GO:0009607]		PCSTGGR	tr|A0A2U1KMZ7|A0A2U1KMZ7_ARTAN Seven transmembrane MLO family protein OS=Artemisia annua OX=35608 GN=CTI12_AA584060 PE=3 SV=1	0.83404	1.378	0	0	0	2857.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2857.3	0	0	0	0	0	0	0	0	0	0	0
A0A2U1KN62	A0A2U1KN62_ARTAN	AAA+ ATPase domain-containing protein	CTI12_AA582570	Artemisia annua (Sweet wormwood)	DNA replication [GO:0006260]	DNA replication factor C complex [GO:0005663]	DNA replication factor C complex [GO:0005663]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA clamp loader activity [GO:0003689]; DNA replication [GO:0006260]	ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA clamp loader activity [GO:0003689]	PIRIFCK	tr|A0A2U1KN62|A0A2U1KN62_ARTAN AAA+ ATPase domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA582570 PE=4 SV=1	0.83396	1.378	20114	18121	15317	23667	20166	0	20114	15676	0	0	0	0	0	0	18121	0	0	0	0	0	0	0	0	15317	0	0	0	0	0	0	0	0	0	23667	0	0	0	0	0	0	0	0	0	0	0	0	0	20166	0	0
A0A2U1KR16	A0A2U1KR16_ARTAN	DUF659 domain-containing protein	CTI12_AA574430	Artemisia annua (Sweet wormwood)					TKGLFKK	tr|A0A2U1KR16|A0A2U1KR16_ARTAN DUF659 domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA574430 PE=4 SV=1	0.83475	1.378	0	0	0	17253	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17253	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1KRP0	A0A2U1KRP0_ARTAN	"Zinc finger, GRF-type"	CTI12_AA572270	Artemisia annua (Sweet wormwood)			zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	VLEAQNR	"tr|A0A2U1KRP0|A0A2U1KRP0_ARTAN Zinc finger, GRF-type OS=Artemisia annua OX=35608 GN=CTI12_AA572270 PE=4 SV=1;tr|A0A164UH10|A0A164UH10_DAUCS RING-type E3 ubiquitin transferase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_025949 PE=4 SV=1"	0.90206	1.378	26897	34473	0	0	0	0	0	0	0	0	0	26897	0	0	0	0	0	0	34473	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1KS53	A0A2U1KS53_ARTAN	Non-heme dioxygenase N-terminal domain-containing protein	CTI12_AA570600	Artemisia annua (Sweet wormwood)			dioxygenase activity [GO:0051213]; metal ion binding [GO:0046872]	dioxygenase activity [GO:0051213]; metal ion binding [GO:0046872]	RAIDACK	tr|A0A2U1KS53|A0A2U1KS53_ARTAN Non-heme dioxygenase N-terminal domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA570600 PE=3 SV=1;tr|A0A6S7LEF4|A0A6S7LEF4_LACSI Fe2OG dioxygenase domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_	0.83415	1.378	15047	37095	15450	34497	0	0	0	0	12238	0	0	0	0	15047	0	0	0	0	0	0	0	0	37095	0	15450	0	0	0	0	0	11189	0	34497	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1KT76	A0A2U1KT76_ARTAN	Protein arginine N-methyltransferase	CTI12_AA546060	Artemisia annua (Sweet wormwood)			protein-arginine N-methyltransferase activity [GO:0016274]	protein-arginine N-methyltransferase activity [GO:0016274]	MVGPVFK	tr|A0A2U1KT76|A0A2U1KT76_ARTAN Protein arginine N-methyltransferase OS=Artemisia annua OX=35608 GN=CTI12_AA546060 PE=4 SV=1	0.82843	1.378	0	0	0	0	939.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	939.23	0	0	0	0	0	0	0
A0A2U1KTE8	A0A2U1KTE8_ARTAN	Uncharacterized protein	CTI12_AA493020	Artemisia annua (Sweet wormwood)					QVLVGCN	tr|A0A2U1KTE8|A0A2U1KTE8_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA493020 PE=4 SV=1	0.83226	1.378	11614	0	474510	421620	13761	0	0	0	0	11609	0	0	0	11614	0	0	0	0	0	0	0	0	0	46287	36552	27971	0	474510	0	0	22411	0	421620	17350	0	0	0	0	0	0	0	0	0	0	0	13761	0	0	0	0
A0A2U1KUT5	A0A2U1KUT5_ARTAN	"Transcription elongation factor, TFIIS/CRSP70"	CTI12_AA543990	Artemisia annua (Sweet wormwood)		nucleus [GO:0005634]	nucleus [GO:0005634]; translation elongation factor activity [GO:0003746]	translation elongation factor activity [GO:0003746]	VHDESAK	"tr|A0A2U1KUT5|A0A2U1KUT5_ARTAN Transcription elongation factor, TFIIS/CRSP70 OS=Artemisia annua OX=35608 GN=CTI12_AA543990 PE=4 SV=1;tr|A0A2U1MZ17|A0A2U1MZ17_ARTAN Transcription elongation factor, TFIIS/CRSP70 OS=Artemisia annua OX=35608 GN=CTI12_AA326500 "	0.67857	2.756	0	0	10335	4719.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10335	0	0	0	0	0	0	4719.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1KVB0	A0A2U1KVB0_ARTAN	Dual specificity phosphatase	CTI12_AA552410	Artemisia annua (Sweet wormwood)			protein tyrosine/serine/threonine phosphatase activity [GO:0008138]	protein tyrosine/serine/threonine phosphatase activity [GO:0008138]	MASMSGS	tr|A0A2U1KVB0|A0A2U1KVB0_ARTAN Dual specificity phosphatase OS=Artemisia annua OX=35608 GN=CTI12_AA552410 PE=4 SV=1	0.83775	1.378	37703	14139	0	9711.8	8941.2	0	0	0	10371	0	0	37703	0	0	0	0	0	0	0	0	0	6580.1	14139	0	0	0	0	0	0	0	0	0	0	9711.8	0	0	0	0	0	0	0	0	8941.2	3513.3	0	0	0	0	0	0
A0A2U1KVC7	A0A2U1KVC7_ARTAN	AP2/ERF domain-containing protein	CTI12_AA560600	Artemisia annua (Sweet wormwood)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	DGNNGER	tr|A0A2U1KVC7|A0A2U1KVC7_ARTAN AP2/ERF domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA560600 PE=4 SV=1	0.8382	1.378	26365	12273	22392	14988	18760	0	0	0	0	0	26365	2419.6	0	0	0	0	0	0	0	12273	0	0	0	0	0	0	0	22392	0	0	0	0	0	0	14988	0	0	0	0	0	0	0	0	0	18760	0	0	0	0	0
A0A2U1KVS4	A0A2U1KVS4_ARTAN	Nudix hydrolase	CTI12_AA559380	Artemisia annua (Sweet wormwood)			hydrolase activity [GO:0016787]	hydrolase activity [GO:0016787]	EDNKKLK	tr|A0A2U1KVS4|A0A2U1KVS4_ARTAN Nudix hydrolase OS=Artemisia annua OX=35608 GN=CTI12_AA559380 PE=4 SV=1;tr|A0A2U1NDH5|A0A2U1NDH5_ARTAN Proline-rich spliceosome-associated (PSP) family protein OS=Artemisia annua OX=35608 GN=CTI12_AA279490 PE=4 SV=1;tr|A0A2U1	0.76316	2.4106	0	0	0	0	115090	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	115090	0	0	0	0	0
A0A2U1KW59	A0A2U1KW59_ARTAN	"RNA-directed DNA polymerase, eukaryota, Reverse transcriptase zinc-binding domain protein"	CTI12_AA557730	Artemisia annua (Sweet wormwood)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	TFVLKAK	"tr|A0A2U1KW59|A0A2U1KW59_ARTAN RNA-directed DNA polymerase, eukaryota, Reverse transcriptase zinc-binding domain protein OS=Artemisia annua OX=35608 GN=CTI12_AA557730 PE=4 SV=1"	0.83856	1.378	0	18301	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18301	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1KXC2	A0A2U1KXC2_ARTAN	Uncharacterized protein	CTI12_AA554170	Artemisia annua (Sweet wormwood)					PKIIALR	tr|A0A2U1KXC2|A0A2U1KXC2_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA554170 PE=4 SV=1;tr|A0A2U1PTY0|A0A2U1PTY0_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA112970 PE=4 SV=1	0.83741	1.378	1110300	1437500	1047400	522450	193480	0	0	1110300	0	0	124710	0	716390	551480	0	0	0	0	0	0	623940	0	1437500	0	0	0	1047400	464980	0	12644	26978	0	0	0	0	0	0	522450	0	0	0	0	0	0	0	0	29725	193480	0	0
A0A2U1KXC6	A0A2U1KXC6_ARTAN	ACT domain-containing protein	CTI12_AA548680	Artemisia annua (Sweet wormwood)					RNENDFV	tr|A0A2U1KXC6|A0A2U1KXC6_ARTAN ACT domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA548680 PE=4 SV=1	0.83785	1.378	328230	0	391570	0	0	0	0	0	0	0	0	0	0	328230	0	0	0	0	0	0	0	0	0	0	0	0	391570	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1L170	A0A2U1L170_ARTAN	Uncharacterized protein	CTI12_AA541590	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		PVMAKKK	tr|A0A2U1L170|A0A2U1L170_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA541590 PE=4 SV=1;tr|A0A2U1PCW1|A0A2U1PCW1_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA165200 PE=4 SV=1;tr|A0A6L2J3T8|A0A6L2J3T8_TANCI Ant	0.83653	1.378	0	0	0	0	21947	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21947
A0A2U1L1L3	A0A2U1L1L3_ARTAN	Copia-like retrotransposon	CTI12_AA441580	Artemisia annua (Sweet wormwood)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	PKPVVGK	tr|A0A2U1L1L3|A0A2U1L1L3_ARTAN Copia-like retrotransposon OS=Artemisia annua OX=35608 GN=CTI12_AA441580 PE=4 SV=1	0.83644	1.378	0	0	5712	12560	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5712	0	0	0	0	0	0	0	0	0	0	0	0	0	12560	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1L2J2	A0A2U1L2J2_ARTAN	"Concanavalin A-like lectin/glucanase domain, Serine/threonine-protein kinase, SIK1/2"	CTI12_AA537540	Artemisia annua (Sweet wormwood)			ATP binding [GO:0005524]; carbohydrate binding [GO:0030246]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; carbohydrate binding [GO:0030246]; protein serine/threonine kinase activity [GO:0004674]	MNDPYKR	"tr|A0A2U1L2J2|A0A2U1L2J2_ARTAN Concanavalin A-like lectin/glucanase domain, Serine/threonine-protein kinase, SIK1/2 OS=Artemisia annua OX=35608 GN=CTI12_AA537540 PE=3 SV=1"	0.82834	1.378	0	0	0	33667	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33667	0	0	0	0	0	0	0	0	0
A0A2U1L4C5	A0A2U1L4C5_ARTAN	"Band 7 domain, Stomatin family"	CTI12_AA531860	Artemisia annua (Sweet wormwood)					SNCSCHR	"tr|A0A2U1L4C5|A0A2U1L4C5_ARTAN Band 7 domain, Stomatin family OS=Artemisia annua OX=35608 GN=CTI12_AA531860 PE=4 SV=1"	0.81643	1.378	0	0	0	6489.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6489.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1L4K0	A0A2U1L4K0_ARTAN	Annexin	CTI12_AA530360	Artemisia annua (Sweet wormwood)			calcium ion binding [GO:0005509]; calcium-dependent phospholipid binding [GO:0005544]	calcium-dependent phospholipid binding [GO:0005544]; calcium ion binding [GO:0005509]	KLIRQAYQEIYQEDLVK	tr|A0A2U1L4K0|A0A2U1L4K0_ARTAN Annexin OS=Artemisia annua OX=35608 GN=CTI12_AA530360 PE=3 SV=1;tr|A0A2U1NN01|A0A2U1NN01_ARTAN Annexin OS=Artemisia annua OX=35608 GN=CTI12_AA247970 PE=3 SV=1;tr|A0A2U1N0G8|A0A2U1N0G8_ARTAN Annexin OS=Artemisia annua OX=35608	0.89868	1.378	0	0	0	12176	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12176	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1L5D8	A0A2U1L5D8_ARTAN	Galactosyl transferase	CTI12_AA532710	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transferase activity [GO:0016740]	transferase activity [GO:0016740]	PRVLLVP	tr|A0A2U1L5D8|A0A2U1L5D8_ARTAN Galactosyl transferase OS=Artemisia annua OX=35608 GN=CTI12_AA532710 PE=4 SV=1	0.81569	1.378	41154	43971	154530	215140	49492	0	0	0	0	0	41154	0	0	0	0	0	43971	24686	0	0	0	0	40004	0	0	93041	0	154530	73213	0	63519	41714	0	128890	81128	0	31839	38356	0	215140	37765	0	49492	0	0	0	31056	0	0	0
A0A2U1L643	A0A2U1L643_ARTAN	Phloem protein 2-like protein	CTI12_AA526430	Artemisia annua (Sweet wormwood)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	PLPVRVK	tr|A0A2U1L643|A0A2U1L643_ARTAN Phloem protein 2-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA526430 PE=4 SV=1	0.94286	1.378	0	69727	0	0	18233	0	0	0	0	0	0	0	0	0	0	0	0	0	69727	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18233	0	0
A0A2U1L6E3	A0A2U1L6E3_ARTAN	RmlC-like jelly roll fold protein	CTI12_AA525300	Artemisia annua (Sweet wormwood)					DFPPEER	tr|A0A2U1L6E3|A0A2U1L6E3_ARTAN RmlC-like jelly roll fold protein OS=Artemisia annua OX=35608 GN=CTI12_AA525300 PE=4 SV=1	0.81505	1.378	0	11980	16127	25699	0	0	0	0	0	0	0	0	0	0	0	11980	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16127	0	0	0	0	0	25699	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1L778	A0A2U1L778_ARTAN	Glycosyltransferase (EC 2.4.1.-)	CTI12_AA525240	Artemisia annua (Sweet wormwood)			UDP-glycosyltransferase activity [GO:0008194]	UDP-glycosyltransferase activity [GO:0008194]	PFLWVKR	tr|A0A2U1L778|A0A2U1L778_ARTAN Glycosyltransferase OS=Artemisia annua OX=35608 GN=CTI12_AA525240 PE=3 SV=1	0.94161	1.378	0	0	11183	4147.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11183	0	0	0	0	0	0	4147.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LA02	A0A2U1LA02_ARTAN	"ATPase, F1/V1/A1 complex, alpha/beta subunit, Zinc knuckle CX2CX4HX4C"	CTI12_AA253450	Artemisia annua (Sweet wormwood)					NSGNDSK	"tr|A0A2U1LA02|A0A2U1LA02_ARTAN ATPase, F1/V1/A1 complex, alpha/beta subunit, Zinc knuckle CX2CX4HX4C OS=Artemisia annua OX=35608 GN=CTI12_AA253450 PE=4 SV=1"	0.8127	1.378	0	0	0	0	8352.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8352.6	0	0	0	0	0	0
A0A2U1LA05	A0A2U1LA05_ARTAN	GDSL-like Lipase/Acylhydrolase superfamily protein	CTI12_AA514100	Artemisia annua (Sweet wormwood)			"hydrolase activity, acting on ester bonds [GO:0016788]"	"hydrolase activity, acting on ester bonds [GO:0016788]"	GFVEATK	tr|A0A2U1LA05|A0A2U1LA05_ARTAN GDSL-like Lipase/Acylhydrolase superfamily protein OS=Artemisia annua OX=35608 GN=CTI12_AA514100 PE=3 SV=1	0.81314	1.378	43831	25201	0	28484	39129	29555	28284	26970	31102	43831	0	0	0	38765	0	0	0	25201	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28484	0	25071	0	0	0	0	0	0	0	0	0	0	0	0	39129	0
A0A2U1LDB7	A0A2U1LDB7_ARTAN	Uncharacterized protein	CTI12_AA504520	Artemisia annua (Sweet wormwood)					QVACKRR	tr|A0A2U1LDB7|A0A2U1LDB7_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA504520 PE=4 SV=1	0.82129	1.378	14521	0	0	0	0	0	0	0	0	0	0	14521	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LDK7	A0A2U1LDK7_ARTAN	DNA-directed RNA polymerase (EC 2.7.7.6)	CTI12_AA501380	Artemisia annua (Sweet wormwood)	"cell wall macromolecule catabolic process [GO:0016998]; chitin catabolic process [GO:0006032]; purine nucleotide biosynthetic process [GO:0006164]; transcription, DNA-templated [GO:0006351]"		"chitinase activity [GO:0004568]; DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; IMP cyclohydrolase activity [GO:0003937]; phosphoribosylaminoimidazolecarboxamide formyltransferase activity [GO:0004643]; ribonucleoside binding [GO:0032549]; cell wall macromolecule catabolic process [GO:0016998]; chitin catabolic process [GO:0006032]; purine nucleotide biosynthetic process [GO:0006164]; transcription, DNA-templated [GO:0006351]"	chitinase activity [GO:0004568]; DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; IMP cyclohydrolase activity [GO:0003937]; phosphoribosylaminoimidazolecarboxamide formyltransferase activity [GO:0004643]; ribonucleoside binding [GO:0032549]	QNPDSYK	tr|A0A2U1LDK7|A0A2U1LDK7_ARTAN DNA-directed RNA polymerase OS=Artemisia annua OX=35608 GN=CTI12_AA501380 PE=3 SV=1	0.82173	1.378	0	49424	0	0	0	0	0	0	0	0	0	0	0	0	0	0	49424	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LDM4	A0A2U1LDM4_ARTAN	Zinc finger MYM-type protein 1	CTI12_AA502270	Artemisia annua (Sweet wormwood)					CATCRKK	tr|A0A2U1LDM4|A0A2U1LDM4_ARTAN Zinc finger MYM-type protein 1 OS=Artemisia annua OX=35608 GN=CTI12_AA502270 PE=4 SV=1	0.82217	1.378	138840	23345	36269	0	108830	0	0	35886	138840	0	0	0	0	12433	0	0	0	0	23345	0	0	0	22660	0	0	0	0	0	0	31486	0	36269	0	0	0	0	0	0	0	0	0	0	0	0	0	108830	0	0	0	56581
A0A2U1LEJ2	A0A2U1LEJ2_ARTAN	"RNA-directed DNA polymerase, eukaryota"	CTI12_AA499780	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	NIPIKLI	"tr|A0A2U1LEJ2|A0A2U1LEJ2_ARTAN RNA-directed DNA polymerase, eukaryota OS=Artemisia annua OX=35608 GN=CTI12_AA499780 PE=4 SV=1"	0.89937	1.378	5180.4	592010	617400	785490	1534800	3399.1	0	5180.4	0	0	0	0	4013.2	0	592010	0	0	191340	0	58169	30797	0	0	15740	337490	13538	0	0	617400	0	0	14065	0	0	0	785490	2967.8	29198	11751	9938.6	2290.6	1534800	53349	457770	10220	0	4140.2	0	1720.9	0
A0A2U1LFT6	A0A2U1LFT6_ARTAN	Uncharacterized protein	CTI12_AA489650	Artemisia annua (Sweet wormwood)					STFSGYC	tr|A0A2U1LFT6|A0A2U1LFT6_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA489650 PE=4 SV=1;tr|A0A699Q3Y1|A0A699Q3Y1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_831692 PE=4 SV=1	0.82047	1.378	0	14475	9162.3	6332	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14475	0	0	0	0	0	0	9162.3	0	0	0	0	0	0	0	0	0	0	0	0	6332	0	0	0	0	0	0	0	0	0	0
A0A2U1LG86	A0A2U1LG86_ARTAN	Uncharacterized protein	CTI12_AA485430	Artemisia annua (Sweet wormwood)					VAGLDYR	tr|A0A2U1LG86|A0A2U1LG86_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA485430 PE=4 SV=1;tr|A0A2J6L527|A0A2J6L527_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_2X107300 PE=3 SV=1;tr|A0A251SM22|A0A251SM22_HELAN Putati	0.82236	1.378	195770	217610	0	112920	227800	0	195770	0	0	0	0	0	0	0	217610	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	112920	0	0	227800	0	110410	204110	211420	0	0	0
A0A2U1LGJ6	A0A2U1LGJ6_ARTAN	Heat stress transcription factor B-2a	CTI12_AA493890	Artemisia annua (Sweet wormwood)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	EENEGEA	tr|A0A2U1LGJ6|A0A2U1LGJ6_ARTAN Heat stress transcription factor B-2a OS=Artemisia annua OX=35608 GN=CTI12_AA493890 PE=3 SV=1	0.85032	1.378	0	9264.2	0	0	0	0	0	0	0	0	0	0	0	0	9264.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LGZ3	A0A2U1LGZ3_ARTAN	Alternative NAD(P)H dehydrogenase 1	CTI12_AA492640	Artemisia annua (Sweet wormwood)			oxidoreductase activity [GO:0016491]	oxidoreductase activity [GO:0016491]	FTTTHHR	tr|A0A2U1LGZ3|A0A2U1LGZ3_ARTAN Alternative NAD(P)H dehydrogenase 1 OS=Artemisia annua OX=35608 GN=CTI12_AA492640 PE=4 SV=1	0.8561	1.378	0	0	9697	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9697	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LHX7	A0A2U1LHX7_ARTAN	Zinc knuckle CX2CX4HX4C	CTI12_AA489330	Artemisia annua (Sweet wormwood)					SDHGVFK	tr|A0A2U1LHX7|A0A2U1LHX7_ARTAN Zinc knuckle CX2CX4HX4C OS=Artemisia annua OX=35608 GN=CTI12_AA489330 PE=4 SV=1	0.85602	1.378	0	495090	441830	502740	50204	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	495090	0	0	43069	0	0	0	0	441830	0	0	0	0	0	0	0	0	502740	0	0	0	0	0	0	0	46543	50204	0	0	0
A0A2U1LJ70	A0A2U1LJ70_ARTAN	Uncharacterized protein	CTI12_AA485840	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		MASVSSK	tr|A0A2U1LJ70|A0A2U1LJ70_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA485840 PE=4 SV=1	0.85565	1.378	0	9076.5	0	0	5802.9	0	0	0	0	0	0	0	0	0	0	0	0	9076.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5802.9	0	0
A0A2U1LKG4	A0A2U1LKG4_ARTAN	Uncharacterized protein	CTI12_AA481920	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		ELLILLL	tr|A0A2U1LKG4|A0A2U1LKG4_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA481920 PE=4 SV=1	0.85212	1.378	10582	0	0	0	0	0	0	0	10582	1941.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LKP3	A0A2U1LKP3_ARTAN	"Nucleic acid-binding, OB-fold protein"	CTI12_AA478140	Artemisia annua (Sweet wormwood)	DNA repair [GO:0006281]		DNA binding [GO:0003677]; DNA repair [GO:0006281]	DNA binding [GO:0003677]	RANGNES	"tr|A0A2U1LKP3|A0A2U1LKP3_ARTAN Nucleic acid-binding, OB-fold protein OS=Artemisia annua OX=35608 GN=CTI12_AA478140 PE=4 SV=1"	0.85257	1.378	50956	26289	15428	17505	19838	0	20759	0	27358	50956	0	0	47250	10175	0	0	0	0	26289	0	0	17797	0	0	8162.5	0	0	0	0	15428	0	0	0	0	0	17505	0	0	0	0	0	0	0	19838	0	0	0	0	0	0
A0A2U1LMC6	A0A2U1LMC6_ARTAN	Uncharacterized protein	CTI12_AA475910	Artemisia annua (Sweet wormwood)					VVRVLCR	tr|A0A2U1LMC6|A0A2U1LMC6_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA475910 PE=4 SV=1	0.85325	1.378	17490	0	0	0	0	0	17490	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LMX8	A0A2U1LMX8_ARTAN	Uncharacterized protein	CTI12_AA473820	Artemisia annua (Sweet wormwood)	regulation of proton transport [GO:0010155]	endoplasmic reticulum [GO:0005783]; plasma membrane [GO:0005886]	endoplasmic reticulum [GO:0005783]; plasma membrane [GO:0005886]; regulation of proton transport [GO:0010155]		GDPGGSR	tr|A0A2U1LMX8|A0A2U1LMX8_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA473820 PE=4 SV=1	0.85572	1.378	0	4418.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4418.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LNT9	A0A2U1LNT9_ARTAN	Uncharacterized protein	CTI12_AA471170	Artemisia annua (Sweet wormwood)	"transcription, DNA-templated [GO:0006351]"	nucleus [GO:0005634]; transcription repressor complex [GO:0017053]	"nucleus [GO:0005634]; transcription repressor complex [GO:0017053]; transcription, DNA-templated [GO:0006351]"		LLVSTVK	tr|A0A2U1LNT9|A0A2U1LNT9_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA471170 PE=4 SV=1	0.85945	1.378	3251.5	0	1960.1	0	0	3251.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1960.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LNU5	A0A2U1LNU5_ARTAN	AP2/ERF domain-containing protein	CTI12_AA470670	Artemisia annua (Sweet wormwood)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	AAAMEPR	tr|A0A2U1LNU5|A0A2U1LNU5_ARTAN AP2/ERF domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA470670 PE=4 SV=1;tr|A0A2U1KT45|A0A2U1KT45_ARTAN AP2/ERF domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA565260 PE=4 SV=1;tr|A0A6L2MYR9|	0.79963	1.378	263110	1455000	656900	1047300	923110	0	0	0	0	0	263110	0	24294	0	636740	0	706350	1455000	0	403370	650170	0	0	283530	488360	0	0	602090	0	656900	0	0	0	0	0	0	1047300	0	0	0	507860	0	912210	0	0	91582	524330	0	923110	0
A0A2U1LPB0	A0A2U1LPB0_ARTAN	Chaperone protein ClpB	CTI12_AA469450	Artemisia annua (Sweet wormwood)			ATP binding [GO:0005524]	ATP binding [GO:0005524]	LIGTPQG	tr|A0A2U1LPB0|A0A2U1LPB0_ARTAN Chaperone protein ClpB OS=Artemisia annua OX=35608 GN=CTI12_AA469450 PE=4 SV=1	0.85833	1.378	0	0	0	20128	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20128	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LPE7	A0A2U1LPE7_ARTAN	Uncharacterized protein	CTI12_AA467250	Artemisia annua (Sweet wormwood)					PLKLISK	tr|A0A2U1LPE7|A0A2U1LPE7_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA467250 PE=4 SV=1;tr|A0A699MDW5|A0A699MDW5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_743293 PE=4 SV=1;tr|A0A699I0R1|A0	0.7892	1.378	34847	27245	0	43890	0	0	8235.8	34847	0	0	0	0	0	0	0	0	0	0	0	0	0	27245	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	43890	0	0	0	0	0	0	0	0	0	0
A0A2U1LQ08	A0A2U1LQ08_ARTAN	F-box domain-containing protein	CTI12_AA304990	Artemisia annua (Sweet wormwood)					TVCKRWK	tr|A0A2U1LQ08|A0A2U1LQ08_ARTAN F-box domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA304990 PE=4 SV=1;tr|A0A2U1LQ19|A0A2U1LQ19_ARTAN F-box domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA304980 PE=4 SV=1	0.85774	1.378	0	10538	21418	11650	2721.5	0	0	0	0	0	0	0	0	0	10538	0	0	0	0	0	0	0	0	0	0	0	0	0	21418	0	0	0	0	0	0	0	11650	0	0	0	0	0	0	0	0	0	0	2721.5	0	0
A0A2U1LQ90	A0A2U1LQ90_ARTAN	Survival protein SurE-like phosphatase/nucleotidase	CTI12_AA464240	Artemisia annua (Sweet wormwood)			metal ion binding [GO:0046872]; nucleotidase activity [GO:0008252]	metal ion binding [GO:0046872]; nucleotidase activity [GO:0008252]	GGDDDDR	tr|A0A2U1LQ90|A0A2U1LQ90_ARTAN Survival protein SurE-like phosphatase/nucleotidase OS=Artemisia annua OX=35608 GN=CTI12_AA464240 PE=3 SV=1;tr|A0A2U1LQ97|A0A2U1LQ97_ARTAN Survival protein SurE-like phosphatase/nucleotidase OS=Artemisia annua OX=35608 GN=CTI	0.85819	1.378	5098.3	0	0	6550.9	3607.6	0	0	5098.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4514.6	0	0	6550.9	0	0	0	0	0	0	0	0	0	0	3607.6	0	0	0
A0A2U1LQ98	A0A2U1LQ98_ARTAN	Small auxin-up RNA	CTI12_AA465750	Artemisia annua (Sweet wormwood)	response to auxin [GO:0009733]		response to auxin [GO:0009733]		LGSHGAK	tr|A0A2U1LQ98|A0A2U1LQ98_ARTAN Small auxin-up RNA OS=Artemisia annua OX=35608 GN=CTI12_AA465750 PE=3 SV=1	0.9021	1.378	27180	62084	0	177920	66054	0	0	0	0	0	27180	0	0	0	0	21992	0	0	0	62084	29810	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	57590	137880	177920	177350	66054	0	0	0	0	45231	0	0	0
A0A2U1LQC2	A0A2U1LQC2_ARTAN	Riboflavin kinase (EC 2.7.1.26)	CTI12_AA466000	Artemisia annua (Sweet wormwood)	FMN biosynthetic process [GO:0009398]; riboflavin biosynthetic process [GO:0009231]		ATP binding [GO:0005524]; riboflavin kinase activity [GO:0008531]; FMN biosynthetic process [GO:0009398]; riboflavin biosynthetic process [GO:0009231]	ATP binding [GO:0005524]; riboflavin kinase activity [GO:0008531]	MSECNLR	tr|A0A2U1LQC2|A0A2U1LQC2_ARTAN Riboflavin kinase OS=Artemisia annua OX=35608 GN=CTI12_AA466000 PE=4 SV=1	0.85863	1.378	37455	34063	0	0	0	0	29327	0	0	25551	0	0	0	37455	0	0	0	17778	34063	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LQV1	A0A2U1LQV1_ARTAN	Serine-threonine/tyrosine-protein kinase catalytic domain-containing protein	CTI12_AA465180	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	GSKTHNR	tr|A0A2U1LQV1|A0A2U1LQV1_ARTAN Serine-threonine/tyrosine-protein kinase catalytic domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA465180 PE=4 SV=1;tr|A0A2U1LQW9|A0A2U1LQW9_ARTAN Serine-threonine/tyrosine-protein kinase catalytic domain-con	0.85821	1.378	0	0	0	10491	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10491	0	3457.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LT13	A0A2U1LT13_ARTAN	NB-ARC domains-containing protein	CTI12_AA457700	Artemisia annua (Sweet wormwood)					TFPPIYR	tr|A0A2U1LT13|A0A2U1LT13_ARTAN NB-ARC domains-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA457700 PE=4 SV=1;tr|A0A2U1L3V0|A0A2U1L3V0_ARTAN NB-ARC domains-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA361080 PE=4 SV=1	0.81652	1.378	0	0	0	0	35017	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35017	34498	0	0	0	0	0
A0A2U1LTG5	A0A2U1LTG5_ARTAN	Purple acid phosphatase (EC 3.1.3.2)	CTI12_AA450910	Artemisia annua (Sweet wormwood)			acid phosphatase activity [GO:0003993]; metal ion binding [GO:0046872]	acid phosphatase activity [GO:0003993]; metal ion binding [GO:0046872]	SAHSYER	tr|A0A2U1LTG5|A0A2U1LTG5_ARTAN Purple acid phosphatase OS=Artemisia annua OX=35608 GN=CTI12_AA450910 PE=3 SV=1	0.8558	1.378	28704	768760	42387	0	577500	28704	25188	0	0	0	0	0	0	0	431180	0	0	0	768760	0	0	494900	0	15044	15713	0	0	0	0	0	0	42387	0	0	0	0	0	0	0	0	0	0	0	577500	14258	0	0	0	0	0
A0A2U1LTJ0	A0A2U1LTJ0_ARTAN	Pyruvate kinase	CTI12_AA247450	Artemisia annua (Sweet wormwood)			kinase activity [GO:0016301]; magnesium ion binding [GO:0000287]; potassium ion binding [GO:0030955]; pyruvate kinase activity [GO:0004743]	kinase activity [GO:0016301]; magnesium ion binding [GO:0000287]; potassium ion binding [GO:0030955]; pyruvate kinase activity [GO:0004743]	GESSHMF	tr|A0A2U1LTJ0|A0A2U1LTJ0_ARTAN Pyruvate kinase OS=Artemisia annua OX=35608 GN=CTI12_AA247450 PE=4 SV=1	0.85039	1.378	6757.9	7775.8	6546.1	5839.8	8092.7	0	5875	4778.8	0	0	0	0	6757.9	0	0	0	5258.4	0	7775.8	0	0	0	0	6546.1	0	0	0	0	0	0	5577.5	0	0	0	0	0	0	0	0	5839.8	0	0	0	0	0	0	0	5993.2	8092.7	0
A0A2U1LTV0	A0A2U1LTV0_ARTAN	Uncharacterized protein	CTI12_AA454840	Artemisia annua (Sweet wormwood)	photosynthesis [GO:0015979]	chloroplast thylakoid membrane [GO:0009535]; photosystem I reaction center [GO:0009538]	chloroplast thylakoid membrane [GO:0009535]; photosystem I reaction center [GO:0009538]; photosynthesis [GO:0015979]		NNEDDMR	tr|A0A2U1LTV0|A0A2U1LTV0_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA454840 PE=3 SV=1	0.84186	1.378	3400.7	9620.7	0	0	8832.8	0	3400.7	0	0	0	0	0	0	0	0	0	0	0	9620.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8832.8	0	0	0	0	809.35	0	0	0
A0A2U1LUG3	A0A2U1LUG3_ARTAN	Sterile alpha motif/pointed domain-containing protein	CTI12_AA452530	Artemisia annua (Sweet wormwood)					RSINNQK	tr|A0A2U1LUG3|A0A2U1LUG3_ARTAN Sterile alpha motif/pointed domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA452530 PE=4 SV=1	0.8423	1.378	0	10897	7170	10166	25029	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10897	0	7170	0	0	0	0	0	0	0	0	10166	0	0	0	0	0	0	0	0	0	0	0	0	0	25029	0	0
A0A2U1LV82	A0A2U1LV82_ARTAN	"RNA-directed DNA polymerase, eukaryota, Reverse transcriptase zinc-binding domain protein"	CTI12_AA386860	Artemisia annua (Sweet wormwood)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	VLKKPFR	"tr|A0A2U1LV82|A0A2U1LV82_ARTAN RNA-directed DNA polymerase, eukaryota, Reverse transcriptase zinc-binding domain protein OS=Artemisia annua OX=35608 GN=CTI12_AA386860 PE=4 SV=1"	0.84116	1.378	11008	18137	34703	10337	7301.9	0	0	0	0	0	11008	0	0	0	0	0	0	0	0	18137	0	0	0	0	0	0	0	34703	0	0	0	0	0	0	9710.4	0	0	10337	0	0	0	7301.9	0	0	3301.9	0	0	0	0	0
A0A2U1LV96	A0A2U1LV96_ARTAN	Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein	CTI12_AA450380	Artemisia annua (Sweet wormwood)		ribosome [GO:0005840]	ribosome [GO:0005840]		VKFATKK	tr|A0A2U1LV96|A0A2U1LV96_ARTAN Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein OS=Artemisia annua OX=35608 GN=CTI12_AA450380 PE=4 SV=1	0.84161	1.378	0	0	0	10172	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10172	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LVQ3	A0A2U1LVQ3_ARTAN	NB-ARC domains-containing protein	CTI12_AA448700	Artemisia annua (Sweet wormwood)	signal transduction [GO:0007165]		signal transduction [GO:0007165]		DDDEMER	tr|A0A2U1LVQ3|A0A2U1LVQ3_ARTAN NB-ARC domains-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA448700 PE=4 SV=1	0.80597	2.1229	0	0	6433.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6433.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LVZ9	A0A2U1LVZ9_ARTAN	"RIN4, pathogenic type III effector avirulence factor Avr cleavage site"	CTI12_AA448450	Artemisia annua (Sweet wormwood)					HTGGGGK	"tr|A0A2U1LVZ9|A0A2U1LVZ9_ARTAN RIN4, pathogenic type III effector avirulence factor Avr cleavage site OS=Artemisia annua OX=35608 GN=CTI12_AA448450 PE=4 SV=1"	0.84152	1.378	22219	42822	20847	21572	0	0	0	0	20302	22219	0	0	0	0	0	0	0	42822	27770	0	0	20739	0	0	0	0	0	0	0	0	0	20847	0	16326	0	21572	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LW15	A0A2U1LW15_ARTAN	CDK inhibitor P21 binding protein	CTI12_AA446440	Artemisia annua (Sweet wormwood)					MPRRPSR	tr|A0A2U1LW15|A0A2U1LW15_ARTAN CDK inhibitor P21 binding protein OS=Artemisia annua OX=35608 GN=CTI12_AA446440 PE=3 SV=1	0.84197	1.378	0	9268.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9268.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LWM9	A0A2U1LWM9_ARTAN	ELM2 domain-containing protein	CTI12_AA447100	Artemisia annua (Sweet wormwood)		nucleus [GO:0005634]	nucleus [GO:0005634]		PSHADDY	tr|A0A2U1LWM9|A0A2U1LWM9_ARTAN ELM2 domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA447100 PE=4 SV=1	0.84241	1.378	3491.8	2848.3	0	0	0	0	0	0	3491.8	0	0	3080	0	0	0	0	0	0	0	0	0	2848.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LX32	A0A2U1LX32_ARTAN	Glycine-rich domain-containing protein-like protein	CTI12_AA443910	Artemisia annua (Sweet wormwood)					FHIAQQK	tr|A0A2U1LX32|A0A2U1LX32_ARTAN Glycine-rich domain-containing protein-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA443910 PE=4 SV=1	0.8433	1.378	16174	13462	0	21521	12945	15887	0	16174	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13462	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21521	0	0	0	0	12945	0	0	0	0
A0A2U1LXQ5	A0A2U1LXQ5_ARTAN	Multiple chloroplast division site 1	CTI12_AA442130	Artemisia annua (Sweet wormwood)	chloroplast fission [GO:0010020]	chloroplast [GO:0009507]; integral component of membrane [GO:0016021]	chloroplast [GO:0009507]; integral component of membrane [GO:0016021]; chloroplast fission [GO:0010020]		GDSNLQR	tr|A0A2U1LXQ5|A0A2U1LXQ5_ARTAN Multiple chloroplast division site 1 OS=Artemisia annua OX=35608 GN=CTI12_AA442130 PE=4 SV=1;tr|A0A103YEL8|A0A103YEL8_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_013983 PE=4 SV=1;tr|A0A5	0.78798	1.378	0	0	239230	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	239230	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LXQ7	A0A2U1LXQ7_ARTAN	Cytochrome P450	CTI12_AA441200	Artemisia annua (Sweet wormwood)			"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	FTGMNRK	tr|A0A2U1LXQ7|A0A2U1LXQ7_ARTAN Cytochrome P450 OS=Artemisia annua OX=35608 GN=CTI12_AA441200 PE=3 SV=1	0.84375	1.378	0	0	0	5868.4	10433	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5868.4	0	0	0	0	0	0	10433	0	0	0	0	0	0	0	0
A0A2U1LYZ3	A0A2U1LYZ3_ARTAN	"Leucine-rich repeat-containing N-terminal, type 2"	CTI12_AA437650	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	FGFSFGK	"tr|A0A2U1LYZ3|A0A2U1LYZ3_ARTAN Leucine-rich repeat-containing N-terminal, type 2 OS=Artemisia annua OX=35608 GN=CTI12_AA437650 PE=3 SV=1"	0.84286	1.378	306890	0	0	0	0	0	306890	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1LZE7	A0A2U1LZE7_ARTAN	Thioredoxin domain-containing protein	CTI12_AA436850	Artemisia annua (Sweet wormwood)					SSQAYTG	tr|A0A2U1LZE7|A0A2U1LZE7_ARTAN Thioredoxin domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA436850 PE=4 SV=1	0.84247	1.378	0	27524	8619.6	17937	15820	0	0	0	0	0	0	0	0	0	0	0	0	0	27524	0	0	20638	16866	0	8619.6	0	0	0	0	0	0	0	17937	0	0	0	0	0	0	0	0	0	0	7095.1	0	13446	0	0	15820	0
A0A2U1M0J1	A0A2U1M0J1_ARTAN	Peptidylprolyl isomerase (EC 5.2.1.8)	CTI12_AA432100	Artemisia annua (Sweet wormwood)			peptidyl-prolyl cis-trans isomerase activity [GO:0003755]	peptidyl-prolyl cis-trans isomerase activity [GO:0003755]	RALKGAK	tr|A0A2U1M0J1|A0A2U1M0J1_ARTAN Peptidylprolyl isomerase OS=Artemisia annua OX=35608 GN=CTI12_AA432100 PE=4 SV=1;tr|A0A5N6PY17|A0A5N6PY17_9ASTR Peptidylprolyl isomerase OS=Mikania micrantha OX=192012 GN=E3N88_00410 PE=4 SV=1;tr|A0A2J6LPT3|A0A2J6LPT3_LACSA P	0.81386	1.378	0	0	6222.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6222.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1M185	A0A2U1M185_ARTAN	Glyceraldehyde-3-phosphate dehydrogenase	CTI12_AA433980	Artemisia annua (Sweet wormwood)			"oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor [GO:0016620]"	"oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor [GO:0016620]"	YILLLLK	tr|A0A2U1M185|A0A2U1M185_ARTAN Glyceraldehyde-3-phosphate dehydrogenase OS=Artemisia annua OX=35608 GN=CTI12_AA433980 PE=3 SV=1;tr|A0A2U1PAT4|A0A2U1PAT4_ARTAN Protein TIC 20 OS=Artemisia annua OX=35608 GN=CTI12_AA172160 PE=3 SV=1	0.84813	1.378	4718.4	5770.3	0	0	0	0	0	0	4718.4	0	0	0	0	0	0	0	0	4385.9	0	0	0	0	5770.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1M199	A0A2U1M199_ARTAN	Anaphase-promoting complex subunit 1	CTI12_AA430930	Artemisia annua (Sweet wormwood)	cell cycle [GO:0007049]; cell division [GO:0051301]	anaphase-promoting complex [GO:0005680]	anaphase-promoting complex [GO:0005680]; ligase activity [GO:0016874]; cell cycle [GO:0007049]; cell division [GO:0051301]	ligase activity [GO:0016874]	HVLDKCR	tr|A0A2U1M199|A0A2U1M199_ARTAN Anaphase-promoting complex subunit 1 OS=Artemisia annua OX=35608 GN=CTI12_AA430930 PE=3 SV=1;tr|A0A699JIH2|A0A699JIH2_TANCI NBS-LRR resistance-like protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_605869 PE=4 	0.81159	2.1178	9034.6	0	5908.1	0	13237	0	9034.6	0	7634.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5594.8	5908.1	0	0	0	0	0	0	4917.9	0	0	0	0	0	0	0	0	0	0	0	0	0	7006.2	0	13237	0	0
A0A2U1M1A5	A0A2U1M1A5_ARTAN	Aminotransferase-like mobile domain-containing protein	CTI12_AA430710	Artemisia annua (Sweet wormwood)	meristem maintenance [GO:0010073]		transaminase activity [GO:0008483]; meristem maintenance [GO:0010073]	transaminase activity [GO:0008483]	LNIGRPR	"tr|A0A2U1M1A5|A0A2U1M1A5_ARTAN Aminotransferase-like mobile domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA430710 PE=4 SV=1;tr|A0A251TSU5|A0A251TSU5_HELAN Putative aminotransferase-like, plant mobile domain family protein OS=Helianthus an"	0.89894	1.378	6069.5	33950	30154	31477	47984	6069.5	0	0	0	0	0	0	0	0	0	15186	9237.7	0	0	33950	0	0	0	15762	0	0	30154	0	0	0	0	0	0	0	0	0	0	0	31477	0	3803.6	0	47984	0	10513	0	0	0	0	0
A0A2U1M296	A0A2U1M296_ARTAN	Tetratricopeptide-like helical domain-containing protein	CTI12_AA394070	Artemisia annua (Sweet wormwood)					MMNPTKR	tr|A0A2U1M296|A0A2U1M296_ARTAN Tetratricopeptide-like helical domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA394070 PE=4 SV=1	0.84429	1.378	0	0	0	0	208350	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	208350	0	0	0
A0A2U1M2W1	A0A2U1M2W1_ARTAN	Quinoprotein alcohol dehydrogenase-like superfamily	CTI12_AA427080	Artemisia annua (Sweet wormwood)					MSGTYYK	tr|A0A2U1M2W1|A0A2U1M2W1_ARTAN Quinoprotein alcohol dehydrogenase-like superfamily OS=Artemisia annua OX=35608 GN=CTI12_AA427080 PE=4 SV=1	0.84308	1.378	0	0	63349	0	41324	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	63349	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	41324	0
A0A2U1M3V3	A0A2U1M3V3_ARTAN	"Coatomer, alpha subunit, C-terminal"	CTI12_AA418950	Artemisia annua (Sweet wormwood)	intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	COPI vesicle coat [GO:0030126]	COPI vesicle coat [GO:0030126]; structural molecule activity [GO:0005198]; intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	structural molecule activity [GO:0005198]	ILKTKDN	"tr|A0A2U1M3V3|A0A2U1M3V3_ARTAN Coatomer, alpha subunit, C-terminal OS=Artemisia annua OX=35608 GN=CTI12_AA418950 PE=4 SV=1"	0.8125	1.378	137240	0	78569	0	0	0	0	0	137240	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	78569	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1M4C9	A0A2U1M4C9_ARTAN	Na+/H+ antiporter	CTI12_AA422340	Artemisia annua (Sweet wormwood)	regulation of pH [GO:0006885]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; sodium:proton antiporter activity [GO:0015385]; regulation of pH [GO:0006885]	sodium:proton antiporter activity [GO:0015385]	LLLPQPK	tr|A0A2U1M4C9|A0A2U1M4C9_ARTAN Na+/H+ antiporter OS=Artemisia annua OX=35608 GN=CTI12_AA422340 PE=3 SV=1;tr|A0A2U1Q185|A0A2U1Q185_ARTAN Sodium/hydrogen exchanger OS=Artemisia annua OX=35608 GN=CTI12_AA087600 PE=3 SV=1	0.77545	1.378	0	0	0	0	65077	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	65077	0	0	0	0	0	0	0	0
A0A2U1M4L9	A0A2U1M4L9_ARTAN	Pentatricopeptide repeat-containing protein	CTI12_AA420950	Artemisia annua (Sweet wormwood)					MMFDGVK	tr|A0A2U1M4L9|A0A2U1M4L9_ARTAN Pentatricopeptide repeat-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA420950 PE=4 SV=1	0.77588	1.378	0	0	0	21945	3577.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21945	0	0	0	0	0	0	0	3577.7	0	0	0	0	0	0
A0A2U1M578	A0A2U1M578_ARTAN	DUF659 domain-containing protein	CTI12_AA413990	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		PRSLLLI	tr|A0A2U1M578|A0A2U1M578_ARTAN DUF659 domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA413990 PE=4 SV=1	0.77576	1.378	0	63079	0	0	0	0	0	0	0	0	0	0	0	0	63079	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1M5X7	A0A2U1M5X7_ARTAN	Acylsugar acyltransferase 3	CTI12_AA418730	Artemisia annua (Sweet wormwood)			"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	MMETLPR	tr|A0A2U1M5X7|A0A2U1M5X7_ARTAN Acylsugar acyltransferase 3 OS=Artemisia annua OX=35608 GN=CTI12_AA418730 PE=3 SV=1	0.77619	1.378	127600	315310	277390	0	288090	0	0	0	0	0	127600	0	0	0	0	132070	236090	315310	0	0	0	0	0	277390	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	288090	0	0	0	0	0	0
A0A2U1M5X9	A0A2U1M5X9_ARTAN	"KH domain, STAR protein, homodimerization region"	CTI12_AA419050	Artemisia annua (Sweet wormwood)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	AGSQGDM	"tr|A0A2U1M5X9|A0A2U1M5X9_ARTAN KH domain, STAR protein, homodimerization region OS=Artemisia annua OX=35608 GN=CTI12_AA419050 PE=4 SV=1"	0.77661	1.378	0	9491.1	0	5229.6	4652.3	0	0	0	0	0	0	0	0	0	0	0	0	9491.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5229.6	0	0	0	0	0	0	0	4652.3	0	0
A0A2U1M6M1	A0A2U1M6M1_ARTAN	Homeodomain-like protein	CTI12_AA412000	Artemisia annua (Sweet wormwood)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]	DNA binding [GO:0003677]	PNSTTSA	tr|A0A2U1M6M1|A0A2U1M6M1_ARTAN Homeodomain-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA412000 PE=4 SV=1	0.77637	1.378	7209.5	5751	7086.4	0	4954.4	0	0	0	0	7209.5	0	0	0	0	0	0	0	0	0	0	0	5751	0	0	0	0	0	0	0	7086.4	0	0	0	0	0	0	0	0	0	0	0	0	0	3515.1	0	0	0	4954.4	0	0
A0A2U1M6Z0	A0A2U1M6Z0_ARTAN	"UvrD-like Helicase, ATP-binding domain, P-loop containing nucleoside triphosphate hydrolase"	CTI12_AA379140	Artemisia annua (Sweet wormwood)			ATP binding [GO:0005524]; helicase activity [GO:0004386]; hydrolase activity [GO:0016787]	ATP binding [GO:0005524]; helicase activity [GO:0004386]; hydrolase activity [GO:0016787]	EDGGCRR	"tr|A0A2U1M6Z0|A0A2U1M6Z0_ARTAN UvrD-like Helicase, ATP-binding domain, P-loop containing nucleoside triphosphate hydrolase OS=Artemisia annua OX=35608 GN=CTI12_AA379140 PE=4 SV=1"	0.86747	1.8173	5869.5	0	14384	0	43635	5683.5	5869.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1438.5	0	0	0	0	0	0	14384	0	0	0	0	0	0	0	0	0	0	0	0	43635	0	15138	0	0	0
A0A2U1M7G3	A0A2U1M7G3_ARTAN	Metal transporter NRAT1	CTI12_AA409000	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; metal ion transmembrane transporter activity [GO:0046873]	metal ion transmembrane transporter activity [GO:0046873]	DMNHDEK	tr|A0A2U1M7G3|A0A2U1M7G3_ARTAN Metal transporter NRAT1 OS=Artemisia annua OX=35608 GN=CTI12_AA409000 PE=3 SV=1	0.77624	1.378	0	0	0	11001	1860.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11001	0	0	0	0	0	0	0	0	0	0	0	0	0	1860.8
A0A2U1M8F0	A0A2U1M8F0_ARTAN	Beta-galactosidase (EC 3.2.1.23)	CTI12_AA203500	Artemisia annua (Sweet wormwood)	carbohydrate metabolic process [GO:0005975]		beta-galactosidase activity [GO:0004565]; carbohydrate binding [GO:0030246]; carbohydrate metabolic process [GO:0005975]	beta-galactosidase activity [GO:0004565]; carbohydrate binding [GO:0030246]	GFPVWLR	tr|A0A2U1M8F0|A0A2U1M8F0_ARTAN Beta-galactosidase OS=Artemisia annua OX=35608 GN=CTI12_AA203500 PE=3 SV=1	0.77434	1.378	9124.7	0	336530	0	144230	0	0	0	0	0	0	0	0	9124.7	0	0	0	0	0	0	0	0	0	0	105170	0	0	0	336530	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	144230
A0A2U1M926	A0A2U1M926_ARTAN	Patatin (EC 3.1.1.-)	CTI12_AA406230	Artemisia annua (Sweet wormwood)	lipid catabolic process [GO:0016042]	vacuole [GO:0005773]	vacuole [GO:0005773]; hydrolase activity [GO:0016787]; nutrient reservoir activity [GO:0045735]; transferase activity [GO:0016740]; lipid catabolic process [GO:0016042]	hydrolase activity [GO:0016787]; nutrient reservoir activity [GO:0045735]; transferase activity [GO:0016740]	RIFIGTK	tr|A0A2U1M926|A0A2U1M926_ARTAN Patatin OS=Artemisia annua OX=35608 GN=CTI12_AA406230 PE=3 SV=1;tr|A0A699HF47|A0A699HF47_TANCI Ribonuclease H-like domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_372211 PE=4 SV=1	0.88132	1.378	12033	0	0	0	0	0	0	0	0	0	0	0	0	12033	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MA50	A0A2U1MA50_ARTAN	RNA exonuclease 4	CTI12_AA401890	Artemisia annua (Sweet wormwood)	rRNA processing [GO:0006364]		3'-5' exonuclease activity [GO:0008408]; nucleic acid binding [GO:0003676]; transferase activity [GO:0016740]; rRNA processing [GO:0006364]	3'-5' exonuclease activity [GO:0008408]; nucleic acid binding [GO:0003676]; transferase activity [GO:0016740]	KAGPPAS	tr|A0A2U1MA50|A0A2U1MA50_ARTAN RNA exonuclease 4 OS=Artemisia annua OX=35608 GN=CTI12_AA401890 PE=3 SV=1;tr|A0A2U1MLF4|A0A2U1MLF4_ARTAN RNA exonuclease 4 OS=Artemisia annua OX=35608 GN=CTI12_AA366810 PE=3 SV=1;tr|A0A2U1MA46|A0A2U1MA46_ARTAN RNA exonuclease	0.78192	1.378	11844	11772	6788.6	6475.4	35614	0	0	0	0	0	11844	0	0	0	4828.2	0	0	0	0	11772	6970.9	0	0	0	0	6788.6	0	0	0	0	0	0	0	0	0	0	0	0	6475.4	0	0	9938.8	35614	0	5980.8	0	1066	2095.6	0	0
A0A2U1MAM3	A0A2U1MAM3_ARTAN	Helitron_like_N domain-containing protein	CTI12_AA399720	Artemisia annua (Sweet wormwood)					DPATIPAHNCYRNYCFR	tr|A0A2U1MAM3|A0A2U1MAM3_ARTAN Helitron_like_N domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA399720 PE=4 SV=1	0.94595	1.378	0	0	0	108140	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	108140	0	0	0	0	0	0	0	0	0	0
A0A2U1MBH6	A0A2U1MBH6_ARTAN	Uncharacterized protein	CTI12_AA385820	Artemisia annua (Sweet wormwood)					KVKLIFR	tr|A0A2U1MBH6|A0A2U1MBH6_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA385820 PE=4 SV=1	0.7807	1.378	0	0	15596	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15596	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MCP6	A0A2U1MCP6_ARTAN	Tubulin-specific chaperone A	CTI12_AA394390	Artemisia annua (Sweet wormwood)	post-chaperonin tubulin folding pathway [GO:0007023]; tubulin complex assembly [GO:0007021]	cytoplasm [GO:0005737]; microtubule [GO:0005874]	cytoplasm [GO:0005737]; microtubule [GO:0005874]; beta-tubulin binding [GO:0048487]; post-chaperonin tubulin folding pathway [GO:0007023]; tubulin complex assembly [GO:0007021]	beta-tubulin binding [GO:0048487]	EEYSSLK	tr|A0A2U1MCP6|A0A2U1MCP6_ARTAN Tubulin-specific chaperone A OS=Artemisia annua OX=35608 GN=CTI12_AA394390 PE=3 SV=1;tr|A0A2U1NHD3|A0A2U1NHD3_ARTAN Tubulin-specific chaperone A OS=Artemisia annua OX=35608 GN=CTI12_AA269310 PE=3 SV=1;tr|A0A6S7M192|A0A6S7M192	0.89375	1.378	0	55642	49066	5507.3	37127	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	55642	0	0	0	0	0	0	49066	0	0	0	0	5507.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37127
A0A2U1MD56	A0A2U1MD56_ARTAN	Protein kinase-like domain-containing protein	CTI12_AA348270	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	GLDYLYR	tr|A0A2U1MD56|A0A2U1MD56_ARTAN Protein kinase-like domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA348270 PE=3 SV=1	0.77936	1.378	0	11492	7598.2	11422	6379.4	0	0	0	0	0	0	0	0	0	0	7865.3	10025	0	0	11492	0	0	0	5939.4	0	0	0	0	7598.2	0	0	0	0	0	0	0	0	0	11422	0	0	0	0	0	0	0	6379.4	0	0	0
A0A2U1MD75	A0A2U1MD75_ARTAN	"Ribosomal protein S35, mitochondrial"	CTI12_AA411120	Artemisia annua (Sweet wormwood)		ribosome [GO:0005840]	ribosome [GO:0005840]		RKILHPK	"tr|A0A2U1MD75|A0A2U1MD75_ARTAN Ribosomal protein S35, mitochondrial OS=Artemisia annua OX=35608 GN=CTI12_AA411120 PE=4 SV=1;tr|A0A5N6NS96|A0A5N6NS96_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_17588 PE=4 SV=1;tr|A0A5N6LK16|A0A5N6L"	0.8784	1.378	0	17868	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17868	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MDC6	A0A2U1MDC6_ARTAN	RabGAP/TBC domain-containing protein	CTI12_AA393100	Artemisia annua (Sweet wormwood)					GTPSDER	tr|A0A2U1MDC6|A0A2U1MDC6_ARTAN RabGAP/TBC domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA393100 PE=4 SV=1;tr|A0A2U1MDC7|A0A2U1MDC7_ARTAN RabGAP/TBC domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA393100 PE=4 SV=1;tr|A0A2U	0.77924	1.378	0	0	0	51802	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	51802	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MDT8	A0A2U1MDT8_ARTAN	Peptide chain release factor eRF1/aRF1	CTI12_AA393800	Artemisia annua (Sweet wormwood)			translation release factor activity [GO:0003747]	translation release factor activity [GO:0003747]	VFFFEGR	tr|A0A2U1MDT8|A0A2U1MDT8_ARTAN Peptide chain release factor eRF1/aRF1 OS=Artemisia annua OX=35608 GN=CTI12_AA393800 PE=4 SV=1	0.77912	1.378	0	0	0	8821.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6110	0	0	0	8821.6	0	0	0	0	0	0	0	0	0
A0A2U1MDZ8	A0A2U1MDZ8_ARTAN	Chloramphenicol acetyltransferase-like domain-containing protein	CTI12_AA281610	Artemisia annua (Sweet wormwood)			"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	PSEETGK	tr|A0A2U1MDZ8|A0A2U1MDZ8_ARTAN Chloramphenicol acetyltransferase-like domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA281610 PE=3 SV=1	0.779	1.378	178070	0	0	0	0	0	0	178070	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MEE5	A0A2U1MEE5_ARTAN	Uncharacterized protein	CTI12_AA384830	Artemisia annua (Sweet wormwood)					MWSSRGR	tr|A0A2U1MEE5|A0A2U1MEE5_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA384830 PE=4 SV=1;tr|A0A2U1MEG8|A0A2U1MEG8_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA384830 PE=4 SV=1	0.77888	1.378	80795	0	0	0	0	0	0	0	0	80795	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MF00	A0A2U1MF00_ARTAN	"Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2"	CTI12_AA387810	Artemisia annua (Sweet wormwood)	protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]		thiol-dependent deubiquitinase [GO:0004843]; protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	thiol-dependent deubiquitinase [GO:0004843]	TACKRPR	"tr|A0A2U1MF00|A0A2U1MF00_ARTAN Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 OS=Artemisia annua OX=35608 GN=CTI12_AA387810 PE=3 SV=1"	0.94898	1.378	15531	9308.7	53079	46683	113680	5299.4	15531	7034.8	0	0	0	0	0	0	0	0	0	0	0	0	0	9308.7	0	53079	14629	0	0	0	24359	0	18088	7279.5	0	18896	0	46683	31497	0	0	0	0	0	0	113680	0	11291	12341	52469	0	52575
A0A2U1MG37	A0A2U1MG37_ARTAN	"Myb-like domain, Myb/SANT-like DNA-binding domain protein"	CTI12_AA384930	Artemisia annua (Sweet wormwood)			DNA binding [GO:0003677]	DNA binding [GO:0003677]	VDSGDAS	"tr|A0A2U1MG37|A0A2U1MG37_ARTAN Myb-like domain, Myb/SANT-like DNA-binding domain protein OS=Artemisia annua OX=35608 GN=CTI12_AA384930 PE=4 SV=1"	0.94771	1.378	8538.8	0	0	7761	19953	0	0	0	0	0	0	8538.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7761	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19953
A0A2U1MGY0	A0A2U1MGY0_ARTAN	Adenylate kinase (EC 2.7.4.3)	CTI12_AA381080	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; adenylate kinase activity [GO:0004017]; ATP binding [GO:0005524]; hydrolase activity [GO:0016787]	adenylate kinase activity [GO:0004017]; ATP binding [GO:0005524]; hydrolase activity [GO:0016787]	SNPLNRR	tr|A0A2U1MGY0|A0A2U1MGY0_ARTAN Adenylate kinase OS=Artemisia annua OX=35608 GN=CTI12_AA381080 PE=4 SV=1;tr|A0A2U1MH50|A0A2U1MH50_ARTAN Adenylate kinase OS=Artemisia annua OX=35608 GN=CTI12_AA381080 PE=4 SV=1;tr|A0A2U1MGZ4|A0A2U1MGZ4_ARTAN Adenylate kinase 	0.81388	1.378	18633	0	0	0	0	0	0	0	0	0	0	18633	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MHS0	A0A2U1MHS0_ARTAN	Uncharacterized protein	CTI12_AA376480	Artemisia annua (Sweet wormwood)					GPESFVK	tr|A0A2U1MHS0|A0A2U1MHS0_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA376480 PE=4 SV=1	0.76153	1.378	15419	0	0	0	46486	15419	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	46486	0	0	0	18233	0	0	0	0
A0A2U1MHX5	A0A2U1MHX5_ARTAN	"Chloride channel, core"	CTI12_AA377040	Artemisia annua (Sweet wormwood)	chloride transport [GO:0006821]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; voltage-gated chloride channel activity [GO:0005247]; chloride transport [GO:0006821]	voltage-gated chloride channel activity [GO:0005247]	SAAGILS	"tr|A0A2U1MHX5|A0A2U1MHX5_ARTAN Chloride channel, core OS=Artemisia annua OX=35608 GN=CTI12_AA377040 PE=4 SV=1"	0.76196	1.378	19876	0	0	0	0	0	0	0	19876	0	0	0	0	9183.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MKU8	A0A2U1MKU8_ARTAN	Transducin family protein / WD-40 repeat family protein	CTI12_AA182540	Artemisia annua (Sweet wormwood)	rRNA processing [GO:0006364]	small-subunit processome [GO:0032040]	small-subunit processome [GO:0032040]; rRNA processing [GO:0006364]		GFEYKKK	tr|A0A2U1MKU8|A0A2U1MKU8_ARTAN Transducin family protein / WD-40 repeat family protein OS=Artemisia annua OX=35608 GN=CTI12_AA182540 PE=4 SV=1;tr|A0A6S7LG97|A0A6S7LG97_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS7723 PE=4 SV=1;tr	0.80985	1.378	0	17211	8480.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17211	0	0	0	0	0	8480.4	0	0	0	0	0	0	8480.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MLY8	A0A2U1MLY8_ARTAN	NAD-dependent epimerase/dehydratase	CTI12_AA211750	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		NLLEDNK	tr|A0A2U1MLY8|A0A2U1MLY8_ARTAN NAD-dependent epimerase/dehydratase OS=Artemisia annua OX=35608 GN=CTI12_AA211750 PE=4 SV=1	0.77452	1.378	0	0	12550	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12550	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MPA7	A0A2U1MPA7_ARTAN	Uncharacterized protein	CTI12_AA194920	Artemisia annua (Sweet wormwood)					NDCNDEE	tr|A0A2U1MPA7|A0A2U1MPA7_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA194920 PE=4 SV=1	0.77149	1.378	0	22462	10840	11217	7694.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22462	0	0	0	8415.9	9604.7	0	0	0	9773.3	0	0	10840	0	0	0	0	0	0	0	10094	11217	0	0	0	0	0	7694.7	0	0	0
A0A2U1MPK4	A0A2U1MPK4_ARTAN	Cysteine proteinase COT44	CTI12_AA321520	Artemisia annua (Sweet wormwood)			cysteine-type peptidase activity [GO:0008234]	cysteine-type peptidase activity [GO:0008234]	MAMIIAR	tr|A0A2U1MPK4|A0A2U1MPK4_ARTAN Cysteine proteinase COT44 OS=Artemisia annua OX=35608 GN=CTI12_AA321520 PE=3 SV=1	0.77409	1.378	0	0	0	0	33701	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33701	0
A0A2U1MQ70	A0A2U1MQ70_ARTAN	Replication protein A 70 kDa DNA-binding subunit	CTI12_AA355340	Artemisia annua (Sweet wormwood)			DNA binding [GO:0003677]	DNA binding [GO:0003677]	VKYGLIK	tr|A0A2U1MQ70|A0A2U1MQ70_ARTAN Replication protein A 70 kDa DNA-binding subunit OS=Artemisia annua OX=35608 GN=CTI12_AA355340 PE=4 SV=1	0.77081	1.378	8655.2	0	0	0	0	0	0	8655.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MRH1	A0A2U1MRH1_ARTAN	DUF641 domain-containing protein	CTI12_AA349330	Artemisia annua (Sweet wormwood)	negative gravitropism [GO:0009959]; response to red or far red light [GO:0009639]		negative gravitropism [GO:0009959]; response to red or far red light [GO:0009639]		TYDITGK	tr|A0A2U1MRH1|A0A2U1MRH1_ARTAN DUF641 domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA349330 PE=4 SV=1	0.76735	1.378	0	16671	26447	21545	6667.2	0	0	0	0	0	0	0	0	0	0	16671	0	0	0	0	0	0	0	0	0	0	26447	0	0	0	0	0	0	0	0	0	0	21545	0	0	0	0	0	0	6667.2	0	0	0	0	0
A0A2U1MS87	A0A2U1MS87_ARTAN	Bulb-type lectin domain-containing protein	CTI12_AA348090	Artemisia annua (Sweet wormwood)			carbohydrate binding [GO:0030246]	carbohydrate binding [GO:0030246]	DGMGNRR	tr|A0A2U1MS87|A0A2U1MS87_ARTAN Bulb-type lectin domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA348090 PE=4 SV=1	0.8741	1.378	12384	0	0	0	0	0	0	0	0	0	0	12384	0	8915.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MSA3	A0A2U1MSA3_ARTAN	Myb/SANT-like domain-containing protein	CTI12_AA346870	Artemisia annua (Sweet wormwood)					GLGTEGK	"tr|A0A2U1MSA3|A0A2U1MSA3_ARTAN Myb/SANT-like domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA346870 PE=4 SV=1;tr|A0A699MU44|A0A699MU44_TANCI RNA-directed DNA polymerase, eukaryota OS=Tanacetum cinerariifolium OX=118510 GN=Tci_762910 PE=4 S"	0.78238	1.378	64281	23765	44369	44958	40528	7972.6	64281	43672	18401	0	0	0	0	8246.3	18150	23765	0	9172.9	0	0	0	0	10531	31714	44369	0	0	0	35525	0	33495	14710	0	6360.8	0	0	11115	0	0	29790	44958	0	0	12830	40528	11612	25230	10550	24508	0
A0A2U1MSC9	A0A2U1MSC9_ARTAN	"Heavy metal-associated domain, HMA"	CTI12_AA348660	Artemisia annua (Sweet wormwood)					MDMKDRK	"tr|A0A2U1MSC9|A0A2U1MSC9_ARTAN Heavy metal-associated domain, HMA OS=Artemisia annua OX=35608 GN=CTI12_AA348660 PE=4 SV=1"	0.76778	1.378	19603	29077	119520	87565	120730	19603	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29077	0	0	0	0	0	0	0	119520	0	0	0	0	0	0	43172	0	0	87565	0	0	0	20341	0	0	0	0	0	120730
A0A2U1MTA7	A0A2U1MTA7_ARTAN	Anthranilate N-benzoyltransferase protein	CTI12_AA341910	Artemisia annua (Sweet wormwood)			"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	CESNHLR	tr|A0A2U1MTA7|A0A2U1MTA7_ARTAN Anthranilate N-benzoyltransferase protein OS=Artemisia annua OX=35608 GN=CTI12_AA341910 PE=3 SV=1	0.78423	1.378	0	0	5326.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2848.5	0	0	0	0	5326.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MUH0	A0A2U1MUH0_ARTAN	Glycosyltransferases (EC 2.4.-.-)	CTI12_AA339760	Artemisia annua (Sweet wormwood)	cell wall organization [GO:0071555]	Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity [GO:0015018]; cell wall organization [GO:0071555]	galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity [GO:0015018]	KKTQLWK	tr|A0A2U1MUH0|A0A2U1MUH0_ARTAN Glycosyltransferases OS=Artemisia annua OX=35608 GN=CTI12_AA339760 PE=3 SV=1;tr|A0A2U1KVY1|A0A2U1KVY1_ARTAN Glycosyltransferases OS=Artemisia annua OX=35608 GN=CTI12_AA558980 PE=3 SV=1	0.83811	1.378	0	0	17420	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17420	0	0	0	0	0	13212	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MX15	A0A2U1MX15_ARTAN	Putative RNA polymerase II transcription factor B subunit 1-1	CTI12_AA333220	Artemisia annua (Sweet wormwood)					LHQQFVK	"tr|A0A2U1MX15|A0A2U1MX15_ARTAN Putative RNA polymerase II transcription factor B subunit 1-1 OS=Artemisia annua OX=35608 GN=CTI12_AA333220 PE=4 SV=1;tr|A0A2U1P2Z8|A0A2U1P2Z8_ARTAN Transposase, Ptta/En/Spm OS=Artemisia annua OX=35608 GN=CTI12_AA196100 PE=4 "	0.80477	1.378	12213	5406.9	0	0	0	0	0	0	0	0	0	12213	0	0	0	0	0	5406.9	0	0	0	4385.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MX43	A0A2U1MX43_ARTAN	Uncharacterized protein	CTI12_AA335370	Artemisia annua (Sweet wormwood)					KSQKASA	tr|A0A2U1MX43|A0A2U1MX43_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA335370 PE=4 SV=1	0.87132	1.378	0	0	0	25477	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25477	0	0	0	0	0	0	0	0	0	0
A0A2U1MX79	A0A2U1MX79_ARTAN	"Triose phosphate/phosphate translocator, chloroplastic"	CTI12_AA335390	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SDQFIKR	"tr|A0A2U1MX79|A0A2U1MX79_ARTAN Triose phosphate/phosphate translocator, chloroplastic OS=Artemisia annua OX=35608 GN=CTI12_AA335390 PE=4 SV=1"	0.80467	1.378	8350.2	31975	9932.7	12647	13257	0	8350.2	0	0	0	0	0	0	0	31975	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9932.7	0	0	12647	0	0	0	0	0	0	0	0	0	0	0	13257	0	8254.7	0	0
A0A2U1MXA5	A0A2U1MXA5_ARTAN	Transducin/WD40 repeat-like superfamily protein	CTI12_AA332570	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		KTKLLSR	tr|A0A2U1MXA5|A0A2U1MXA5_ARTAN Transducin/WD40 repeat-like superfamily protein OS=Artemisia annua OX=35608 GN=CTI12_AA332570 PE=4 SV=1	0.80813	1.378	0	0	8574.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4056.4	0	0	8574.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MXG2	A0A2U1MXG2_ARTAN	Alpha/beta-Hydrolases superfamily protein	CTI12_AA312570	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; hydrolase activity [GO:0016787]	hydrolase activity [GO:0016787]	MMYYSAR	tr|A0A2U1MXG2|A0A2U1MXG2_ARTAN Alpha/beta-Hydrolases superfamily protein OS=Artemisia annua OX=35608 GN=CTI12_AA312570 PE=4 SV=1	0.86813	1.378	0	76615	0	48339	47273	0	0	0	0	0	0	0	0	0	0	0	0	0	76615	0	0	0	0	0	0	0	0	0	0	0	0	0	0	48339	0	0	0	0	0	0	0	0	0	0	0	47273	0	0	0	0
A0A2U1MYP6	A0A2U1MYP6_ARTAN	"Tetratricopeptide-like helical domain, Protein SirB1"	CTI12_AA326660	Artemisia annua (Sweet wormwood)					SSVVDSK	"tr|A0A2U1MYP6|A0A2U1MYP6_ARTAN Tetratricopeptide-like helical domain, Protein SirB1 OS=Artemisia annua OX=35608 GN=CTI12_AA326660 PE=4 SV=1"	0.80185	1.378	33506	88604	58308	57228	105250	0	0	33506	0	0	0	0	0	0	0	0	62429	88604	0	0	23932	0	0	32681	0	0	58308	0	34592	38079	0	0	0	0	0	0	57228	0	0	0	0	0	105250	94357	0	9536.5	34592	0	0	0
A0A2U1MZ69	A0A2U1MZ69_ARTAN	Uncharacterized protein	CTI12_AA324850	Artemisia annua (Sweet wormwood)					NPQRLSA	tr|A0A2U1MZ69|A0A2U1MZ69_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA324850 PE=4 SV=1	0.80174	1.378	0	89191	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	89191	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MZW2	A0A2U1MZW2_ARTAN	NSP (Nuclear shuttle protein)-interacting GTPase	CTI12_AA317330	Artemisia annua (Sweet wormwood)			GTPase activator activity [GO:0005096]	GTPase activator activity [GO:0005096]	SDDGGSK	tr|A0A2U1MZW2|A0A2U1MZW2_ARTAN NSP (Nuclear shuttle protein)-interacting GTPase OS=Artemisia annua OX=35608 GN=CTI12_AA317330 PE=4 SV=1;tr|A0A2U1MZR3|A0A2U1MZR3_ARTAN NSP (Nuclear shuttle protein)-interacting GTPase OS=Artemisia annua OX=35608 GN=CTI12_AA3	0.80217	1.378	0	0	8431.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7483.3	8431.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1MZY4	A0A2U1MZY4_ARTAN	LOV domain-containing protein	CTI12_AA322960	Artemisia annua (Sweet wormwood)					SSEAYTIDLMDESPKWR	tr|A0A2U1MZY4|A0A2U1MZY4_ARTAN LOV domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA322960 PE=4 SV=1;tr|A0A2U1PS53|A0A2U1PS53_ARTAN LOV domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA083250 PE=3 SV=1;tr|A0A699H8U8|A0A699H8	0.86545	1.378	0	0	0	16339	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16339	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1N007	A0A2U1N007_ARTAN	Voltage-dependent anion channel	CTI12_AA324040	Artemisia annua (Sweet wormwood)	cellular ion homeostasis [GO:0006873]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; voltage-gated anion channel activity [GO:0008308]; cellular ion homeostasis [GO:0006873]	voltage-gated anion channel activity [GO:0008308]	TKKVAFK	tr|A0A2U1N007|A0A2U1N007_ARTAN Voltage-dependent anion channel OS=Artemisia annua OX=35608 GN=CTI12_AA324040 PE=3 SV=1;tr|A0A2U1QDL3|A0A2U1QDL3_ARTAN Voltage-dependent anion channel OS=Artemisia annua OX=35608 GN=CTI12_AA039060 PE=3 SV=1;tr|A0A699V6P4|A0A6	0.80207	1.378	13973	22375	8397.1	17280	12349	6987.3	8361.8	0	0	0	0	0	13973	0	12379	0	0	22375	0	0	0	0	0	8397.1	0	0	0	0	0	0	0	0	0	0	0	17280	0	9740.5	0	0	0	0	0	0	0	12349	0	10851	0	0
A0A2U1N0M2	A0A2U1N0M2_ARTAN	Uncharacterized protein	CTI12_AA321170	Artemisia annua (Sweet wormwood)					GHGGVGK	tr|A0A2U1N0M2|A0A2U1N0M2_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA321170 PE=4 SV=1	0.80823	1.378	0	0	0	9562.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9562.6	0	0	0	0	0	0	0	0	0	0
A0A2U1N0N4	A0A2U1N0N4_ARTAN	Ribonuclease H-like domain-containing protein	CTI12_AA321740	Artemisia annua (Sweet wormwood)					VRVLPAR	tr|A0A2U1N0N4|A0A2U1N0N4_ARTAN Ribonuclease H-like domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA321740 PE=4 SV=1	0.8078	1.378	21209	23024	13648	19452	21957	0	0	21209	0	0	12453	0	0	0	0	13313	0	0	0	23024	0	0	0	0	0	0	13648	0	0	0	0	0	0	0	7459.5	0	19452	0	0	0	0	15852	21957	0	13873	0	0	0	0	0
A0A2U1N1K1	A0A2U1N1K1_ARTAN	Uncharacterized protein	CTI12_AA305150	Artemisia annua (Sweet wormwood)			"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	PLLALVK	tr|A0A2U1N1K1|A0A2U1N1K1_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA305150 PE=3 SV=1;tr|A0A103XL99|A0A103XL99_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_005171 PE=3 SV=1	0.9446	1.378	3595.3	0	5026.4	0	1289.3	0	0	0	3595.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5026.4	0	0	0	0	0	0	0	0	0	0	0	0	0	1289.3	0	0	0	0	0	0
A0A2U1N284	A0A2U1N284_ARTAN	Soluble N-ethylmaleimide-sensitive factor adaptor protein 30	CTI12_AA314910	Artemisia annua (Sweet wormwood)	protein transport [GO:0015031]		protein transport [GO:0015031]		KPHFPHK	tr|A0A2U1N284|A0A2U1N284_ARTAN Soluble N-ethylmaleimide-sensitive factor adaptor protein 30 OS=Artemisia annua OX=35608 GN=CTI12_AA314910 PE=4 SV=1	0.8097	1.378	0	0	0	13614	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13614	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1N2B3	A0A2U1N2B3_ARTAN	Elongation factor 1-alpha	CTI12_AA316290	Artemisia annua (Sweet wormwood)			translation elongation factor activity [GO:0003746]	translation elongation factor activity [GO:0003746]	LLTVSLK	tr|A0A2U1N2B3|A0A2U1N2B3_ARTAN Elongation factor 1-alpha OS=Artemisia annua OX=35608 GN=CTI12_AA316290 PE=4 SV=1;tr|A0A2U1P0Z7|A0A2U1P0Z7_ARTAN Elongation factor 1-alpha OS=Artemisia annua OX=35608 GN=CTI12_AA113760 PE=4 SV=1	0.81014	1.378	0	3388.7	0	0	0	0	0	0	0	0	0	0	0	0	0	3388.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1N2I7	A0A2U1N2I7_ARTAN	Zinc knuckle CX2CX4HX4C	CTI12_AA315370	Artemisia annua (Sweet wormwood)					TTHGSQK	tr|A0A2U1N2I7|A0A2U1N2I7_ARTAN Zinc knuckle CX2CX4HX4C OS=Artemisia annua OX=35608 GN=CTI12_AA315370 PE=4 SV=1	0.81058	1.378	4098.7	0	0	0	0	0	0	0	0	4098.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1N328	A0A2U1N328_ARTAN	Uncharacterized protein	CTI12_AA282800	Artemisia annua (Sweet wormwood)	translation [GO:0006412]	ribosome [GO:0005840]	ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	MPPTTSR	tr|A0A2U1N328|A0A2U1N328_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA282800 PE=4 SV=1	0.80994	1.378	0	0	0	0	323240	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	323240	0	0
A0A2U1N333	A0A2U1N333_ARTAN	"Glycosyl transferase, family 10"	CTI12_AA313720	Artemisia annua (Sweet wormwood)	protein glycosylation [GO:0006486]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; fucosyltransferase activity [GO:0008417]; protein glycosylation [GO:0006486]	fucosyltransferase activity [GO:0008417]	GFGMAKI	"tr|A0A2U1N333|A0A2U1N333_ARTAN Glycosyl transferase, family 10 OS=Artemisia annua OX=35608 GN=CTI12_AA313720 PE=3 SV=1"	0.81037	1.378	0	26875	0	30456	60406	0	0	0	0	0	0	0	0	0	0	26875	0	0	0	0	0	0	24292	0	0	0	0	0	0	0	0	0	0	0	0	0	24367	28508	0	30456	0	60406	57774	0	0	0	0	0	0	0
A0A2U1N367	A0A2U1N367_ARTAN	Uncharacterized protein	CTI12_AA313400	Artemisia annua (Sweet wormwood)					SYRRGLR	tr|A0A2U1N367|A0A2U1N367_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA313400 PE=4 SV=1	0.87365	1.378	4412.8	0	5218.9	0	0	0	0	0	0	0	0	4412.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5218.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1N443	A0A2U1N443_ARTAN	5'-nucleotidase domain-containing protein 4	CTI12_AA309370	Artemisia annua (Sweet wormwood)			hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]	hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]	ARPVSCR	tr|A0A2U1N443|A0A2U1N443_ARTAN 5-nucleotidase domain-containing protein 4 OS=Artemisia annua OX=35608 GN=CTI12_AA309370 PE=3 SV=1	0.80973	1.378	0	0	6742.1	11433	5034.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4878.8	0	6742.1	0	0	0	0	0	0	0	0	0	0	7366.2	0	0	11433	0	0	0	0	5034.8	0	0	0	0	0
A0A2U1N497	A0A2U1N497_ARTAN	"F-box domain, Leucine-rich repeat domain, L domain-like protein"	CTI12_AA308100	Artemisia annua (Sweet wormwood)					MDSYKKK	"tr|A0A2U1N497|A0A2U1N497_ARTAN F-box domain, Leucine-rich repeat domain, L domain-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA308100 PE=4 SV=1"	0.80963	1.378	0	7196.4	7149.8	11657	8741.7	0	0	0	0	0	0	0	0	0	7196.4	0	0	0	0	0	0	0	0	7149.8	0	0	0	0	0	0	0	0	0	0	0	0	9369.3	0	0	11657	0	0	0	0	5162.7	0	8741.7	0	0	0
A0A2U1N4I9	A0A2U1N4I9_ARTAN	RT_RNaseH_2 domain-containing protein	CTI12_AA305600	Artemisia annua (Sweet wormwood)					VLFRAKR	tr|A0A2U1N4I9|A0A2U1N4I9_ARTAN RT_RNaseH_2 domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA305600 PE=4 SV=1	0.80898	1.378	0	13856	13899	10247	0	0	0	0	0	0	0	0	0	0	0	10040	0	0	0	13856	0	0	0	0	0	13167	0	0	13899	0	0	0	0	0	0	0	10247	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1N5Y7	A0A2U1N5Y7_ARTAN	Putative E3 ubiquitin-protein ligase RHC2A	CTI12_AA295610	Artemisia annua (Sweet wormwood)					GGGGSSA	tr|A0A2U1N5Y7|A0A2U1N5Y7_ARTAN Putative E3 ubiquitin-protein ligase RHC2A OS=Artemisia annua OX=35608 GN=CTI12_AA295610 PE=4 SV=1;tr|A0A2U1L4L8|A0A2U1L4L8_ARTAN Putative E3 ubiquitin-protein ligase RHC2A OS=Artemisia annua OX=35608 GN=CTI12_AA531470 PE=4 S	0.81686	1.378	0	0	0	0	3814.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3814.7
A0A2U1N708	A0A2U1N708_ARTAN	"Protein TOC75-3, chloroplastic"	CTI12_AA181710	Artemisia annua (Sweet wormwood)		plastid outer membrane [GO:0009527]	plastid outer membrane [GO:0009527]		MMSEHDK	"tr|A0A2U1N708|A0A2U1N708_ARTAN Protein TOC75-3, chloroplastic OS=Artemisia annua OX=35608 GN=CTI12_AA181710 PE=4 SV=1"	0.80185	1.378	208850	377080	185840	208280	193960	0	0	0	0	208850	0	0	0	0	0	208830	0	248090	0	0	171980	0	377080	0	0	0	0	0	185840	0	0	177410	0	0	129410	173760	0	135530	208280	154590	0	0	193960	0	0	103110	128400	0	0	0
A0A2U1N729	A0A2U1N729_ARTAN	"Glycoside hydrolase, family 79"	CTI12_AA296310	Artemisia annua (Sweet wormwood)			hydrolase activity [GO:0016787]	hydrolase activity [GO:0016787]	YYAGILR	"tr|A0A2U1N729|A0A2U1N729_ARTAN Glycoside hydrolase, family 79 OS=Artemisia annua OX=35608 GN=CTI12_AA296310 PE=4 SV=1"	0.79192	1.378	0	0	27267	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27267	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1N8F2	A0A2U1N8F2_ARTAN	"F-box domain, Leucine-rich repeat domain, L domain-like protein"	CTI12_AA294420	Artemisia annua (Sweet wormwood)					DRFGHRR	"tr|A0A2U1N8F2|A0A2U1N8F2_ARTAN F-box domain, Leucine-rich repeat domain, L domain-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA294420 PE=4 SV=1;tr|A0A2U1N8F4|A0A2U1N8F4_ARTAN F-box domain, Leucine-rich repeat domain, L domain-like protein OS=Artemis"	0.78962	1.378	0	29877	0	34988	18714	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29877	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23008	26344	0	0	34988	0	0	0	18714	0	18419	0	0	0
A0A2U1N8K4	A0A2U1N8K4_ARTAN	RmlC-like jelly roll fold protein	CTI12_AA294920	Artemisia annua (Sweet wormwood)					GDMEEGR	tr|A0A2U1N8K4|A0A2U1N8K4_ARTAN RmlC-like jelly roll fold protein OS=Artemisia annua OX=35608 GN=CTI12_AA294920 PE=4 SV=1	0.7895	1.378	0	0	0	18822	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18822	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1N8V2	A0A2U1N8V2_ARTAN	TRICHOME BIREFRINGENCE-LIKE 5	CTI12_AA226820	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VDDDYMK	tr|A0A2U1N8V2|A0A2U1N8V2_ARTAN TRICHOME BIREFRINGENCE-LIKE 5 OS=Artemisia annua OX=35608 GN=CTI12_AA226820 PE=3 SV=1	0.79203	1.378	8213.3	15216	0	0	0	0	0	8213.3	0	0	0	0	0	0	0	15216	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NAU1	A0A2U1NAU1_ARTAN	Nucleotide-binding alpha-beta plait domain-containing protein	CTI12_AA284690	Artemisia annua (Sweet wormwood)					FGFFTFR	"tr|A0A2U1NAU1|A0A2U1NAU1_ARTAN Nucleotide-binding alpha-beta plait domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA284690 PE=4 SV=1;tr|A0A2U1KY30|A0A2U1KY30_ARTAN RNA-directed DNA polymerase, eukaryota OS=Artemisia annua OX=35608 GN=CTI12_"	0.83768	1.378	301120	42130	0	0	99601	0	0	0	0	0	0	301120	0	0	0	0	0	0	42130	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	99601	0	0	0	0	0	0	0
A0A2U1NAU6	A0A2U1NAU6_ARTAN	RWP-RK domain-containing protein	CTI12_AA287180	Artemisia annua (Sweet wormwood)					IGCLQHK	tr|A0A2U1NAU6|A0A2U1NAU6_ARTAN RWP-RK domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA287180 PE=4 SV=1	0.78611	1.378	0	26556	14255	13016	11594	0	0	0	0	0	0	0	0	0	13545	0	12644	0	0	26556	22598	0	0	8745.8	0	9659.6	0	0	13378	0	0	14255	0	0	0	0	12405	13016	0	0	0	0	0	0	0	6835.7	11594	0	0	0
A0A2U1NB67	A0A2U1NB67_ARTAN	Acyl-[acyl-carrier-protein] hydrolase (EC 3.1.2.-)	CTI12_AA283230	Artemisia annua (Sweet wormwood)	fatty acid biosynthetic process [GO:0006633]	chloroplast [GO:0009507]	chloroplast [GO:0009507]; thiolester hydrolase activity [GO:0016790]; fatty acid biosynthetic process [GO:0006633]	thiolester hydrolase activity [GO:0016790]	VQMVVDR	tr|A0A2U1NB67|A0A2U1NB67_ARTAN Acyl-[acyl-carrier-protein] hydrolase OS=Artemisia annua OX=35608 GN=CTI12_AA283230 PE=3 SV=1	0.78599	1.378	0	0	0	15441	13611	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15441	0	0	0	0	0	0	13611	11577	0	0	0	0	0	0	0
A0A2U1NBJ0	A0A2U1NBJ0_ARTAN	Uncharacterized protein	CTI12_AA282930	Artemisia annua (Sweet wormwood)			protein heterodimerization activity [GO:0046982]	protein heterodimerization activity [GO:0046982]	VLSDSYK	tr|A0A2U1NBJ0|A0A2U1NBJ0_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA282930 PE=4 SV=1	0.8609	1.378	0	14114	8631	10436	11718	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14114	0	0	0	0	0	8631	0	0	0	0	0	0	0	0	0	0	0	7082.2	10191	10436	0	0	11718	0	8205.2	0	8139	0	0	0
A0A2U1NBU0	A0A2U1NBU0_ARTAN	Uncharacterized protein	CTI12_AA289790	Artemisia annua (Sweet wormwood)					NMMYMFR	tr|A0A2U1NBU0|A0A2U1NBU0_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA289790 PE=4 SV=1	0.9403	1.378	0	32138	0	19661	21438	0	0	0	0	0	0	0	0	0	0	11401	0	0	0	32138	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19661	0	0	21438	0	0	0	0	0	0	0	0
A0A2U1NC90	A0A2U1NC90_ARTAN	C3H1-type domain-containing protein	CTI12_AA265120	Artemisia annua (Sweet wormwood)			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	PPLKVLK	tr|A0A2U1NC90|A0A2U1NC90_ARTAN C3H1-type domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA265120 PE=4 SV=1	0.85768	1.378	0	7155	4399.3	0	10259	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7155	0	0	0	0	0	0	0	0	4399.3	0	0	0	0	0	0	0	0	0	0	0	0	0	10259	0	0	1476	0
A0A2U1NCM1	A0A2U1NCM1_ARTAN	"Peptidase C48, SUMO/Sentrin/Ubl1"	CTI12_AA282480	Artemisia annua (Sweet wormwood)			cysteine-type peptidase activity [GO:0008234]	cysteine-type peptidase activity [GO:0008234]	PDDGGDR	"tr|A0A2U1NCM1|A0A2U1NCM1_ARTAN Peptidase C48, SUMO/Sentrin/Ubl1 OS=Artemisia annua OX=35608 GN=CTI12_AA282480 PE=3 SV=1;tr|A0A2U1NCI2|A0A2U1NCI2_ARTAN Peptidase C48, SUMO/Sentrin/Ubl1 OS=Artemisia annua OX=35608 GN=CTI12_AA282480 PE=3 SV=1"	0.89571	1.378	17664	0	14620	16070	0	0	0	0	0	0	0	17664	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14620	13266	0	16070	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NDA1	A0A2U1NDA1_ARTAN	"Homeodomain-like, DEK"	CTI12_AA280270	Artemisia annua (Sweet wormwood)	chromatin organization [GO:0006325]		DNA binding [GO:0003677]; chromatin organization [GO:0006325]	DNA binding [GO:0003677]	PMCLSGE	"tr|A0A2U1NDA1|A0A2U1NDA1_ARTAN Homeodomain-like, DEK OS=Artemisia annua OX=35608 GN=CTI12_AA280270 PE=4 SV=1"	0.8012	1.378	0	39764	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	39764	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NDA2	A0A2U1NDA2_ARTAN	Cation/H+ exchanger	CTI12_AA150430	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; solute:proton antiporter activity [GO:0015299]	solute:proton antiporter activity [GO:0015299]	PKLLIRR	tr|A0A2U1NDA2|A0A2U1NDA2_ARTAN Cation/H+ exchanger OS=Artemisia annua OX=35608 GN=CTI12_AA150430 PE=4 SV=1	0.92969	1.378	0	37850	0	5820.4	6011.4	0	0	0	0	0	0	0	0	0	0	0	0	37850	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5820.4	0	0	0	0	0	6011.4	0	0	0	0
A0A2U1NDB1	A0A2U1NDB1_ARTAN	"Polymerase, nucleotidyl transferase domain-containing protein"	CTI12_AA282540	Artemisia annua (Sweet wormwood)			transferase activity [GO:0016740]	transferase activity [GO:0016740]	DNDDDAI	"tr|A0A2U1NDB1|A0A2U1NDB1_ARTAN Polymerase, nucleotidyl transferase domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA282540 PE=4 SV=1"	0.80163	1.378	0	0	37569	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37569	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NDL8	A0A2U1NDL8_ARTAN	5-formyltetrahydrofolate cyclo-ligase	CTI12_AA279320	Artemisia annua (Sweet wormwood)			ligase activity [GO:0016874]	ligase activity [GO:0016874]	SMDPALR	tr|A0A2U1NDL8|A0A2U1NDL8_ARTAN 5-formyltetrahydrofolate cyclo-ligase OS=Artemisia annua OX=35608 GN=CTI12_AA279320 PE=4 SV=1;tr|A0A2J6L4B0|A0A2J6L4B0_LACSA 5-formyltetrahydrofolate cyclo-ligase OS=Lactuca sativa OX=4236 GN=LSAT_1X11380 PE=3 SV=1;tr|A0A2U1N	0.89616	1.378	0	0	0	365260	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	365260	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NDN0	A0A2U1NDN0_ARTAN	TMV resistance protein N	CTI12_AA284160	Artemisia annua (Sweet wormwood)	signal transduction [GO:0007165]		ADP binding [GO:0043531]; hydrolase activity [GO:0016787]; signal transduction [GO:0007165]	ADP binding [GO:0043531]; hydrolase activity [GO:0016787]	DDMGDFFCAIDLFLNQR	tr|A0A2U1NDN0|A0A2U1NDN0_ARTAN TMV resistance protein N OS=Artemisia annua OX=35608 GN=CTI12_AA284160 PE=4 SV=1	0.94118	1.378	0	9313.4	0	65704	26252	0	0	0	0	0	0	0	0	0	0	0	0	9313.4	7301.8	0	0	0	0	0	0	0	0	0	0	0	0	0	24317	65704	0	0	0	0	0	0	0	0	0	7966.7	0	0	0	0	26252	0
A0A2U1NDU9	A0A2U1NDU9_ARTAN	Glutamate synthase	CTI12_AA276300	Artemisia annua (Sweet wormwood)					NMDPKRK	tr|A0A2U1NDU9|A0A2U1NDU9_ARTAN Glutamate synthase OS=Artemisia annua OX=35608 GN=CTI12_AA276300 PE=4 SV=1;tr|A0A103YDH4|A0A103YDH4_CYNCS Glutamate synthase (NADH) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_014544 PE=3 SV=1;tr|A0A2U1PKW7|A0A2U1PKW	0.85965	1.378	70218	26294	18189	12016	43515	0	70218	0	10835	0	0	0	0	0	0	0	0	0	0	0	0	0	26294	18189	0	0	0	0	0	0	0	0	0	0	0	12016	8671.1	0	0	0	0	0	0	0	0	0	0	0	0	43515
A0A2U1NF73	A0A2U1NF73_ARTAN	Ubiquitin-conjugating enzyme family protein	CTI12_AA275300	Artemisia annua (Sweet wormwood)					CGEVCLR	tr|A0A2U1NF73|A0A2U1NF73_ARTAN Ubiquitin-conjugating enzyme family protein OS=Artemisia annua OX=35608 GN=CTI12_AA275300 PE=4 SV=1	0.79607	1.378	13675	16033	15411	12651	7656.6	13675	10687	0	0	0	0	0	9627.4	0	14145	6886.7	0	0	0	0	0	16033	13315	0	8668.9	0	0	0	0	0	0	15411	0	0	0	10860	0	0	0	0	12651	0	0	0	0	7656.6	0	0	0	0
A0A2U1NF91	A0A2U1NF91_ARTAN	Cysteine-rich RLK (RECEPTOR-like protein kinase) 25	CTI12_AA266480	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	EGCPNQK	tr|A0A2U1NF91|A0A2U1NF91_ARTAN Cysteine-rich RLK (RECEPTOR-like protein kinase) 25 OS=Artemisia annua OX=35608 GN=CTI12_AA266480 PE=4 SV=1	0.79651	1.378	0	0	0	9455.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9455.1	0	0	0	0	0	0	0	0	0
A0A2U1NFV5	A0A2U1NFV5_ARTAN	"Phospholipase-like, Aminotransferase-like mobile domain protein"	CTI12_AA271170	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transaminase activity [GO:0008483]	transaminase activity [GO:0008483]	VLKEEEK	"tr|A0A2U1NFV5|A0A2U1NFV5_ARTAN Phospholipase-like, Aminotransferase-like mobile domain protein OS=Artemisia annua OX=35608 GN=CTI12_AA271170 PE=4 SV=1;tr|A0A2U1M231|A0A2U1M231_ARTAN Phospholipase-like, Aminotransferase-like mobile domain protein OS=Artemis"	0.8449	1.378	131420	76686	320130	99930	41822	28192	0	131420	24321	0	0	0	31158	0	0	0	0	0	25712	0	0	0	76686	59177	0	0	0	0	0	320130	0	0	85812	99930	0	0	0	0	0	0	0	0	0	41822	0	0	0	0	0	0
A0A2U1NH20	A0A2U1NH20_ARTAN	"Putative, Caspase-like domain protein"	CTI12_AA266570	Artemisia annua (Sweet wormwood)					CQPTTAM	"tr|A0A2U1NH20|A0A2U1NH20_ARTAN Putative, Caspase-like domain protein OS=Artemisia annua OX=35608 GN=CTI12_AA266570 PE=4 SV=1"	0.90476	1.378	4112.5	13880	0	14083	1765	0	0	4112.5	0	0	0	0	2109.2	0	0	13880	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14083	0	0	0	0	1765	0	0	0	0	0
A0A2U1NIU5	A0A2U1NIU5_ARTAN	Nuclear transport factor 2	CTI12_AA124280	Artemisia annua (Sweet wormwood)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	FGNVKHR	tr|A0A2U1NIU5|A0A2U1NIU5_ARTAN Nuclear transport factor 2 OS=Artemisia annua OX=35608 GN=CTI12_AA124280 PE=4 SV=1	0.79258	1.378	9668.5	13082	5317.9	8297.8	0	0	4765.2	0	0	9668.5	0	0	0	7430.8	0	0	0	0	13082	0	0	0	0	0	0	0	0	0	0	0	5317.9	0	0	0	0	8297.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NJB4	A0A2U1NJB4_ARTAN	"PPM-type phosphatase domain, Protein phosphatase 2C family"	CTI12_AA257280	Artemisia annua (Sweet wormwood)					NNNPSTK	"tr|A0A2U1NJB4|A0A2U1NJB4_ARTAN PPM-type phosphatase domain, Protein phosphatase 2C family OS=Artemisia annua OX=35608 GN=CTI12_AA257280 PE=4 SV=1"	0.79201	1.378	0	0	12189	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12189	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NJL0	A0A2U1NJL0_ARTAN	Uncharacterized protein	CTI12_AA259660	Artemisia annua (Sweet wormwood)					CGCCGEK	tr|A0A2U1NJL0|A0A2U1NJL0_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA259660 PE=4 SV=1	0.9	1.378	0	0	0	52876	30530	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	52876	0	0	0	0	0	30530	0	0	0	0	0	13203	0
A0A2U1NJU2	A0A2U1NJU2_ARTAN	"Mitogen-activated protein (MAP) kinase kinase kinase Ste11, Cryptococcus"	CTI12_AA167740	Artemisia annua (Sweet wormwood)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	NGSHSDS	"tr|A0A2U1NJU2|A0A2U1NJU2_ARTAN Mitogen-activated protein (MAP) kinase kinase kinase Ste11, Cryptococcus OS=Artemisia annua OX=35608 GN=CTI12_AA167740 PE=4 SV=1;tr|A0A2U1MM64|A0A2U1MM64_ARTAN Oxygen-dependent choline dehydrogenase, FAD/NAD(P)-binding domain"	0.77384	1.378	0	7679.5	0	4347.4	6313.7	0	0	0	0	0	0	0	0	0	0	0	0	7679.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4347.4	0	0	0	0	0	0	0	0	0	0	0	6313.7	0	0
A0A2U1NJW8	A0A2U1NJW8_ARTAN	Uncharacterized protein	CTI12_AA167690	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; aminopeptidase activity [GO:0004177]; metallopeptidase activity [GO:0008237]; zinc ion binding [GO:0008270]	aminopeptidase activity [GO:0004177]; metallopeptidase activity [GO:0008237]; zinc ion binding [GO:0008270]	TACWDIK	tr|A0A2U1NJW8|A0A2U1NJW8_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA167690 PE=3 SV=1	0.79238	1.378	310900	314400	274170	252460	213160	0	310900	245900	0	0	264160	0	0	0	314400	0	0	0	0	0	0	0	0	274170	0	16635	0	0	37708	0	0	40846	0	252460	0	12146	0	0	7183.4	0	20795	0	0	0	0	213160	0	0	0	0
A0A2U1NK91	A0A2U1NK91_ARTAN	"Transposase, mutator type"	CTI12_AA237940	Artemisia annua (Sweet wormwood)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	KKVIVLG	"tr|A0A2U1NK91|A0A2U1NK91_ARTAN Transposase, mutator type OS=Artemisia annua OX=35608 GN=CTI12_AA237940 PE=4 SV=1;tr|A0A2U1PNU7|A0A2U1PNU7_ARTAN Transposase, mutator type OS=Artemisia annua OX=35608 GN=CTI12_AA128280 PE=4 SV=1;tr|A0A2U1MCV7|A0A2U1MCV7_ARTAN"	0.77894	1.378	0	0	34266	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34266	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NKY5	A0A2U1NKY5_ARTAN	Uncharacterized protein	CTI12_AA252840	Artemisia annua (Sweet wormwood)					SSAYMPR	tr|A0A2U1NKY5|A0A2U1NKY5_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA252840 PE=4 SV=1	0.86857	1.378	58028	0	0	0	17057	0	0	58028	0	0	0	0	41390	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17057
A0A2U1NM37	A0A2U1NM37_ARTAN	Protein FAR1-RELATED SEQUENCE	CTI12_AA251170	Artemisia annua (Sweet wormwood)	"regulation of transcription, DNA-templated [GO:0006355]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; zinc ion binding [GO:0008270]; regulation of transcription, DNA-templated [GO:0006355]"	zinc ion binding [GO:0008270]	FMVGCQK	tr|A0A2U1NM37|A0A2U1NM37_ARTAN Protein FAR1-RELATED SEQUENCE OS=Artemisia annua OX=35608 GN=CTI12_AA251170 PE=3 SV=1	0.79033	1.378	0	0	0	0	15983	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15983	0	0	0	0	0
A0A2U1NMC9	A0A2U1NMC9_ARTAN	Uncharacterized protein	CTI12_AA249350	Artemisia annua (Sweet wormwood)	regulation of exit from mitosis [GO:0007096]	nucleus [GO:0005634]	nucleus [GO:0005634]; regulation of exit from mitosis [GO:0007096]		KTKILPK	tr|A0A2U1NMC9|A0A2U1NMC9_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA249350 PE=4 SV=1	0.78977	1.378	2309.6	0	0	0	0	0	0	0	0	2309.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NMD7	A0A2U1NMD7_ARTAN	Uncharacterized protein	CTI12_AA250280	Artemisia annua (Sweet wormwood)					IGAEGSK	tr|A0A2U1NMD7|A0A2U1NMD7_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA250280 PE=4 SV=1;tr|A0A2U1NMH7|A0A2U1NMH7_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA250280 PE=4 SV=1	0.875	1.378	44933	45268	0	31328	32921	0	0	0	41519	44933	0	0	0	34102	0	0	0	0	45268	0	0	0	34773	0	0	0	0	0	0	0	0	0	0	0	0	31328	0	0	0	0	0	0	0	0	0	19268	32921	0	0	0
A0A2U1NMZ9	A0A2U1NMZ9_ARTAN	"Transferase, Chloramphenicol acetyltransferase-like domain protein"	CTI12_AA225770	Artemisia annua (Sweet wormwood)			"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	EVVPESR	"tr|A0A2U1NMZ9|A0A2U1NMZ9_ARTAN Transferase, Chloramphenicol acetyltransferase-like domain protein OS=Artemisia annua OX=35608 GN=CTI12_AA225770 PE=3 SV=1"	0.92553	1.5858	0	0	0	0	17405	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14310	17405	0	0	0	0	0	0
A0A2U1NNW0	A0A2U1NNW0_ARTAN	"F-box domain, FBD domain, Leucine-rich repeat domain, L domain-like protein"	CTI12_AA126090	Artemisia annua (Sweet wormwood)					QIVLPPR	"tr|A0A2U1NNW0|A0A2U1NNW0_ARTAN F-box domain, FBD domain, Leucine-rich repeat domain, L domain-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA126090 PE=4 SV=1"	0.79089	1.378	5310.5	0	3033.6	13764	5533.4	0	0	0	0	0	0	0	5310.5	0	0	0	0	0	0	0	0	0	0	3033.6	0	0	0	0	2654.2	0	0	0	0	0	0	0	13764	0	0	0	0	0	0	0	0	0	0	0	5533.4	0
A0A2U1NPJ0	A0A2U1NPJ0_ARTAN	Phospholipase-like protein	CTI12_AA242780	Artemisia annua (Sweet wormwood)					VFPGKIK	tr|A0A2U1NPJ0|A0A2U1NPJ0_ARTAN Phospholipase-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA242780 PE=4 SV=1	0.80019	1.378	0	0	0	0	18248	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18248	0	0	0	0	0	0	0
A0A2U1NPV8	A0A2U1NPV8_ARTAN	Protein kinase-like domain-containing protein	CTI12_AA240950	Artemisia annua (Sweet wormwood)			ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	TTSSSGK	tr|A0A2U1NPV8|A0A2U1NPV8_ARTAN Protein kinase-like domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA240950 PE=3 SV=1;tr|A0A2U1L5G7|A0A2U1L5G7_ARTAN Protein kinase-like domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA526060 	0.81716	1.378	0	0	0	8435.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8435.9	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NQ66	A0A2U1NQ66_ARTAN	Uncharacterized protein	CTI12_AA241340	Artemisia annua (Sweet wormwood)					EELFVVR	tr|A0A2U1NQ66|A0A2U1NQ66_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA241340 PE=4 SV=1;tr|A0A2U1NQ27|A0A2U1NQ27_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA241340 PE=4 SV=1	0.79778	1.378	0	0	7162.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7162.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NQ99	A0A2U1NQ99_ARTAN	SANT associated	CTI12_AA066930	Artemisia annua (Sweet wormwood)					ECSITRR	tr|A0A2U1NQ99|A0A2U1NQ99_ARTAN SANT associated OS=Artemisia annua OX=35608 GN=CTI12_AA066930 PE=4 SV=1	0.79769	1.378	0	24620	27625	31450	19677	0	0	0	0	0	0	0	0	0	0	0	0	24620	0	0	0	19973	0	16705	0	0	0	0	0	27625	14990	0	0	0	0	31450	0	0	0	0	0	0	0	12271	18138	0	19661	19677	0	0
A0A2U1NQA2	A0A2U1NQA2_ARTAN	Tudor/PWWP/MBT superfamily protein	CTI12_AA234590	Artemisia annua (Sweet wormwood)					PTPAPPR	tr|A0A2U1NQA2|A0A2U1NQA2_ARTAN Tudor/PWWP/MBT superfamily protein OS=Artemisia annua OX=35608 GN=CTI12_AA234590 PE=4 SV=1	0.79805	1.378	8051.5	0	0	0	0	0	0	0	0	8051.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NQN0	A0A2U1NQN0_ARTAN	Ribosomal_L12 domain-containing protein	CTI12_AA239900	Artemisia annua (Sweet wormwood)	translation [GO:0006412]	ribosome [GO:0005840]	ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	VPVVVKK	tr|A0A2U1NQN0|A0A2U1NQN0_ARTAN Ribosomal_L12 domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA239900 PE=3 SV=1;tr|A0A6S7NBT0|A0A6S7NBT0_LACSI Ribosomal_L12 domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS22447 PE=3 SV=1;t	0.93372	1.378	4956.8	0	0	0	0	0	4405.8	0	0	4956.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NQW5	A0A2U1NQW5_ARTAN	"Leucine-rich repeat domain, L domain-like protein"	CTI12_AA219050	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		HGGPIVK	"tr|A0A2U1NQW5|A0A2U1NQW5_ARTAN Leucine-rich repeat domain, L domain-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA219050 PE=3 SV=1"	0.7975	1.378	0	0	8742.2	0	6240.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8742.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6240.1	0	0	0	0	0	0	0	0
A0A2U1NSK5	A0A2U1NSK5_ARTAN	Uncharacterized protein	CTI12_AA232940	Artemisia annua (Sweet wormwood)					NESDTQR	tr|A0A2U1NSK5|A0A2U1NSK5_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA232940 PE=4 SV=1	0.7974	1.378	0	0	32567	0	24974	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32567	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24974	0	0	0	0	0	0	0	0
A0A2U1NTD0	A0A2U1NTD0_ARTAN	"Bromodomain, Auxin response factor, Coatomer alpha subunit"	CTI12_AA231930	Artemisia annua (Sweet wormwood)					SSQCPAR	"tr|A0A2U1NTD0|A0A2U1NTD0_ARTAN Bromodomain, Auxin response factor, Coatomer alpha subunit OS=Artemisia annua OX=35608 GN=CTI12_AA231930 PE=4 SV=1"	0.79499	1.378	645410	72576	126510	107370	361940	0	0	645410	0	0	46303	0	0	0	34713	0	55682	72576	0	48748	69730	0	0	0	29694	71841	80845	126510	75746	0	0	0	0	0	107370	77138	68695	0	0	0	0	59457	0	23563	71835	86019	60139	71212	361940	0
A0A2U1NTM9	A0A2U1NTM9_ARTAN	Uncharacterized protein	CTI12_AA231020	Artemisia annua (Sweet wormwood)					SITVEEN	tr|A0A2U1NTM9|A0A2U1NTM9_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA231020 PE=4 SV=1	0.78911	1.378	0	0	0	0	213280	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	213280	0	0	0
A0A2U1NU10	A0A2U1NU10_ARTAN	Zinc finger BED domain-containing protein RICESLEEPER 2	CTI12_AA227300	Artemisia annua (Sweet wormwood)			DNA binding [GO:0003677]; protein dimerization activity [GO:0046983]	DNA binding [GO:0003677]; protein dimerization activity [GO:0046983]	YDGDGLK	tr|A0A2U1NU10|A0A2U1NU10_ARTAN Zinc finger BED domain-containing protein RICESLEEPER 2 OS=Artemisia annua OX=35608 GN=CTI12_AA227300 PE=4 SV=1	0.79982	1.378	0	0	52490	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	52490	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NU79	A0A2U1NU79_ARTAN	"Nucleic acid-binding, OB-fold protein"	CTI12_AA225820	Artemisia annua (Sweet wormwood)	DNA repair [GO:0006281]; DNA replication [GO:0006260]		DNA binding [GO:0003677]; DNA repair [GO:0006281]; DNA replication [GO:0006260]	DNA binding [GO:0003677]	GELLIVK	"tr|A0A2U1NU79|A0A2U1NU79_ARTAN Nucleic acid-binding, OB-fold protein OS=Artemisia annua OX=35608 GN=CTI12_AA225820 PE=4 SV=1"	0.42857	2.756	21646	33220	24471	0	17178	0	19941	0	0	0	0	0	21646	0	0	0	33220	0	0	0	0	0	0	0	0	0	0	0	0	0	24471	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17178	0
A0A2U1NVC9	A0A2U1NVC9_ARTAN	FAD-binding Berberine family protein	CTI12_AA223280	Artemisia annua (Sweet wormwood)			FAD binding [GO:0071949]; oxidoreductase activity [GO:0016491]	FAD binding [GO:0071949]; oxidoreductase activity [GO:0016491]	WLQVANK	tr|A0A2U1NVC9|A0A2U1NVC9_ARTAN FAD-binding Berberine family protein OS=Artemisia annua OX=35608 GN=CTI12_AA223280 PE=3 SV=1;tr|A0A5N6MZZ0|A0A5N6MZZ0_9ASTR FAD-binding PCMH-type domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_28610 PE=3 SV	0.78214	1.378	76817	0	0	0	0	0	0	0	0	0	0	76817	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NVJ7	A0A2U1NVJ7_ARTAN	Clathrin adaptor complexes medium subunit family protein	CTI12_AA223690	Artemisia annua (Sweet wormwood)					SIFHMHK	tr|A0A2U1NVJ7|A0A2U1NVJ7_ARTAN Clathrin adaptor complexes medium subunit family protein OS=Artemisia annua OX=35608 GN=CTI12_AA223690 PE=4 SV=1	0.78204	1.378	0	0	0	0	7481.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7481.5	0	0	0
A0A2U1NVN7	A0A2U1NVN7_ARTAN	Cytochrome P450	CTI12_AA223100	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	"integral component of membrane [GO:0016021]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	RCKNLAK	tr|A0A2U1NVN7|A0A2U1NVN7_ARTAN Cytochrome P450 OS=Artemisia annua OX=35608 GN=CTI12_AA223100 PE=3 SV=1	0.78194	1.378	0	0	0	0	17080	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17080	0	0	0
A0A2U1NWZ4	A0A2U1NWZ4_ARTAN	Mannitol dehydrogenase	CTI12_AA102090	Artemisia annua (Sweet wormwood)					WPRLLVR	tr|A0A2U1NWZ4|A0A2U1NWZ4_ARTAN Mannitol dehydrogenase OS=Artemisia annua OX=35608 GN=CTI12_AA102090 PE=4 SV=1	0.7808	1.378	0	5556.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5556.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NXA6	A0A2U1NXA6_ARTAN	"Peptidase C48, SUMO/Sentrin/Ubl1"	CTI12_AA218280	Artemisia annua (Sweet wormwood)					ETEEMVNAR	"tr|A0A2U1NXA6|A0A2U1NXA6_ARTAN Peptidase C48, SUMO/Sentrin/Ubl1 OS=Artemisia annua OX=35608 GN=CTI12_AA218280 PE=4 SV=1"	0.86111	1.409	10044	0	7915.8	0	12200	0	10044	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7915.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12200	0
A0A2U1NXJ1	A0A2U1NXJ1_ARTAN	Uncharacterized protein	CTI12_AA218260	Artemisia annua (Sweet wormwood)					HGTWIWK	tr|A0A2U1NXJ1|A0A2U1NXJ1_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA218260 PE=4 SV=1;tr|A0A118K545|A0A118K545_CYNCS Uncharacterized protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_013111 PE=4 SV=1;tr|A0A6L2	0.91145	1.378	10012	0	0	0	8927.5	0	0	0	7530.3	9497.4	0	10012	0	8406	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8927.5
A0A2U1NXT2	A0A2U1NXT2_ARTAN	Uncharacterized protein	CTI12_AA177380	Artemisia annua (Sweet wormwood)		EMC complex [GO:0072546]	EMC complex [GO:0072546]		CTHTGKK	tr|A0A2U1NXT2|A0A2U1NXT2_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA177380 PE=4 SV=1	0.78022	1.378	0	0	0	11505	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11505	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NY03	A0A2U1NY03_ARTAN	Uncharacterized protein	CTI12_AA215480	Artemisia annua (Sweet wormwood)					GSSEGER	tr|A0A2U1NY03|A0A2U1NY03_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA215480 PE=4 SV=1	0.92258	1.378	0	0	0	15171	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15171	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NYQ3	A0A2U1NYQ3_ARTAN	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein	CTI12_AA214770	Artemisia annua (Sweet wormwood)			metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]	metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]	SSMSHFR	tr|A0A2U1NYQ3|A0A2U1NYQ3_ARTAN 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein OS=Artemisia annua OX=35608 GN=CTI12_AA214770 PE=3 SV=1;tr|A0A2U1M6C8|A0A2U1M6C8_ARTAN 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily pr	0.77649	1.378	0	0	25110	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25110	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1NZN9	A0A2U1NZN9_ARTAN	SANT/Myb domain-containing protein	CTI12_AA209920	Artemisia annua (Sweet wormwood)		nucleus [GO:0005634]	nucleus [GO:0005634]		HNNYIYH	tr|A0A2U1NZN9|A0A2U1NZN9_ARTAN SANT/Myb domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA209920 PE=4 SV=1	0.77731	1.378	5903.6	0	6188.8	0	0	0	0	0	0	0	5903.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6188.8	4437.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1P1B5	A0A2U1P1B5_ARTAN	Ypt/Rab-GAP domain of gyp1p superfamily protein	CTI12_AA205540	Artemisia annua (Sweet wormwood)			zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	SDCDDGR	tr|A0A2U1P1B5|A0A2U1P1B5_ARTAN Ypt/Rab-GAP domain of gyp1p superfamily protein OS=Artemisia annua OX=35608 GN=CTI12_AA205540 PE=4 SV=1	0.78271	1.378	0	0	0	8750.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8750.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1P1H5	A0A2U1P1H5_ARTAN	Terpene_synth_C domain-containing protein	CTI12_AA205080	Artemisia annua (Sweet wormwood)			magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333]	magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333]	QAIDSEF	tr|A0A2U1P1H5|A0A2U1P1H5_ARTAN Terpene_synth_C domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA205080 PE=4 SV=1	0.78808	1.378	0	30555	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30555	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1P1X6	A0A2U1P1X6_ARTAN	Uncharacterized protein	CTI12_AA203050	Artemisia annua (Sweet wormwood)					MMVDCNR	tr|A0A2U1P1X6|A0A2U1P1X6_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA203050 PE=4 SV=1	0.78705	1.378	0	15206	25589	14276	13394	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15206	0	0	8668.9	0	0	25589	0	0	0	0	0	0	0	14276	0	0	0	0	11971	0	13394	0	0	0	0	0	0	0	0
A0A2U1P2C5	A0A2U1P2C5_ARTAN	"Myosin heavy chain, non-muscle"	CTI12_AA201840	Artemisia annua (Sweet wormwood)					LLLMHAK	"tr|A0A2U1P2C5|A0A2U1P2C5_ARTAN Myosin heavy chain, non-muscle OS=Artemisia annua OX=35608 GN=CTI12_AA201840 PE=4 SV=1"	0.78648	1.378	0	0	0	19170	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19170	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1P2X8	A0A2U1P2X8_ARTAN	Uncharacterized protein	CTI12_AA199110	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VVRIRIR	tr|A0A2U1P2X8|A0A2U1P2X8_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA199110 PE=4 SV=1;tr|A0A2U1LB39|A0A2U1LB39_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA511110 PE=4 SV=1	0.88554	1.378	0	23264	44404	49829	46761	0	0	0	0	0	0	0	0	0	0	0	20087	0	0	0	23264	0	0	0	0	0	0	44404	43311	0	0	0	0	0	0	0	32106	10878	49829	30848	0	46604	36548	0	0	0	46761	0	0	0
A0A2U1P486	A0A2U1P486_ARTAN	Uncharacterized protein	CTI12_AA194830	Artemisia annua (Sweet wormwood)	cortical microtubule organization [GO:0043622]		cortical microtubule organization [GO:0043622]		RLCPPSK	tr|A0A2U1P486|A0A2U1P486_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA194830 PE=3 SV=1	0.78591	1.378	15648	21982	16197	13045	65644	0	0	13239	0	0	0	0	15648	0	19571	0	21982	18905	0	0	0	0	0	13424	16197	0	0	0	0	0	15419	0	0	0	0	0	13045	0	0	0	0	0	0	0	65644	0	38634	13957	0	0
A0A2U1P5S9	A0A2U1P5S9_ARTAN	BEACH domain-containing protein	CTI12_AA189910	Artemisia annua (Sweet wormwood)					HVILVII	tr|A0A2U1P5S9|A0A2U1P5S9_ARTAN BEACH domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA189910 PE=4 SV=1	0.78301	1.378	79739	137250	119880	103890	110950	0	13577	0	0	5257.6	79739	0	0	12582	78950	99950	123250	90851	23051	137250	104100	20697	123030	0	76051	94606	100220	96850	119880	4923	82462	111610	11733	0	0	99380	97238	88800	100970	103890	87688	105200	110950	78287	68430	0	78357	0	0	91783
A0A2U1P5U7	A0A2U1P5U7_ARTAN	NAC domain-containing protein	CTI12_AA188900	Artemisia annua (Sweet wormwood)	"regulation of transcription, DNA-templated [GO:0006355]"		"DNA binding [GO:0003677]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]	PRMAGNK	tr|A0A2U1P5U7|A0A2U1P5U7_ARTAN NAC domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA188900 PE=4 SV=1	0.78338	1.378	0	0	0	0	27088	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27088	0	0	0	0	0
A0A2U1P6D4	A0A2U1P6D4_ARTAN	Reverse transcriptase domain-containing protein	CTI12_AA188340	Artemisia annua (Sweet wormwood)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	MRMEFEHLFNDVCLSQR	tr|A0A2U1P6D4|A0A2U1P6D4_ARTAN Reverse transcriptase domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA188340 PE=4 SV=1	0.93377	1.378	68848	225000	59114	0	0	0	0	68848	0	0	0	0	0	0	0	0	0	0	0	0	0	0	225000	0	0	0	0	0	0	0	59114	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1P6H0	A0A2U1P6H0_ARTAN	Transcription initiation factor TFIID subunit 8	CTI12_AA186860	Artemisia annua (Sweet wormwood)		transcription factor TFIID complex [GO:0005669]	transcription factor TFIID complex [GO:0005669]; protein heterodimerization activity [GO:0046982]	protein heterodimerization activity [GO:0046982]	LNFNHGR	tr|A0A2U1P6H0|A0A2U1P6H0_ARTAN Transcription initiation factor TFIID subunit 8 OS=Artemisia annua OX=35608 GN=CTI12_AA186860 PE=3 SV=1	0.78281	1.378	0	17605	13346	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17605	0	0	0	0	0	0	13346	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1P7C2	A0A2U1P7C2_ARTAN	"Metalloenzyme, LuxS/M16 peptidase-like protein"	CTI12_AA181040	Artemisia annua (Sweet wormwood)			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	PPPLKLK	"tr|A0A2U1P7C2|A0A2U1P7C2_ARTAN Metalloenzyme, LuxS/M16 peptidase-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA181040 PE=4 SV=1"	0.79954	1.378	43051	82393	74736	62131	69165	0	0	0	0	0	43051	0	0	0	0	16732	14203	0	0	82393	8273.6	0	0	18806	0	62283	74736	27039	31635	0	0	0	0	0	62131	0	0	42543	12792	12529	15596	0	69165	0	0	0	36194	0	0	0
A0A2U1P7K4	A0A2U1P7K4_ARTAN	RRM domain-containing protein	CTI12_AA183920	Artemisia annua (Sweet wormwood)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	FESPLPK	tr|A0A2U1P7K4|A0A2U1P7K4_ARTAN RRM domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA183920 PE=4 SV=1	0.80948	1.378	27682	17930	12492	9631.9	6820.6	0	27682	25996	0	0	0	0	0	18085	0	0	0	17930	0	0	0	0	0	0	12492	0	0	0	0	0	0	0	0	9631.9	0	0	0	0	0	0	0	0	0	0	0	6820.6	0	0	0	0
A0A2U1P9E6	A0A2U1P9E6_ARTAN	Prolyl-tRNA synthetase (EC 6.1.1.15)	CTI12_AA104520	Artemisia annua (Sweet wormwood)	prolyl-tRNA aminoacylation [GO:0006433]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; proline-tRNA ligase activity [GO:0004827]; prolyl-tRNA aminoacylation [GO:0006433]	ATP binding [GO:0005524]; proline-tRNA ligase activity [GO:0004827]	TQDSDDK	tr|A0A2U1P9E6|A0A2U1P9E6_ARTAN Prolyl-tRNA synthetase OS=Artemisia annua OX=35608 GN=CTI12_AA104520 PE=4 SV=1;tr|A0A6L2JHJ5|A0A6L2JHJ5_TANCI Prolyl-tRNA synthetase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_008364 PE=4 SV=1;tr|A0A2U1P9C8|A0A2U1P9C8_ARTA	0.77137	1.378	14844	16421	41201	0	4942.1	0	0	14844	0	0	0	0	0	0	0	0	16421	0	0	0	0	0	0	0	0	9235.5	0	41201	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4942.1	0	0	0	0	0	0
A0A2U1P9V0	A0A2U1P9V0_ARTAN	Switch 2	CTI12_AA051270	Artemisia annua (Sweet wormwood)			ATP binding [GO:0005524]; nucleosome-dependent ATPase activity [GO:0070615]	ATP binding [GO:0005524]; nucleosome-dependent ATPase activity [GO:0070615]	QVECCNR	tr|A0A2U1P9V0|A0A2U1P9V0_ARTAN Switch 2 OS=Artemisia annua OX=35608 GN=CTI12_AA051270 PE=4 SV=1;tr|A0A164ZHJ8|A0A164ZHJ8_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_019177 PE=4 SV=1;tr|A0A2U1P9S4|A0A2U1P9S4_ARTAN Switch 2	0.89024	1.378	0	13845	16084	17410	25679	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13845	0	0	0	0	0	0	16084	0	0	0	0	0	0	16054	0	0	0	17410	0	0	0	25679	0	0	0	0	0	0	0
A0A2U1PA36	A0A2U1PA36_ARTAN	Armadillo repeat-containing protein 3 and Serine/threonine-protein kinase CTR1	CTI12_AA176490	Artemisia annua (Sweet wormwood)			kinase activity [GO:0016301]	kinase activity [GO:0016301]	IQIFVFD	tr|A0A2U1PA36|A0A2U1PA36_ARTAN Armadillo repeat-containing protein 3 and Serine/threonine-protein kinase CTR1 OS=Artemisia annua OX=35608 GN=CTI12_AA176490 PE=4 SV=1	0.80666	1.378	0	0	0	8516.3	8029.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8516.3	0	0	0	0	0	0	0	0	0	8029.7	0	0	0	0
A0A2U1PA59	A0A2U1PA59_ARTAN	DUF4283 domain-containing protein	CTI12_AA176400	Artemisia annua (Sweet wormwood)					SMNQQWK	tr|A0A2U1PA59|A0A2U1PA59_ARTAN DUF4283 domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA176400 PE=4 SV=1	0.80957	1.378	0	0	15196	9535.4	11559	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15196	7723.9	0	0	0	0	0	0	6305.3	0	0	0	0	8491.6	9535.4	0	11559	0	0	0	0	0	0	0
A0A2U1PAG3	A0A2U1PAG3_ARTAN	Uncharacterized protein	CTI12_AA111470	Artemisia annua (Sweet wormwood)					WCGGGGK	tr|A0A2U1PAG3|A0A2U1PAG3_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA111470 PE=4 SV=1	0.80611	1.378	25121	19636	0	0	0	0	0	0	0	0	0	25121	0	0	0	0	0	0	19636	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PBI2	A0A2U1PBI2_ARTAN	Pantoate--beta-alanine ligase (EC 6.3.2.1) (Pantoate-activating enzyme) (Pantothenate synthetase)	CTI12_AA171430	Artemisia annua (Sweet wormwood)	pantothenate biosynthetic process [GO:0015940]		ATP binding [GO:0005524]; pantoate-beta-alanine ligase activity [GO:0004592]; pantothenate biosynthetic process [GO:0015940]	ATP binding [GO:0005524]; pantoate-beta-alanine ligase activity [GO:0004592]	PLIIKTK	tr|A0A2U1PBI2|A0A2U1PBI2_ARTAN Pantoate--beta-alanine ligase OS=Artemisia annua OX=35608 GN=CTI12_AA171430 PE=3 SV=1	0.80602	1.378	14913	0	4622.2	0	2971.9	14913	0	9791.5	0	0	0	0	11140	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4622.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2971.9	0
A0A2U1PC10	A0A2U1PC10_ARTAN	Hexokinase (EC 2.7.1.1)	CTI12_AA168520	Artemisia annua (Sweet wormwood)	cellular glucose homeostasis [GO:0001678]; glycolytic process [GO:0006096]; hexose metabolic process [GO:0019318]		ATP binding [GO:0005524]; glucose binding [GO:0005536]; hexokinase activity [GO:0004396]; cellular glucose homeostasis [GO:0001678]; glycolytic process [GO:0006096]; hexose metabolic process [GO:0019318]	ATP binding [GO:0005524]; glucose binding [GO:0005536]; hexokinase activity [GO:0004396]	QVHIYFR	tr|A0A2U1PC10|A0A2U1PC10_ARTAN Hexokinase OS=Artemisia annua OX=35608 GN=CTI12_AA168520 PE=3 SV=1	0.80457	1.378	0	0	22086	0	11893	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22086	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11893	0	0	0	0	0	0	0	0
A0A2U1PDN5	A0A2U1PDN5_ARTAN	Leucine-rich repeat transmembrane protein kinase protein	CTI12_AA164590	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	MFRELKR	tr|A0A2U1PDN5|A0A2U1PDN5_ARTAN Leucine-rich repeat transmembrane protein kinase protein OS=Artemisia annua OX=35608 GN=CTI12_AA164590 PE=4 SV=1	0.85714	1.8079	0	0	0	0	14754	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14754	0	0	0	0	0
A0A2U1PDQ4	A0A2U1PDQ4_ARTAN	"RNA-directed DNA polymerase, eukaryota, Reverse transcriptase zinc-binding domain protein"	CTI12_AA158600	Artemisia annua (Sweet wormwood)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	SSECSRK	"tr|A0A2U1PDQ4|A0A2U1PDQ4_ARTAN RNA-directed DNA polymerase, eukaryota, Reverse transcriptase zinc-binding domain protein OS=Artemisia annua OX=35608 GN=CTI12_AA158600 PE=4 SV=1"	0.81224	1.378	0	60614	16034	0	0	0	0	0	0	0	0	0	0	0	0	0	0	60614	0	0	0	0	0	0	10440	0	0	0	0	16034	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PEP4	A0A2U1PEP4_ARTAN	Helitron helicase-like domain-containing protein	CTI12_AA161250	Artemisia annua (Sweet wormwood)			helicase activity [GO:0004386]	helicase activity [GO:0004386]	PECPKRK	tr|A0A2U1PEP4|A0A2U1PEP4_ARTAN Helitron helicase-like domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA161250 PE=4 SV=1	0.9375	1.378	0	0	0	0	7021.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6392.8	7021.3
A0A2U1PET8	A0A2U1PET8_ARTAN	SIN-like family protein	CTI12_AA161290	Artemisia annua (Sweet wormwood)	"transcription, DNA-templated [GO:0006351]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; transcription, DNA-templated [GO:0006351]"		PLPKQPK	tr|A0A2U1PET8|A0A2U1PET8_ARTAN SIN-like family protein OS=Artemisia annua OX=35608 GN=CTI12_AA161290 PE=4 SV=1	0.81026	1.378	9270.9	9718.1	5310.5	11239	0	0	0	0	0	0	0	0	9270.9	0	0	9718.1	0	0	0	0	0	0	0	5310.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11239	0	0	0	0	0	0	0	0	0	0
A0A2U1PEX4	A0A2U1PEX4_ARTAN	"Polyphenol oxidase, central domain-containing protein"	CTI12_AA132940	Artemisia annua (Sweet wormwood)	pigment biosynthetic process [GO:0046148]		catechol oxidase activity [GO:0004097]; metal ion binding [GO:0046872]; pigment biosynthetic process [GO:0046148]	catechol oxidase activity [GO:0004097]; metal ion binding [GO:0046872]	IQLIPIE	"tr|A0A2U1PEX4|A0A2U1PEX4_ARTAN Polyphenol oxidase, central domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA132940 PE=3 SV=1"	0.81017	1.378	7541.4	5498.1	11062	16834	7737.4	7541.4	0	0	0	0	0	0	7041	0	0	0	5498.1	0	0	0	0	0	0	0	0	0	0	0	3846.4	0	0	11062	0	0	0	0	0	0	16834	0	0	0	0	0	0	0	7737.4	0	5350.2	0
A0A2U1PEY7	A0A2U1PEY7_ARTAN	Reverse transcriptase	CTI12_AA156720	Artemisia annua (Sweet wormwood)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	DEQECYR	tr|A0A2U1PEY7|A0A2U1PEY7_ARTAN Reverse transcriptase OS=Artemisia annua OX=35608 GN=CTI12_AA156720 PE=4 SV=1	0.81054	1.378	0	10961	0	9342.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10961	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9342.3	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PEZ3	A0A2U1PEZ3_ARTAN	F-box associated interaction domain-containing protein	CTI12_AA160800	Artemisia annua (Sweet wormwood)					KLLFVKR	tr|A0A2U1PEZ3|A0A2U1PEZ3_ARTAN F-box associated interaction domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA160800 PE=4 SV=1	0.81091	1.378	5007.9	0	0	0	0	0	5007.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PF73	A0A2U1PF73_ARTAN	Protein phosphatase 2C	CTI12_AA159770	Artemisia annua (Sweet wormwood)			phosphatase activity [GO:0016791]	phosphatase activity [GO:0016791]	HAHNLPK	tr|A0A2U1PF73|A0A2U1PF73_ARTAN Protein phosphatase 2C OS=Artemisia annua OX=35608 GN=CTI12_AA159770 PE=4 SV=1	0.81082	1.378	0	0	0	5963.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2108.5	0	5963.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PFA2	A0A2U1PFA2_ARTAN	EEIG1/EHBP1 N-terminal domain-containing protein	CTI12_AA158870	Artemisia annua (Sweet wormwood)					DEEKWGVAFYDDGFENR	tr|A0A2U1PFA2|A0A2U1PFA2_ARTAN EEIG1/EHBP1 N-terminal domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA158870 PE=4 SV=1;tr|A0A2U1PFA3|A0A2U1PFA3_ARTAN EEIG1/EHBP1 N-terminal domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA1	0.94366	1.378	0	0	0	175100	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	175100	0	0	0	0	0	0	0	0	0	0
A0A2U1PFZ1	A0A2U1PFZ1_ARTAN	14-3-3 domain-containing protein	CTI12_AA157050	Artemisia annua (Sweet wormwood)					SGADDEE	tr|A0A2U1PFZ1|A0A2U1PFZ1_ARTAN 14-3-3 domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA157050 PE=3 SV=1	0.81074	1.378	0	10995	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10995	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PG53	A0A2U1PG53_ARTAN	DNA-binding pseudobarrel domain-containing protein	CTI12_AA157220	Artemisia annua (Sweet wormwood)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]	DNA binding [GO:0003677]	PLPPAAK	tr|A0A2U1PG53|A0A2U1PG53_ARTAN DNA-binding pseudobarrel domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA157220 PE=4 SV=1;tr|A0A2U1KY08|A0A2U1KY08_ARTAN B3 domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA552340 PE=4 SV=1	0.83723	1.378	0	3343.2	3776.1	6227.1	8021.5	0	0	0	0	0	0	0	0	0	0	3343.2	0	0	0	0	0	0	0	1489.1	0	3776.1	0	0	0	0	0	0	0	0	0	0	0	6227.1	5177.4	0	0	0	8021.5	0	0	0	0	0	0	0
A0A2U1PG61	A0A2U1PG61_ARTAN	Uncharacterized protein	CTI12_AA083510	Artemisia annua (Sweet wormwood)		ribosome [GO:0005840]	ribosome [GO:0005840]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	RNA-DNA hybrid ribonuclease activity [GO:0004523]	SKFFQSR	tr|A0A2U1PG61|A0A2U1PG61_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA083510 PE=3 SV=1;tr|A0A2U1NNQ2|A0A2U1NNQ2_ARTAN Ribonuclease OS=Artemisia annua OX=35608 GN=CTI12_AA245350 PE=3 SV=1	0.78874	1.378	14085	21544	24947	19189	16312	0	0	0	0	0	0	0	14085	0	0	21544	0	0	0	0	0	0	0	0	19805	0	0	0	19802	0	0	24947	0	0	0	0	0	0	0	0	19189	0	0	0	0	4280.6	0	0	16312	0
A0A2U1PGK1	A0A2U1PGK1_ARTAN	Terpene cyclase/mutase family member (EC 5.4.99.-)	CTI12_AA156260	Artemisia annua (Sweet wormwood)	triterpenoid biosynthetic process [GO:0016104]	lipid droplet [GO:0005811]	lipid droplet [GO:0005811]; beta-amyrin synthase activity [GO:0042300]; lanosterol synthase activity [GO:0000250]; triterpenoid biosynthetic process [GO:0016104]	beta-amyrin synthase activity [GO:0042300]; lanosterol synthase activity [GO:0000250]	MFDGPPK	tr|A0A2U1PGK1|A0A2U1PGK1_ARTAN Terpene cyclase/mutase family member OS=Artemisia annua OX=35608 GN=CTI12_AA156260 PE=3 SV=1	0.85165	1.378	0	0	0	0	82347	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	82347
A0A2U1PHD9	A0A2U1PHD9_ARTAN	Ricin B lectin domain-containing protein	CTI12_AA151570	Artemisia annua (Sweet wormwood)			carbohydrate binding [GO:0030246]	carbohydrate binding [GO:0030246]	QDDDNDA	tr|A0A2U1PHD9|A0A2U1PHD9_ARTAN Ricin B lectin domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA151570 PE=4 SV=1	0.81102	1.378	12865	18908	0	0	6034.2	0	0	0	12865	0	0	0	0	0	0	0	0	18908	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6034.2	0
A0A2U1PHK6	A0A2U1PHK6_ARTAN	Eukaryotic translation initiation factor 4G	CTI12_AA148990	Artemisia annua (Sweet wormwood)			translation initiation factor activity [GO:0003743]	translation initiation factor activity [GO:0003743]	EFSMLTK	tr|A0A2U1PHK6|A0A2U1PHK6_ARTAN Eukaryotic translation initiation factor 4G OS=Artemisia annua OX=35608 GN=CTI12_AA148990 PE=4 SV=1	0.86286	1.378	18078	25408	11605	21393	11374	0	0	0	0	0	18078	0	0	0	0	0	0	0	0	25408	9394.4	0	0	0	0	0	11605	0	0	0	0	0	0	0	21393	0	0	0	0	0	0	11090	0	0	11374	0	0	0	0	0
A0A2U1PHN1	A0A2U1PHN1_ARTAN	"Polynucleotidyl transferase, ribonuclease H-like superfamily protein"	CTI12_AA151500	Artemisia annua (Sweet wormwood)			nucleic acid binding [GO:0003676]; RNA-DNA hybrid ribonuclease activity [GO:0004523]; transferase activity [GO:0016740]	nucleic acid binding [GO:0003676]; RNA-DNA hybrid ribonuclease activity [GO:0004523]; transferase activity [GO:0016740]	YLGLILK	"tr|A0A2U1PHN1|A0A2U1PHN1_ARTAN Polynucleotidyl transferase, ribonuclease H-like superfamily protein OS=Artemisia annua OX=35608 GN=CTI12_AA151500 PE=4 SV=1;tr|A0A161X411|A0A161X411_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=D"	0.8857	1.378	0	27474	61409	0	0	0	0	0	0	0	0	0	0	0	0	0	27474	0	0	0	0	0	0	0	0	28303	0	0	61409	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PHU2	A0A2U1PHU2_ARTAN	"Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein"	CTI12_AA151410	Artemisia annua (Sweet wormwood)			kinase activity [GO:0016301]	kinase activity [GO:0016301]	NSSQEMK	"tr|A0A2U1PHU2|A0A2U1PHU2_ARTAN Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein OS=Artemisia annua OX=35608 GN=CTI12_AA151410 PE=4 SV=1"	0.80265	1.378	0	0	5248.8	4909	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5248.8	0	0	0	4909	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PI38	A0A2U1PI38_ARTAN	LAG1-like protein	CTI12_AA093430	Artemisia annua (Sweet wormwood)	ceramide biosynthetic process [GO:0046513]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; sphingosine N-acyltransferase activity [GO:0050291]; ceramide biosynthetic process [GO:0046513]	sphingosine N-acyltransferase activity [GO:0050291]	SDSDDDS	tr|A0A2U1PI38|A0A2U1PI38_ARTAN LAG1-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA093430 PE=4 SV=1	0.80581	1.378	0	0	0	2500.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2500.2	0	2175.6	0	0	0	0	0	0	0	0	0
A0A2U1PIL6	A0A2U1PIL6_ARTAN	Uncharacterized protein	CTI12_AA147690	Artemisia annua (Sweet wormwood)					ADPGNMM	tr|A0A2U1PIL6|A0A2U1PIL6_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA147690 PE=4 SV=1	0.85714	1.378	0	20898	18586	35431	7245.9	0	0	0	0	0	0	0	0	0	14727	18573	20898	0	0	0	0	0	0	0	0	18586	0	0	0	0	0	0	0	0	0	0	0	29135	35431	17279	12719	0	0	0	7245.9	4259.8	0	0	0	0
A0A2U1PJN0	A0A2U1PJN0_ARTAN	Protein FAR1-RELATED SEQUENCE 5	CTI12_AA144530	Artemisia annua (Sweet wormwood)					GDGDDSK	tr|A0A2U1PJN0|A0A2U1PJN0_ARTAN Protein FAR1-RELATED SEQUENCE 5 OS=Artemisia annua OX=35608 GN=CTI12_AA144530 PE=4 SV=1	0.80111	1.378	12315	0	6692.5	9094.6	4636.3	0	0	0	12315	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6692.5	0	0	0	0	0	9094.6	0	0	0	0	0	0	0	4636.3	0	0	0	0	0	0
A0A2U1PKK2	A0A2U1PKK2_ARTAN	40S ribosomal protein S24	CTI12_AA141480	Artemisia annua (Sweet wormwood)	translation [GO:0006412]	ribosome [GO:0005840]	ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	DETDGDN	tr|A0A2U1PKK2|A0A2U1PKK2_ARTAN 40S ribosomal protein S24 OS=Artemisia annua OX=35608 GN=CTI12_AA141480 PE=3 SV=1	0.80055	1.378	0	0	0	7968.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7968.7	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PPS0	A0A2U1PPS0_ARTAN	Uncharacterized protein	CTI12_AA126500	Artemisia annua (Sweet wormwood)					HAILLVK	tr|A0A2U1PPS0|A0A2U1PPS0_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA126500 PE=3 SV=1	0.80302	1.378	152890	178100	47179	19353	46728	0	0	0	152890	0	0	0	0	0	0	0	0	0	0	178100	0	0	0	0	0	0	0	47179	9539.2	0	0	0	0	0	0	0	0	19353	0	0	0	0	0	0	46728	0	0	0	0	0
A0A2U1PPT6	A0A2U1PPT6_ARTAN	GYF-like protein	CTI12_AA125880	Artemisia annua (Sweet wormwood)			DNA binding [GO:0003677]	DNA binding [GO:0003677]	MLLGYMR	tr|A0A2U1PPT6|A0A2U1PPT6_ARTAN GYF-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA125880 PE=4 SV=1	0.80338	1.378	11620	5870.3	0	0	0	0	0	11620	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5870.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PPU8	A0A2U1PPU8_ARTAN	ABC transporter domain-containing protein	CTI12_AA127140	Artemisia annua (Sweet wormwood)			ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	FGWICQK	tr|A0A2U1PPU8|A0A2U1PPU8_ARTAN ABC transporter domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA127140 PE=4 SV=1;tr|A0A2U1PDY5|A0A2U1PDY5_ARTAN ABC transporter domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA103820 PE=4 SV=	0.81216	1.378	0	0	105310	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	105310	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PPW4	A0A2U1PPW4_ARTAN	Uncharacterized protein	CTI12_AA126710	Artemisia annua (Sweet wormwood)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	ARSEGGSGFVISPSGRK	tr|A0A2U1PPW4|A0A2U1PPW4_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA126710 PE=4 SV=1	0.94891	1.378	16220	18273	38867	41448	14737	16220	10892	0	0	0	0	0	0	0	15603	14925	18273	0	0	0	0	0	0	12073	0	0	0	0	38867	0	0	19212	0	0	0	0	0	0	0	0	41448	0	0	0	0	0	14737	0	0	0
A0A2U1PQY8	A0A2U1PQY8_ARTAN	Uncharacterized protein	CTI12_AA123830	Artemisia annua (Sweet wormwood)					KFFIPKK	tr|A0A2U1PQY8|A0A2U1PQY8_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA123830 PE=4 SV=1;tr|A0A2U1KYN0|A0A2U1KYN0_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA550700 PE=4 SV=1	0.89498	1.378	1046	0	0	0	0	0	0	0	0	0	1046	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PR28	A0A2U1PR28_ARTAN	Carrier protein	CTI12_AA122880	Artemisia annua (Sweet wormwood)	mitochondrial phosphate ion transmembrane transport [GO:1990547]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; inorganic phosphate transmembrane transporter activity [GO:0005315]; mitochondrial phosphate ion transmembrane transport [GO:1990547]	inorganic phosphate transmembrane transporter activity [GO:0005315]	YAIPIPK	tr|A0A2U1PR28|A0A2U1PR28_ARTAN Carrier protein OS=Artemisia annua OX=35608 GN=CTI12_AA122880 PE=3 SV=1	0.80329	1.378	0	23510	0	460070	8909.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23510	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	460070	0	0	0	0	0	8909.7	0	0	0
A0A2U1PRF9	A0A2U1PRF9_ARTAN	Uncharacterized protein	CTI12_AA121840	Artemisia annua (Sweet wormwood)	reciprocal meiotic recombination [GO:0007131]		reciprocal meiotic recombination [GO:0007131]		GLHEGFK	tr|A0A2U1PRF9|A0A2U1PRF9_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA121840 PE=4 SV=1;tr|A0A103YDM3|A0A103YDM3_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_014475 PE=4 SV=1	0.82636	1.378	0	14379	0	8613.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14379	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8613.3	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PRP3	A0A2U1PRP3_ARTAN	"Dehydrogenase, E1 component"	CTI12_AA120510	Artemisia annua (Sweet wormwood)			"oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor [GO:0016624]"	"oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor [GO:0016624]"	QINRSFESEENDSWWKR	"tr|A0A2U1PRP3|A0A2U1PRP3_ARTAN Dehydrogenase, E1 component OS=Artemisia annua OX=35608 GN=CTI12_AA120510 PE=4 SV=1;tr|A0A2U1PRT2|A0A2U1PRT2_ARTAN Dehydrogenase, E1 component OS=Artemisia annua OX=35608 GN=CTI12_AA120510 PE=4 SV=1"	0.91129	1.378	41075	326120	0	0	76452	0	0	0	41075	0	0	0	34010	0	0	0	0	0	0	0	0	32683	326120	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	76452	0
A0A2U1PSQ9	A0A2U1PSQ9_ARTAN	Cannabidiolic acid synthase-like 1	CTI12_AA115280	Artemisia annua (Sweet wormwood)			FAD binding [GO:0071949]; oxidoreductase activity [GO:0016491]	FAD binding [GO:0071949]; oxidoreductase activity [GO:0016491]	LKEPIPK	tr|A0A2U1PSQ9|A0A2U1PSQ9_ARTAN Cannabidiolic acid synthase-like 1 OS=Artemisia annua OX=35608 GN=CTI12_AA115280 PE=3 SV=1;tr|A0A699K127|A0A699K127_TANCI Berberine bridge enzyme-like 15 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_636729 PE=3 SV=1;tr|A0A2U	0.839	1.378	0	0	0	0	41068	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	41068	0	0	0	0	0	0	0	0
A0A2U1PTF3	A0A2U1PTF3_ARTAN	Cytochrome P450	CTI12_AA115120	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	"integral component of membrane [GO:0016021]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	RFIVRVR	tr|A0A2U1PTF3|A0A2U1PTF3_ARTAN Cytochrome P450 OS=Artemisia annua OX=35608 GN=CTI12_AA115120 PE=3 SV=1	0.89076	1.378	15766	20799	5595	8417.5	2130.9	0	0	0	0	0	0	15766	0	0	0	0	0	0	20799	0	0	0	0	0	0	0	0	0	0	0	5595	0	6325.6	8417.5	0	0	0	0	0	0	0	0	0	2130.9	0	0	0	0	0	0
A0A2U1PU26	A0A2U1PU26_ARTAN	Uncharacterized protein	CTI12_AA112830	Artemisia annua (Sweet wormwood)					DGDYLGK	tr|A0A2U1PU26|A0A2U1PU26_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA112830 PE=4 SV=1	0.80422	1.378	46639	65004	40569	41592	18882	0	46639	43955	42631	0	0	0	0	0	29978	0	0	0	0	0	65004	0	0	16748	35086	0	0	0	0	0	0	40569	0	0	0	41592	0	0	0	0	0	0	0	0	12633	8039.8	0	18882	0	0
A0A2U1PUH1	A0A2U1PUH1_ARTAN	Reverse transcriptase	CTI12_AA111670	Artemisia annua (Sweet wormwood)	DNA integration [GO:0015074]; tRNA aminoacylation for protein translation [GO:0006418]		aminoacyl-tRNA ligase activity [GO:0004812]; ATP binding [GO:0005524]; nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]; tRNA aminoacylation for protein translation [GO:0006418]	aminoacyl-tRNA ligase activity [GO:0004812]; ATP binding [GO:0005524]; nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	GSHFCNK	tr|A0A2U1PUH1|A0A2U1PUH1_ARTAN Reverse transcriptase OS=Artemisia annua OX=35608 GN=CTI12_AA111670 PE=4 SV=1	0.80496	1.378	0	0	0	18704	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18704	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PUH3	A0A2U1PUH3_ARTAN	DUF4283 domain-containing protein	CTI12_AA111640	Artemisia annua (Sweet wormwood)	arginyl-tRNA aminoacylation [GO:0006420]	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]; arginine-tRNA ligase activity [GO:0004814]; ATP binding [GO:0005524]; arginyl-tRNA aminoacylation [GO:0006420]	arginine-tRNA ligase activity [GO:0004814]; ATP binding [GO:0005524]	KKITLWNK	tr|A0A2U1PUH3|A0A2U1PUH3_ARTAN DUF4283 domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA111640 PE=4 SV=1	0.85882	1.7673	12426	13979	10568	17299	39303	0	0	0	0	0	12426	0	5399	0	13979	0	0	0	0	0	8185.3	0	0	0	0	10568	0	0	5200.2	0	0	0	0	0	13767	0	0	6988.5	17299	0	0	39303	16103	0	11678	0	8964.2	0	0	0
A0A2U1PV41	A0A2U1PV41_ARTAN	DNA helicase (EC 3.6.4.12)	CTI12_AA109360	Artemisia annua (Sweet wormwood)	nucleotide-excision repair [GO:0006289]; transcription initiation from RNA polymerase II promoter [GO:0006367]		ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0140603]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; nucleotide-excision repair [GO:0006289]; transcription initiation from RNA polymerase II promoter [GO:0006367]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0140603]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]	PKIPAKR	tr|A0A2U1PV41|A0A2U1PV41_ARTAN DNA helicase OS=Artemisia annua OX=35608 GN=CTI12_AA109360 PE=3 SV=1	0.80607	1.378	0	15111	29240	13851	5603.4	0	0	0	0	0	0	0	0	0	8474.3	15111	0	0	0	0	0	0	0	21838	0	0	0	0	29240	0	0	0	0	0	0	0	0	0	0	13851	7523.4	0	0	0	0	5603.4	0	0	0	0
A0A2U1PVS3	A0A2U1PVS3_ARTAN	Transcription factor	CTI12_AA106720	Artemisia annua (Sweet wormwood)	root development [GO:0048364]	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; protein dimerization activity [GO:0046983]; root development [GO:0048364]	DNA-binding transcription factor activity [GO:0003700]; protein dimerization activity [GO:0046983]	FGCQNPK	tr|A0A2U1PVS3|A0A2U1PVS3_ARTAN Transcription factor OS=Artemisia annua OX=35608 GN=CTI12_AA106720 PE=4 SV=1	0.80681	1.378	0	0	30918	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25734	0	0	0	0	0	30918	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PWC3	A0A2U1PWC3_ARTAN	ARM repeat superfamily protein	CTI12_AA105300	Artemisia annua (Sweet wormwood)					ELCMGPFHTTFWRDVIK	tr|A0A2U1PWC3|A0A2U1PWC3_ARTAN ARM repeat superfamily protein OS=Artemisia annua OX=35608 GN=CTI12_AA105300 PE=4 SV=1	0.94928	1.378	0	0	18417	6418.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18417	0	0	0	0	0	0	6418.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PXI2	A0A2U1PXI2_ARTAN	"THO complex, subunit 5"	CTI12_AA100660	Artemisia annua (Sweet wormwood)		nucleus [GO:0005634]	nucleus [GO:0005634]		KAQLALA	"tr|A0A2U1PXI2|A0A2U1PXI2_ARTAN THO complex, subunit 5 OS=Artemisia annua OX=35608 GN=CTI12_AA100660 PE=3 SV=1;tr|A0A2U1LZS2|A0A2U1LZS2_ARTAN THO complex, subunit 5 OS=Artemisia annua OX=35608 GN=CTI12_AA424130 PE=3 SV=1"	0.90909	2.756	15612	61841	51241	33344	34787	0	0	0	0	0	0	0	0	15612	0	42094	7471.1	61841	47422	36987	0	0	0	0	0	0	0	0	6052.5	35660	0	51241	33344	0	0	0	0	0	0	0	0	0	34787	0	0	0	0	0	0	0
A0A2U1PXP6	A0A2U1PXP6_ARTAN	"Small ubiquitin-related modifier, SUMO"	CTI12_AA100240	Artemisia annua (Sweet wormwood)					MSSHTVK	"tr|A0A2U1PXP6|A0A2U1PXP6_ARTAN Small ubiquitin-related modifier, SUMO OS=Artemisia annua OX=35608 GN=CTI12_AA100240 PE=4 SV=1;tr|A0A2U1PV05|A0A2U1PV05_ARTAN Small ubiquitin-related modifier, SUMO OS=Artemisia annua OX=35608 GN=CTI12_AA110150 PE=3 SV=1;tr|A"	0.84263	1.378	41187	0	0	0	0	0	0	0	0	0	0	41187	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PXT6	A0A2U1PXT6_ARTAN	(S)-2-hydroxy-acid oxidase (EC 1.1.3.15)	CTI12_AA093870	Artemisia annua (Sweet wormwood)	oxidative photosynthetic carbon pathway [GO:0009854]		FMN binding [GO:0010181]; long-chain-(S)-2-hydroxy-long-chain-acid oxidase activity [GO:0052853]; medium-chain-(S)-2-hydroxy-acid oxidase activity [GO:0052854]; very-long-chain-(S)-2-hydroxy-acid oxidase activity [GO:0052852]; oxidative photosynthetic carbon pathway [GO:0009854]	FMN binding [GO:0010181]; long-chain-(S)-2-hydroxy-long-chain-acid oxidase activity [GO:0052853]; medium-chain-(S)-2-hydroxy-acid oxidase activity [GO:0052854]; very-long-chain-(S)-2-hydroxy-acid oxidase activity [GO:0052852]	DCDGPGR	tr|A0A2U1PXT6|A0A2U1PXT6_ARTAN (S)-2-hydroxy-acid oxidase OS=Artemisia annua OX=35608 GN=CTI12_AA093870 PE=3 SV=1	0.80867	1.378	0	24631	16726	16759	0	0	0	0	0	0	0	0	0	0	21978	0	15702	0	0	24631	18979	0	0	0	0	16726	0	0	0	0	0	0	0	0	0	0	16213	16759	0	0	13785	0	0	0	0	0	0	0	0	0
A0A2U1PY05	A0A2U1PY05_ARTAN	"F-box domain, cyclin-like protein"	CTI12_AA096820	Artemisia annua (Sweet wormwood)					IKNQALM	"tr|A0A2U1PY05|A0A2U1PY05_ARTAN F-box domain, cyclin-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA096820 PE=4 SV=1"	0.83582	2.119	5095.5	11232	7975.7	17807	18584	0	5095.5	0	0	0	0	0	0	0	11232	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7975.7	0	0	0	0	0	17807	0	6568.1	0	0	0	18584	0	0	0	0	0	0	0
A0A2U1PYA1	A0A2U1PYA1_ARTAN	Homeodomain-like protein	CTI12_AA097950	Artemisia annua (Sweet wormwood)			DNA binding [GO:0003677]	DNA binding [GO:0003677]	VPTTDDR	tr|A0A2U1PYA1|A0A2U1PYA1_ARTAN Homeodomain-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA097950 PE=4 SV=1	0.94074	1.378	12609	0	10396	0	0	0	0	0	0	0	0	0	0	12609	0	0	0	0	0	0	0	0	0	10396	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PYB5	A0A2U1PYB5_ARTAN	K-like domain protein	CTI12_AA090010	Artemisia annua (Sweet wormwood)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	SCGMCGK	tr|A0A2U1PYB5|A0A2U1PYB5_ARTAN K-like domain protein OS=Artemisia annua OX=35608 GN=CTI12_AA090010 PE=4 SV=1	0.77804	1.378	8388.3	0	0	0	10928	0	0	0	0	0	0	8388.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10928
A0A2U1PZ81	A0A2U1PZ81_ARTAN	NAC domain-containing protein	CTI12_AA095190	Artemisia annua (Sweet wormwood)			DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	FENPSNN	tr|A0A2U1PZ81|A0A2U1PZ81_ARTAN NAC domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA095190 PE=4 SV=1	0.83099	1.378	0	0	0	7843.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7843.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1PZY0	A0A2U1PZY0_ARTAN	Uncharacterized protein	CTI12_AA090200	Artemisia annua (Sweet wormwood)					GFIRMHK	tr|A0A2U1PZY0|A0A2U1PZY0_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA090200 PE=4 SV=1	0.83183	1.378	93862	0	85624	9124.6	32284	0	0	0	8814.8	7108.9	0	93862	0	9564.4	0	0	0	0	0	0	0	0	0	85624	0	0	0	0	0	16453	0	0	0	9124.6	0	0	0	0	0	0	0	0	0	0	0	32284	0	0	0	21104
A0A2U1Q099	A0A2U1Q099_ARTAN	Cytochrome P450	CTI12_AA089730	Artemisia annua (Sweet wormwood)					LLIPINK	tr|A0A2U1Q099|A0A2U1Q099_ARTAN Cytochrome P450 OS=Artemisia annua OX=35608 GN=CTI12_AA089730 PE=4 SV=1	0.83225	1.378	0	0	0	37496	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37496	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1Q0B1	A0A2U1Q0B1_ARTAN	PDR ABC-type transporter family protein	CTI12_AA090620	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	VYLWVFR	tr|A0A2U1Q0B1|A0A2U1Q0B1_ARTAN PDR ABC-type transporter family protein OS=Artemisia annua OX=35608 GN=CTI12_AA090620 PE=3 SV=1	0.83266	1.378	0	4055.2	0	2549.2	3016.7	0	0	0	0	0	0	0	0	0	0	0	0	4055.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2549.2	0	0	0	0	0	0	0	0	0	0	0	0	3016.7	0
A0A2U1Q114	A0A2U1Q114_ARTAN	Myb/SANT-like domain-containing protein	CTI12_AA088020	Artemisia annua (Sweet wormwood)					SFGTNEM	tr|A0A2U1Q114|A0A2U1Q114_ARTAN Myb/SANT-like domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA088020 PE=4 SV=1;tr|A0A2U1NJ21|A0A2U1NJ21_ARTAN Myb/SANT-like domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA260320 PE=4 SV=1	0.90984	1.378	0	0	0	35403	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35403	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1Q268	A0A2U1Q268_ARTAN	"RNA-directed DNA polymerase, eukaryota"	CTI12_AA083850	Artemisia annua (Sweet wormwood)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	VPIRFFR	"tr|A0A2U1Q268|A0A2U1Q268_ARTAN RNA-directed DNA polymerase, eukaryota OS=Artemisia annua OX=35608 GN=CTI12_AA083850 PE=4 SV=1"	0.90977	1.378	3364.7	0	0	0	0	0	0	0	0	0	0	0	0	3364.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1Q2C9	A0A2U1Q2C9_ARTAN	NAC domain-containing protein	CTI12_AA084580	Artemisia annua (Sweet wormwood)	"regulation of transcription, DNA-templated [GO:0006355]"		"DNA binding [GO:0003677]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]	YFFLTPR	tr|A0A2U1Q2C9|A0A2U1Q2C9_ARTAN NAC domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA084580 PE=4 SV=1;tr|A0A2U1Q275|A0A2U1Q275_ARTAN NAC domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA084580 PE=4 SV=1	0.8356	1.378	0	149340	0	25048	0	0	0	0	0	0	0	0	0	0	0	149340	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25048	0	0	0	0	0	0	0	0	0
A0A2U1Q2D0	A0A2U1Q2D0_ARTAN	Alpha/beta-Hydrolases superfamily protein	CTI12_AA030660	Artemisia annua (Sweet wormwood)			hydrolase activity [GO:0016787]	hydrolase activity [GO:0016787]	ICTFINN	tr|A0A2U1Q2D0|A0A2U1Q2D0_ARTAN Alpha/beta-Hydrolases superfamily protein OS=Artemisia annua OX=35608 GN=CTI12_AA030660 PE=4 SV=1	0.83645	1.378	0	0	0	0	6906.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6906.9	0	0	0	0	0	0
A0A2U1Q2D3	A0A2U1Q2D3_ARTAN	Dihydroxy-acid dehydratase	CTI12_AA084700	Artemisia annua (Sweet wormwood)		nucleus [GO:0005634]	nucleus [GO:0005634]; lyase activity [GO:0016829]	lyase activity [GO:0016829]	FSGGSHR	tr|A0A2U1Q2D3|A0A2U1Q2D3_ARTAN Dihydroxy-acid dehydratase OS=Artemisia annua OX=35608 GN=CTI12_AA084700 PE=3 SV=1	0.83687	1.378	0	0	0	0	270240	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	270240	0	0
A0A2U1Q2M6	A0A2U1Q2M6_ARTAN	Rhodanese-like domain-containing protein	CTI12_AA081270	Artemisia annua (Sweet wormwood)	cellular response to calcium ion [GO:0071277]; de-etiolation [GO:0009704]; regulation of stomatal closure [GO:0090333]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; cellular response to calcium ion [GO:0071277]; de-etiolation [GO:0009704]; regulation of stomatal closure [GO:0090333]		DDNGNDK	tr|A0A2U1Q2M6|A0A2U1Q2M6_ARTAN Rhodanese-like domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA081270 PE=4 SV=1	0.83729	1.378	0	2671.8	0	5308.3	0	0	0	0	0	0	0	0	0	0	0	2671.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5308.3	0	0	0	0	0	0	0	0	0	0
A0A2U1Q449	A0A2U1Q449_ARTAN	Uncharacterized protein	CTI12_AA077850	Artemisia annua (Sweet wormwood)					STGSHTR	tr|A0A2U1Q449|A0A2U1Q449_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA077850 PE=4 SV=1	0.83476	1.378	0	485850	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	485850	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1Q4B3	A0A2U1Q4B3_ARTAN	Nucleotide-binding alpha-beta plait domain-containing protein	CTI12_AA074370	Artemisia annua (Sweet wormwood)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	SPLANSD	tr|A0A2U1Q4B3|A0A2U1Q4B3_ARTAN Nucleotide-binding alpha-beta plait domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA074370 PE=4 SV=1	0.82933	1.378	181220	0	57789	62235	0	0	0	0	181220	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	57789	0	0	0	0	0	62235	0	48684	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1Q4Y5	A0A2U1Q4Y5_ARTAN	Uncharacterized protein	CTI12_AA074580	Artemisia annua (Sweet wormwood)					YCKFTLK	tr|A0A2U1Q4Y5|A0A2U1Q4Y5_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA074580 PE=4 SV=1	0.92308	1.378	10868	10047	8197.4	10387	0	0	0	0	8195.4	0	0	10868	0	0	0	0	0	9247.9	0	0	0	10047	0	0	0	0	0	0	0	8197.4	0	0	0	10387	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1Q594	A0A2U1Q594_ARTAN	"Transposase, MuDR, MULE transposase domain protein"	CTI12_AA073930	Artemisia annua (Sweet wormwood)			zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	HVVKLPK	"tr|A0A2U1Q594|A0A2U1Q594_ARTAN Transposase, MuDR, MULE transposase domain protein OS=Artemisia annua OX=35608 GN=CTI12_AA073930 PE=4 SV=1"	0.8285	1.378	15715	12568	21057	59009	16710	0	0	0	11491	15715	0	0	0	0	0	0	0	9809.2	0	0	0	12568	0	0	0	0	0	0	0	0	21057	0	10100	8050.7	0	0	0	0	0	0	59009	0	0	16710	0	11971	0	0	10853	0
A0A2U1Q5A9	A0A2U1Q5A9_ARTAN	Uncharacterized protein	CTI12_AA073670	Artemisia annua (Sweet wormwood)					EDCGDEE	tr|A0A2U1Q5A9|A0A2U1Q5A9_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA073670 PE=4 SV=1	0.81908	1.378	15260	0	6704.2	0	0	0	0	0	11585	15260	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6704.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1Q5T1	A0A2U1Q5T1_ARTAN	Myb/SANT-like domain-containing protein	CTI12_AA070070	Artemisia annua (Sweet wormwood)					TTTLPFR	tr|A0A2U1Q5T1|A0A2U1Q5T1_ARTAN Myb/SANT-like domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA070070 PE=4 SV=1	0.8203	1.378	0	0	13355	0	11893	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13355	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11893	0	0
A0A2U1Q6I9	A0A2U1Q6I9_ARTAN	Uncharacterized protein	CTI12_AA069020	Artemisia annua (Sweet wormwood)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	TKKLPSK	tr|A0A2U1Q6I9|A0A2U1Q6I9_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA069020 PE=4 SV=1	0.82111	1.378	9820.4	0	0	8805.3	0	0	0	0	0	0	9820.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8805.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1Q7X6	A0A2U1Q7X6_ARTAN	Ferritin (EC 1.16.3.1)	CTI12_AA064030	Artemisia annua (Sweet wormwood)	cellular iron ion homeostasis [GO:0006879]; iron ion transport [GO:0006826]	chloroplast [GO:0009507]	chloroplast [GO:0009507]; ferric iron binding [GO:0008199]; ferroxidase activity [GO:0004322]; cellular iron ion homeostasis [GO:0006879]; iron ion transport [GO:0006826]	ferric iron binding [GO:0008199]; ferroxidase activity [GO:0004322]	MLSAVYK	tr|A0A2U1Q7X6|A0A2U1Q7X6_ARTAN Ferritin OS=Artemisia annua OX=35608 GN=CTI12_AA064030 PE=3 SV=1	0.82233	1.378	0	0	14965	0	29931	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14965	0	14628	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29931	0	0	0	0	0	0	0	0
A0A2U1Q841	A0A2U1Q841_ARTAN	RRM domain-containing protein	CTI12_AA064110	Artemisia annua (Sweet wormwood)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	VVLAKVK	tr|A0A2U1Q841|A0A2U1Q841_ARTAN RRM domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA064110 PE=4 SV=1	0.82356	1.378	37668	0	19267	26922	0	0	29703	0	37668	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19267	0	26922	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1Q864	A0A2U1Q864_ARTAN	"Transferase, Chloramphenicol acetyltransferase-like domain protein"	CTI12_AA062280	Artemisia annua (Sweet wormwood)			"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	HMLSFCH	"tr|A0A2U1Q864|A0A2U1Q864_ARTAN Transferase, Chloramphenicol acetyltransferase-like domain protein OS=Artemisia annua OX=35608 GN=CTI12_AA062280 PE=3 SV=1"	0.82397	1.378	0	5209.3	0	0	5803.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5209.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5803.7	0	0	0	0	0	0	0
A0A2U1Q866	A0A2U1Q866_ARTAN	Chloramphenicol acetyltransferase-like domain-containing protein	CTI12_AA062270	Artemisia annua (Sweet wormwood)			"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	PLLKQGK	tr|A0A2U1Q866|A0A2U1Q866_ARTAN Chloramphenicol acetyltransferase-like domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA062270 PE=3 SV=1	0.82438	1.378	0	0	11049	0	7062.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11049	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7062.3	0	0	0	0	0	0	0
A0A2U1Q8D7	A0A2U1Q8D7_ARTAN	Rab-GTPase-TBC domain-containing protein	CTI12_AA061310	Artemisia annua (Sweet wormwood)					KHALLPK	tr|A0A2U1Q8D7|A0A2U1Q8D7_ARTAN Rab-GTPase-TBC domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA061310 PE=4 SV=1	0.82479	1.378	0	0	34577	16077	20915	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34577	0	0	0	0	0	15812	0	0	0	16077	0	0	0	0	0	0	11922	0	0	0	0	0	0	0	20915	0
A0A2U1Q8E1	A0A2U1Q8E1_ARTAN	Cis-prenyltransferase	CTI12_AA052130	Artemisia annua (Sweet wormwood)			"transferase activity, transferring alkyl or aryl (other than methyl) groups [GO:0016765]"	"transferase activity, transferring alkyl or aryl (other than methyl) groups [GO:0016765]"	TDDSERD	tr|A0A2U1Q8E1|A0A2U1Q8E1_ARTAN Cis-prenyltransferase OS=Artemisia annua OX=35608 GN=CTI12_AA052130 PE=4 SV=1	0.8252	1.378	0	0	34843	0	27497	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34843	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27497	0	0	0	0	0	0	0
A0A2U1Q8L6	A0A2U1Q8L6_ARTAN	Endonuclease/exonuclease/phosphatase	CTI12_AA060660	Artemisia annua (Sweet wormwood)	phosphatidylinositol dephosphorylation [GO:0046856]		endonuclease activity [GO:0004519]; exonuclease activity [GO:0004527]; phosphatase activity [GO:0016791]; phosphatidylinositol dephosphorylation [GO:0046856]	endonuclease activity [GO:0004519]; exonuclease activity [GO:0004527]; phosphatase activity [GO:0016791]	SHSRCYK	tr|A0A2U1Q8L6|A0A2U1Q8L6_ARTAN Endonuclease/exonuclease/phosphatase OS=Artemisia annua OX=35608 GN=CTI12_AA060660 PE=3 SV=1	0.82602	1.378	20159	17917	24510	241460	17479	12474	11863	12547	20159	0	0	0	18508	0	0	0	17917	0	0	0	0	17147	0	0	0	0	0	0	0	0	0	24510	0	0	0	17538	13969	0	241460	0	88817	0	0	17479	13455	0	0	14491	0	0
A0A2U1Q9M0	A0A2U1Q9M0_ARTAN	Hybrid signal transduction histidine kinase M	CTI12_AA057200	Artemisia annua (Sweet wormwood)			kinase activity [GO:0016301]	kinase activity [GO:0016301]	FPHHSPR	tr|A0A2U1Q9M0|A0A2U1Q9M0_ARTAN Hybrid signal transduction histidine kinase M OS=Artemisia annua OX=35608 GN=CTI12_AA057200 PE=4 SV=1	0.82809	1.378	16889	17996	16446	0	9131.3	0	9504	10247	0	16889	0	0	0	7654.3	0	0	0	0	0	0	0	17996	0	6976.4	0	0	0	0	0	16446	12805	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7124.6	0	9131.3	0	0
A0A2U1QA00	A0A2U1QA00_ARTAN	Uncharacterized protein	CTI12_AA055990	Artemisia annua (Sweet wormwood)					RKAFITK	tr|A0A2U1QA00|A0A2U1QA00_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA055990 PE=4 SV=1	0.83941	1.378	6220.6	0	0	0	0	0	0	0	6220.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1QA16	A0A2U1QA16_ARTAN	Dof zinc finger protein DOF3.4	CTI12_AA055410	Artemisia annua (Sweet wormwood)	"regulation of transcription, DNA-templated [GO:0006355]"		"DNA binding [GO:0003677]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]	MPRHFSK	tr|A0A2U1QA16|A0A2U1QA16_ARTAN Dof zinc finger protein DOF3.4 OS=Artemisia annua OX=35608 GN=CTI12_AA055410 PE=4 SV=1	0.81868	1.378	0	0	11389	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11389	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1QA26	A0A2U1QA26_ARTAN	Uncharacterized protein	CTI12_AA055500	Artemisia annua (Sweet wormwood)					FATFRNR	tr|A0A2U1QA26|A0A2U1QA26_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA055500 PE=4 SV=1;tr|A0A251SQA7|A0A251SQA7_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0394821 PE=4 SV=1;tr|A0A2U1QA20|A0A2U1QA20_A	0.81769	1.378	2417.5	0	0	12730	7198.7	0	2417.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4781.1	0	0	0	0	0	0	12730	0	0	0	0	0	0	7198.7	0	0	0
A0A2U1QA29	A0A2U1QA29_ARTAN	"Nuclear fragile X mental retardation-interacting protein 1, conserved domain-containing protein"	CTI12_AA056610	Artemisia annua (Sweet wormwood)					QSHRGQK	"tr|A0A2U1QA29|A0A2U1QA29_ARTAN Nuclear fragile X mental retardation-interacting protein 1, conserved domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA056610 PE=4 SV=1"	0.83984	1.378	0	17477	9994.7	0	7103.2	0	0	0	0	0	0	0	0	0	0	0	17477	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9994.7	0	0	0	0	0	0	0	0	0	0	0	0	0	7103.2	0	0	0	0
A0A2U1QA42	A0A2U1QA42_ARTAN	"IQ motif, EF-hand binding site"	CTI12_AA055340	Artemisia annua (Sweet wormwood)		nucleus [GO:0005634]	nucleus [GO:0005634]; calmodulin binding [GO:0005516]	calmodulin binding [GO:0005516]	QQNLFKR	"tr|A0A2U1QA42|A0A2U1QA42_ARTAN IQ motif, EF-hand binding site OS=Artemisia annua OX=35608 GN=CTI12_AA055340 PE=4 SV=1;tr|A0A124SB60|A0A124SB60_CYNCS Calponin homology domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_008397 PE="	0.84127	2.1356	7335.2	5399.9	11362	0	5161.7	0	0	6917.5	0	0	0	0	7335.2	0	5399.9	0	0	0	0	0	0	0	0	5987.5	0	9041.4	0	0	9243.3	0	0	11362	0	0	0	0	0	0	0	0	0	0	0	0	5161.7	0	0	0	0	0
A0A2U1QAA1	A0A2U1QAA1_ARTAN	Ribonuclease H protein	CTI12_AA051810	Artemisia annua (Sweet wormwood)					WRFLVEK	tr|A0A2U1QAA1|A0A2U1QAA1_ARTAN Ribonuclease H protein OS=Artemisia annua OX=35608 GN=CTI12_AA051810 PE=4 SV=1;tr|A0A2U1KY60|A0A2U1KY60_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA552240 PE=4 SV=1	0.89091	1.378	18521	20529	20048	23074	23309	0	0	0	0	0	18521	0	0	0	0	20529	0	0	0	0	17273	0	0	0	0	0	0	0	20048	0	0	0	0	0	0	23074	0	0	0	0	0	23309	0	0	0	0	17034	0	0	0
A0A2U1QAF4	A0A2U1QAF4_ARTAN	"Bromodomain, NET domain protein"	CTI12_AA054280	Artemisia annua (Sweet wormwood)					RTPVPKK	"tr|A0A2U1QAF4|A0A2U1QAF4_ARTAN Bromodomain, NET domain protein OS=Artemisia annua OX=35608 GN=CTI12_AA054280 PE=4 SV=1"	0.84069	1.378	16671	0	0	0	0	0	0	16671	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1QB55	A0A2U1QB55_ARTAN	RAB geranylgeranyl transferase alpha subunit 1	CTI12_AA023140	Artemisia annua (Sweet wormwood)	protein prenylation [GO:0018342]		protein prenyltransferase activity [GO:0008318]; protein prenylation [GO:0018342]	protein prenyltransferase activity [GO:0008318]	FSDYDLTHSMPSSCLRR	tr|A0A2U1QB55|A0A2U1QB55_ARTAN RAB geranylgeranyl transferase alpha subunit 1 OS=Artemisia annua OX=35608 GN=CTI12_AA023140 PE=3 SV=1	0.86264	1.378	0	0	0	57290	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	57290	0	0	0	0	0	0	0	0	0	0
A0A2U1QB63	A0A2U1QB63_ARTAN	"Rho GTPase activation protein, PH domain-like, Ternary complex factor MIP1, leucine-zipper"	CTI12_AA023150	Artemisia annua (Sweet wormwood)	signal transduction [GO:0007165]		signal transduction [GO:0007165]		IDGCDWK	"tr|A0A2U1QB63|A0A2U1QB63_ARTAN Rho GTPase activation protein, PH domain-like, Ternary complex factor MIP1, leucine-zipper OS=Artemisia annua OX=35608 GN=CTI12_AA023150 PE=4 SV=1"	0.8528	1.378	0	18276	9919.2	14172	19890	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18276	13077	0	0	0	0	9919.2	0	0	0	0	0	0	0	0	0	0	0	14172	0	0	0	0	19890	0	6574.6	0	6763.2	0	0	0
A0A2U1QC99	A0A2U1QC99_ARTAN	DUF4283 domain-containing protein	CTI12_AA048600	Artemisia annua (Sweet wormwood)					HVDSHDK	tr|A0A2U1QC99|A0A2U1QC99_ARTAN DUF4283 domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA048600 PE=4 SV=1	0.85589	1.378	9037.9	11888	0	0	0	0	0	0	9037.9	0	0	0	0	0	0	0	0	0	11888	0	0	7232.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1QCB1	A0A2U1QCB1_ARTAN	Malectin/receptor-like protein kinase family protein	CTI12_AA046160	Artemisia annua (Sweet wormwood)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	PQDWQKK	tr|A0A2U1QCB1|A0A2U1QCB1_ARTAN Malectin/receptor-like protein kinase family protein OS=Artemisia annua OX=35608 GN=CTI12_AA046160 PE=4 SV=1;tr|A0A2U1LWR5|A0A2U1LWR5_ARTAN Malectin/receptor-like protein kinase family protein OS=Artemisia annua OX=35608 GN=C	0.8263	1.378	0	0	0	0	9061.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9061.8	0	0
A0A2U1QDK0	A0A2U1QDK0_ARTAN	"Alpha-1,4 glucan phosphorylase (EC 2.4.1.1)"	CTI12_AA044220	Artemisia annua (Sweet wormwood)	carbohydrate metabolic process [GO:0005975]		glycogen phosphorylase activity [GO:0008184]; linear malto-oligosaccharide phosphorylase activity [GO:0102250]; pyridoxal phosphate binding [GO:0030170]; SHG alpha-glucan phosphorylase activity [GO:0102499]; carbohydrate metabolic process [GO:0005975]	glycogen phosphorylase activity [GO:0008184]; linear malto-oligosaccharide phosphorylase activity [GO:0102250]; pyridoxal phosphate binding [GO:0030170]; SHG alpha-glucan phosphorylase activity [GO:0102499]	DGYFGYK	"tr|A0A2U1QDK0|A0A2U1QDK0_ARTAN Alpha-1,4 glucan phosphorylase OS=Artemisia annua OX=35608 GN=CTI12_AA044220 PE=3 SV=1;tr|A0A251V019|A0A251V019_HELAN Alpha-1,4 glucan phosphorylase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr04g0117131 PE=3 SV=1"	0.80488	2.2865	0	647010	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	647010	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1QDN8	A0A2U1QDN8_ARTAN	Ribosome production factor 2 homolog (Ribosome biogenesis protein RPF2 homolog)	CTI12_AA043040	Artemisia annua (Sweet wormwood)	maturation of LSU-rRNA [GO:0000470]; ribosomal large subunit assembly [GO:0000027]	nucleolus [GO:0005730]	nucleolus [GO:0005730]; rRNA binding [GO:0019843]; maturation of LSU-rRNA [GO:0000470]; ribosomal large subunit assembly [GO:0000027]	rRNA binding [GO:0019843]	QEDDASA	tr|A0A2U1QDN8|A0A2U1QDN8_ARTAN Ribosome production factor 2 homolog OS=Artemisia annua OX=35608 GN=CTI12_AA043040 PE=3 SV=1	0.8581	1.378	113000	104670	83619	121450	152390	113000	0	0	0	103090	0	0	0	0	9819.9	99753	104670	0	0	47248	47934	0	0	83619	55982	15134	0	0	26664	0	0	0	0	0	0	74016	46144	61718	121450	73591	0	0	152390	63519	26106	16349	26533	0	18091	0
A0A2U1QDQ6	A0A2U1QDQ6_ARTAN	Endoribonuclease XendoU-like protein	CTI12_AA042800	Artemisia annua (Sweet wormwood)			endoribonuclease activity [GO:0004521]	endoribonuclease activity [GO:0004521]	DDWDNFK	tr|A0A2U1QDQ6|A0A2U1QDQ6_ARTAN Endoribonuclease XendoU-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA042800 PE=3 SV=1	0.85855	1.378	0	0	0	0	3621.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3621.1	0	0
A0A2U1QEB5	A0A2U1QEB5_ARTAN	Zinc finger CCCH domain-containing protein 14	CTI12_AA039400	Artemisia annua (Sweet wormwood)			DNA binding [GO:0003677]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]	DFGFNKK	tr|A0A2U1QEB5|A0A2U1QEB5_ARTAN Zinc finger CCCH domain-containing protein 14 OS=Artemisia annua OX=35608 GN=CTI12_AA039400 PE=4 SV=1	0.85944	1.378	0	14842	10870	12798	14432	0	0	0	0	0	0	0	0	0	0	11411	0	0	0	14842	14652	0	0	0	0	10870	10620	0	0	0	0	0	0	0	0	0	0	11665	0	12798	0	14432	0	0	8616.5	0	11147	0	0	0
A0A2U1QER1	A0A2U1QER1_ARTAN	ENTH/VHS-like protein	CTI12_AA037910	Artemisia annua (Sweet wormwood)	protein targeting to vacuole [GO:0006623]	clathrin-coated vesicle [GO:0030136]; Golgi apparatus [GO:0005794]	clathrin-coated vesicle [GO:0030136]; Golgi apparatus [GO:0005794]; clathrin binding [GO:0030276]; protein targeting to vacuole [GO:0006623]	clathrin binding [GO:0030276]	AYVRHWR	tr|A0A2U1QER1|A0A2U1QER1_ARTAN ENTH/VHS-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA037910 PE=4 SV=1;tr|A0A2U1LF70|A0A2U1LF70_ARTAN ENTH/VHS-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA498690 PE=4 SV=1;tr|A0A5N6MX02|A0A5N6MX02_9ASTR ENTH do	0.8072	1.378	0	0	0	7861.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7861.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1QFY9	A0A2U1QFY9_ARTAN	Tetratricopeptide repeat (TPR)-like superfamily protein	CTI12_AA034350	Artemisia annua (Sweet wormwood)					VYAIHGR	tr|A0A2U1QFY9|A0A2U1QFY9_ARTAN Tetratricopeptide repeat (TPR)-like superfamily protein OS=Artemisia annua OX=35608 GN=CTI12_AA034350 PE=4 SV=1;tr|A0A2U1LIJ7|A0A2U1LIJ7_ARTAN Tetratricopeptide repeat (TPR)-like superfamily protein OS=Artemisia annua OX=3560	0.8549	1.378	18630	0	8140	0	11561	0	0	0	18630	11514	0	0	0	9087.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8140	0	0	0	0	0	0	0	0	0	0	0	0	0	11561	0	0	0	0	0	0
A0A2U1QGK5	A0A2U1QGK5_ARTAN	"Zinc finger, RING/FYVE/PHD-type"	CTI12_AA032150	Artemisia annua (Sweet wormwood)					SSSSSGM	"tr|A0A2U1QGK5|A0A2U1QGK5_ARTAN Zinc finger, RING/FYVE/PHD-type OS=Artemisia annua OX=35608 GN=CTI12_AA032150 PE=4 SV=1;tr|A0A175YJR6|A0A175YJR6_DAUCS RING-type domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_030947 PE=4 SV=1"	0.847	1.378	8420.8	0	0	0	1606.5	8420.8	0	0	0	0	0	0	6840.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1606.5	0	0
A0A2U1QH27	A0A2U1QH27_ARTAN	Protein kinase-like protein	CTI12_AA030890	Artemisia annua (Sweet wormwood)			kinase activity [GO:0016301]	kinase activity [GO:0016301]	AWCWNCCCC	tr|A0A2U1QH27|A0A2U1QH27_ARTAN Protein kinase-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA030890 PE=4 SV=1	0.88235	2.1744	26097	34244	138390	66414	51023	0	0	26097	0	18088	0	0	0	0	0	0	0	34244	0	0	0	0	0	0	0	0	0	0	0	0	0	138390	0	0	0	0	0	0	0	66414	0	51023	49664	0	0	0	0	0	0	0
A0A2U1QHC9	A0A2U1QHC9_ARTAN	"Alcohol dehydrogenase, C-terminal"	CTI12_AA009570	Artemisia annua (Sweet wormwood)					FTPLSSK	"tr|A0A2U1QHC9|A0A2U1QHC9_ARTAN Alcohol dehydrogenase, C-terminal OS=Artemisia annua OX=35608 GN=CTI12_AA009570 PE=4 SV=1"	0.84197	1.378	66592	67217	21759	0	42288	19130	18765	0	32214	32451	0	66592	0	21079	0	0	0	12287	67217	0	0	12424	0	19466	0	0	0	0	0	21759	0	0	0	0	0	0	0	0	0	0	0	0	0	31654	0	0	0	35152	42288	0
A0A2U1QJG5	A0A2U1QJG5_ARTAN	TO45-2	CTI12_AA004390	Artemisia annua (Sweet wormwood)					GFMKEYR	tr|A0A2U1QJG5|A0A2U1QJG5_ARTAN TO45-2 OS=Artemisia annua OX=35608 GN=CTI12_AA004390 PE=4 SV=1	0.84627	1.378	0	0	0	7107.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7107.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1QJM3	A0A2U1QJM3_ARTAN	Uncharacterized protein	CTI12_AA021450	Artemisia annua (Sweet wormwood)		plasma membrane [GO:0005886]	plasma membrane [GO:0005886]		GMDMPDSFAWSYKRIYK	tr|A0A2U1QJM3|A0A2U1QJM3_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA021450 PE=3 SV=1	0.90323	1.378	31398	7811.6	12334	0	30950	0	0	0	10226	0	0	31398	0	0	0	0	0	0	7811.6	0	0	0	0	0	0	0	0	0	0	12334	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30950	0	26471	21031	0
A0A2U1QKJ4	A0A2U1QKJ4_ARTAN	"UV excision repair protein Rad23, UBA-like, Ubiquitin-related domain protein"	CTI12_AA018360	Artemisia annua (Sweet wormwood)					VASGQHR	"tr|A0A2U1QKJ4|A0A2U1QKJ4_ARTAN UV excision repair protein Rad23, UBA-like, Ubiquitin-related domain protein OS=Artemisia annua OX=35608 GN=CTI12_AA018360 PE=4 SV=1"	0.85057	1.378	169120	46037	40043	22190	33557	55038	169120	27346	0	0	0	0	0	0	0	0	0	0	46037	0	0	0	0	23370	13189	0	0	0	0	0	0	40043	0	0	0	22190	0	0	0	0	0	0	0	33557	0	4584.8	0	0	21367	0
A0A2U1QLC0	A0A2U1QLC0_ARTAN	Gibberellin regulated protein	CTI12_AA008480	Artemisia annua (Sweet wormwood)					YACTFGCDDK	tr|A0A2U1QLC0|A0A2U1QLC0_ARTAN Gibberellin regulated protein OS=Artemisia annua OX=35608 GN=CTI12_AA008480 PE=3 SV=1	0.84757	1.378	0	0	5222.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5222.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1QLE9	A0A2U1QLE9_ARTAN	NB-ARC domains-containing protein	CTI12_AA011480	Artemisia annua (Sweet wormwood)			ADP binding [GO:0043531]	ADP binding [GO:0043531]	HAVKILK	tr|A0A2U1QLE9|A0A2U1QLE9_ARTAN NB-ARC domains-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA011480 PE=4 SV=1	0.848	1.378	0	0	0	24762	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24762	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1QLU2	A0A2U1QLU2_ARTAN	Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8)	CTI12_AA013800	Artemisia annua (Sweet wormwood)		nucleus [GO:0005634]	nucleus [GO:0005634]; peptidyl-prolyl cis-trans isomerase activity [GO:0003755]; RNA binding [GO:0003723]; zinc ion binding [GO:0008270]	peptidyl-prolyl cis-trans isomerase activity [GO:0003755]; RNA binding [GO:0003723]; zinc ion binding [GO:0008270]	HGGTAGK	tr|A0A2U1QLU2|A0A2U1QLU2_ARTAN Peptidyl-prolyl cis-trans isomerase OS=Artemisia annua OX=35608 GN=CTI12_AA013800 PE=3 SV=1;tr|A0A2U1MFN8|A0A2U1MFN8_ARTAN Peptidyl-prolyl cis-trans isomerase OS=Artemisia annua OX=35608 GN=CTI12_AA208000 PE=3 SV=1	0.77421	1.378	0	0	12157	6962.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12157	0	0	0	0	0	0	6962.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1QMN9	A0A2U1QMN9_ARTAN	BTB/POZ-like protein	CTI12_AA003620	Artemisia annua (Sweet wormwood)					LLAASDK	tr|A0A2U1QMN9|A0A2U1QMN9_ARTAN BTB/POZ-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA003620 PE=3 SV=1;tr|A0A161Y6Z7|A0A161Y6Z7_DAUCS FAD-binding FR-type domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_025204 PE=4 SV=1	0.84931	1.378	172920	253850	437790	151820	88528	115210	107640	121410	0	0	139420	0	172920	86914	253850	189240	0	145880	107420	0	146660	0	0	73030	133400	132060	0	437790	112160	88199	163820	172880	89385	0	129370	151820	90184	90128	91349	148330	145620	0	88528	0	0	0	57829	0	84157	0
A0A2U1QMV0	A0A2U1QMV0_ARTAN	Elongation factor family protein	CTI12_AA009800	Artemisia annua (Sweet wormwood)			GTP binding [GO:0005525]; GTPase activity [GO:0003924]; translation elongation factor activity [GO:0003746]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]; translation elongation factor activity [GO:0003746]	DTDLDVS	tr|A0A2U1QMV0|A0A2U1QMV0_ARTAN Elongation factor family protein OS=Artemisia annua OX=35608 GN=CTI12_AA009800 PE=4 SV=1	0.84974	1.378	0	0	0	0	6957.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6957.1	3749	0	0	0	0
A0A2U1QNT0	A0A2U1QNT0_ARTAN	Uncharacterized protein	CTI12_AA004180	Artemisia annua (Sweet wormwood)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		HVGGVGR	tr|A0A2U1QNT0|A0A2U1QNT0_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA004180 PE=4 SV=1	0.81787	1.378	4030.2	3599.5	5813.7	7259.6	0	4030.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3599.5	0	0	3993.4	0	0	0	0	5813.7	0	0	0	5214.2	0	7259.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1QNU9	A0A2U1QNU9_ARTAN	"Small GTPase superfamily, Ran GTPase, P-loop containing nucleoside triphosphate hydrolase"	CTI12_AA004190	Artemisia annua (Sweet wormwood)			GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	GSDNCCS	"tr|A0A2U1QNU9|A0A2U1QNU9_ARTAN Small GTPase superfamily, Ran GTPase, P-loop containing nucleoside triphosphate hydrolase OS=Artemisia annua OX=35608 GN=CTI12_AA004190 PE=4 SV=1"	0.7974	1.378	0	0	13013	1601.8	1204.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13013	2121.3	0	0	0	0	0	0	0	0	1601.8	0	0	0	0	0	0	0	0	0	0	0	1204.6	0	0
A0A2U1QPA2	A0A2U1QPA2_ARTAN	"Transcription factor, TCP"	CTI12_AA002460	Artemisia annua (Sweet wormwood)			DNA-binding transcription factor activity [GO:0003700]	DNA-binding transcription factor activity [GO:0003700]	THTSTSR	"tr|A0A2U1QPA2|A0A2U1QPA2_ARTAN Transcription factor, TCP OS=Artemisia annua OX=35608 GN=CTI12_AA002460 PE=4 SV=1"	0.81746	1.378	0	202500	0	0	0	0	0	0	0	0	0	0	0	0	0	202500	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2U1QPQ0	A0A2U1QPQ0_ARTAN	"F-box domain, cyclin-like protein"	CTI12_AA000750	Artemisia annua (Sweet wormwood)					FTRRPGR	"tr|A0A2U1QPQ0|A0A2U1QPQ0_ARTAN F-box domain, cyclin-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA000750 PE=4 SV=1;tr|A0A699H211|A0A699H211_TANCI F-box protein PP2-A13-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_298501 PE=4 SV=1"	0.78867	1.378	0	0	0	26806	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26806	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A5HSG2	A5HSG2_ARTAN	40S ribosomal protein S9 (Putative 40S ribosomal protein S9)	CTI12_AA169300	Artemisia annua (Sweet wormwood)	translation [GO:0006412]	small ribosomal subunit [GO:0015935]	small ribosomal subunit [GO:0015935]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]	NYGKTFK	"tr|A5HSG2|A5HSG2_ARTAN 40S ribosomal protein S9 OS=Artemisia annua OX=35608 GN=CTI12_AA169300 PE=2 SV=1;tr|A0A103XVP6|A0A103XVP6_CYNCS Ribosomal protein S4, conserved site-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_000141 PE=3 "	0.73077	2.756	15085	8493.9	11508	10510	6771.1	0	5324.6	10237	15085	0	0	0	7626.9	0	0	8493.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11508	0	0	0	0	0	0	10510	0	0	0	0	0	0	0	0	0	6771.1	0
B2LRS5	B2LRS5_ARTAN	Terpene cyclase/mutase family member (EC 5.4.99.-)	BAS	Artemisia annua (Sweet wormwood)	triterpenoid biosynthetic process [GO:0016104]	lipid droplet [GO:0005811]	lipid droplet [GO:0005811]; beta-amyrin synthase activity [GO:0042300]; lanosterol synthase activity [GO:0000250]; triterpenoid biosynthetic process [GO:0016104]	beta-amyrin synthase activity [GO:0042300]; lanosterol synthase activity [GO:0000250]	QVLPQLK	tr|B2LRS5|B2LRS5_ARTAN Terpene cyclase/mutase family member OS=Artemisia annua OX=35608 GN=BAS PE=2 SV=1;tr|B1P7H3|B1P7H3_ARTAN Terpene cyclase/mutase family member OS=Artemisia annua OX=35608 GN=BAS PE=2 SV=1;tr|A0A2U1LPY6|A0A2U1LPY6_ARTAN Terpene cyclase	0.90278	1.378	0	23122	25554	26934	17436	0	0	0	0	0	0	0	0	0	23122	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25554	0	0	25426	0	0	0	0	26934	0	0	0	0	0	0	17436	0	0	0	0
D2X656	D2X656_ARTAN	KAKTUS 1 (Fragment)		Artemisia annua (Sweet wormwood)			ubiquitin-protein transferase activity [GO:0004842]	ubiquitin-protein transferase activity [GO:0004842]	LPSYSTK	tr|D2X656|D2X656_ARTAN KAKTUS 1 (Fragment) OS=Artemisia annua OX=35608 PE=2 SV=1;tr|A0A2U1LY69|A0A2U1LY69_ARTAN Ubiquitin-transferase OS=Artemisia annua OX=35608 GN=CTI12_AA440120 PE=4 SV=1;tr|A0A2U1LY75|A0A2U1LY75_ARTAN Ubiquitin-transferase OS=Artemisia 	0.84367	1.378	0	0	72101	86290	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	72101	0	0	0	0	0	0	0	0	86290	0	0	0	0	0	0	0	0	0	0	0	0	0
B2Y596	B2Y596_9ASTR	"NAD(P)H dehydrogenase, chain 4 (NAD(P)H-quinone oxidoreductase chain 4, chloroplastic) (NADH-plastoquinone oxidoreductase chain 4) (Fragment)"	ndhD	Atractylis cancellata	ATP synthesis coupled electron transport [GO:0042773]	chloroplast [GO:0009507]; integral component of membrane [GO:0016021]; thylakoid [GO:0009579]	chloroplast [GO:0009507]; integral component of membrane [GO:0016021]; thylakoid [GO:0009579]; NADH dehydrogenase (ubiquinone) activity [GO:0008137]; ATP synthesis coupled electron transport [GO:0042773]	NADH dehydrogenase (ubiquinone) activity [GO:0008137]	TLPLIPK	"tr|B2Y596|B2Y596_9ASTR NAD(P)H dehydrogenase, chain 4 (Fragment) OS=Atractylis cancellata OX=143173 GN=ndhD PE=3 SV=1"	0.93146	1.378	0	122440	20349	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	122440	0	0	0	0	0	20349	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5P8H4P8	A0A5P8H4P8_ATRLA	Beta-caryophyllene synthase	CPS1	Atractylodes lancea (Atractylodes japonica)	diterpenoid biosynthetic process [GO:0016102]		magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333]; diterpenoid biosynthetic process [GO:0016102]	magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333]	VIHVMYK	tr|A0A5P8H4P8|A0A5P8H4P8_ATRLA Beta-caryophyllene synthase OS=Atractylodes lancea OX=41486 GN=CPS1 PE=2 SV=1	0.82664	1.378	0	0	0	46040	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	46040	0	0	0	0	0	0	0	0	0
L7NQF7	L7NQF7_9ASTR	"30S ribosomal protein S11, chloroplastic"	rps11 Denin_Cp054	Chrysanthemum indicum	translation [GO:0006412]	chloroplast [GO:0009507]; ribosome [GO:0005840]	chloroplast [GO:0009507]; ribosome [GO:0005840]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]	WEICRKK	"tr|L7NQF7|L7NQF7_9ASTR 30S ribosomal protein S11, chloroplastic OS=Chrysanthemum indicum OX=146995 GN=rps11 PE=3 SV=1;tr|K9L669|K9L669_CHRMO 30S ribosomal protein S11, chloroplastic OS=Chrysanthemum morifolium OX=41568 GN=rps11 PE=3 SV=1"	0.9497	1.378	0	33216	43274	67417	0	0	0	0	0	0	0	0	0	0	0	0	30024	0	0	33216	18436	0	0	0	0	32023	43274	0	0	0	0	0	0	0	35500	0	0	0	0	67417	0	0	0	0	0	0	0	0	0	0
B7U8J5	B7U8J5_CHRMO	Constans-like protein		Chrysanthemum morifolium (Florist's daisy) (Dendranthema grandiflorum)		nucleus [GO:0005634]	nucleus [GO:0005634]; zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	AECSECR	tr|B7U8J5|B7U8J5_CHRMO Constans-like protein OS=Chrysanthemum morifolium OX=41568 PE=2 SV=1	0.93193	1.378	57064	6913.6	5248	32943	17479	0	0	0	0	0	0	57064	0	0	0	0	0	0	6913.6	0	0	0	0	0	0	0	0	0	0	5248	0	0	32943	0	0	0	0	0	0	0	0	0	0	7133	0	0	0	0	0	17479
A0A0M4JN75	A0A0M4JN75_CICIN	Transcription factor bHLH (Fragment)	bHLH	Cichorium intybus (Chicory)					IVIHLLL	tr|A0A0M4JN75|A0A0M4JN75_CICIN Transcription factor bHLH (Fragment) OS=Cichorium intybus OX=13427 GN=bHLH PE=2 SV=1	0.92872	1.378	0	0	0	0	4843.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4843.1
Q6YFH9	Q6YFH9_CICIN	Resistance protein candidate (Fragment)		Cichorium intybus (Chicory)			ADP binding [GO:0043531]	ADP binding [GO:0043531]	MMQRLRK	tr|Q6YFH9|Q6YFH9_CICIN Resistance protein candidate (Fragment) OS=Cichorium intybus OX=13427 PE=4 SV=1	0.80348	1.378	0	23898	10002	14163	26164	0	0	0	0	0	0	0	0	0	0	0	17513	0	0	0	23898	0	0	0	10002	0	0	0	0	0	0	0	0	0	0	14163	0	0	0	0	0	0	0	14505	26164	0	26006	0	0	0
A0A881ZQV3	A0A881ZQV3_9ASTR	Flavonoid 3'-hydroxylase	f3'h	Cirsium japonicum					PPHSGAK	tr|A0A881ZQV3|A0A881ZQV3_9ASTR Flavonoid 3-hydroxylase OS=Cirsium japonicum OX=516546 GN=f3h PE=2 SV=1	0.80755	1.378	8441.4	0	0	23582	0	0	2701.2	0	0	0	0	0	8441.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23582	0	0	0	0	0	0	0	0	0	0
A0A1Z2QSG2	A0A1Z2QSG2_9ASTR	NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K)	ndhE nuoK Cl_fau1Pt1196	Clermontia fauriei	ATP synthesis coupled electron transport [GO:0042773]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; plastid [GO:0009536]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; plastid [GO:0009536]; NADH dehydrogenase (quinone) activity [GO:0050136]; quinone binding [GO:0048038]; ATP synthesis coupled electron transport [GO:0042773]	NADH dehydrogenase (quinone) activity [GO:0050136]; quinone binding [GO:0048038]	LLNAQNR	"tr|A0A1Z2QSG2|A0A1Z2QSG2_9ASTR NADH-quinone oxidoreductase subunit K OS=Clermontia fauriei OX=138094 GN=ndhE PE=3 SV=1;tr|A0A1U7AF81|A0A1U7AF81_9ASTR NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Clermontia samuelii subsp. hanaensis OX=126917"	0.84238	1.378	0	0	0	5801000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5801000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1P8STJ4	A0A1P8STJ4_9ASTR	Steroid 5-alpha-reductase DET2 (EC 1.3.1.22)	DET2	Coreopsis rosea	brassinosteroid biosynthetic process [GO:0016132]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; 3-oxo-5-alpha-steroid 4-dehydrogenase activity [GO:0003865]; cholestenone 5-alpha-reductase activity [GO:0047751]; brassinosteroid biosynthetic process [GO:0016132]	3-oxo-5-alpha-steroid 4-dehydrogenase activity [GO:0003865]; cholestenone 5-alpha-reductase activity [GO:0047751]	GPYDEGK	tr|A0A1P8STJ4|A0A1P8STJ4_9ASTR Steroid 5-alpha-reductase DET2 OS=Coreopsis rosea OX=159682 GN=DET2 PE=2 SV=1;tr|A0A6S7NEW1|A0A6S7NEW1_LACSI Steroid 5-alpha-reductase DET2 OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS26870 PE=3 SV=1;tr|A0A2J6JWE7|A0A2J6JWE7_LAC	0.8032	1.378	40090	0	0	0	0	0	0	0	0	0	0	0	0	40090	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A7D5YRR6	A0A7D5YRR6_CORSA	Ankyrin repeat protein		Coriandrum sativum (Coriander) (Chinese parsley)					VVSETQK	tr|A0A7D5YRR6|A0A7D5YRR6_CORSA Ankyrin repeat protein OS=Coriandrum sativum OX=4047 PE=2 SV=1;tr|A0A6L5BAP9|A0A6L5BAP9_APIGR Uncharacterized protein OS=Apium graveolens OX=4045 GN=AG4045_001927 PE=4 SV=1;tr|A0A164Z0I8|A0A164Z0I8_DAUCS MSP domain-containing	0.80857	1.378	0	11284	0	0	0	0	0	0	0	0	0	0	0	0	11284	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A346D3R2	A0A346D3R2_COSBI	Cycloidea-like protein		Cosmos bipinnatus (Garden cosmos) (Bidens formosa)			DNA-binding transcription factor activity [GO:0003700]	DNA-binding transcription factor activity [GO:0003700]	DSSFQGS	tr|A0A346D3R2|A0A346D3R2_COSBI Cycloidea-like protein OS=Cosmos bipinnatus OX=51277 PE=4 SV=1;tr|A0A346D3P1|A0A346D3P1_9ASTR Cycloidea-like protein (Fragment) OS=Crossostephium chinense OX=99046 PE=4 SV=1;tr|A0A346D3J8|A0A346D3J8_9ASTR Cycloidea-like prote	0.8254	2.1364	0	0	0	9944	1183.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9944	9721.9	0	0	0	0	0	0	0	0	0	1183.1	0	0	0	0	0
C1J0N7	C1J0N7_9ASTR	Flavonoid 3'-hydroxylase		Cosmos sulphureus			"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	DHSSSGK	tr|C1J0N7|C1J0N7_9ASTR Flavonoid 3-hydroxylase OS=Cosmos sulphureus OX=459758 PE=2 SV=1	0.94807	1.378	0	0	0	0	513700	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6631.9	513700	0
A0A103UAG6	A0A103UAG6_CYNCS	Chromatin-remodeling ATPase INO80 (EC 3.6.4.-)	Ccrd_025826	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	"ATP-dependent chromatin remodeling [GO:0043044]; DNA repair [GO:0006281]; transcription, DNA-templated [GO:0006351]"	Ino80 complex [GO:0031011]	"Ino80 complex [GO:0031011]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0140603]; DNA binding [GO:0003677]; helicase activity [GO:0004386]; ATP-dependent chromatin remodeling [GO:0043044]; DNA repair [GO:0006281]; transcription, DNA-templated [GO:0006351]"	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0140603]; DNA binding [GO:0003677]; helicase activity [GO:0004386]	MLLLPSK	tr|A0A103UAG6|A0A103UAG6_CYNCS Chromatin-remodeling ATPase INO80 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_025826 PE=3 SV=1;tr|A0A5N6L9S3|A0A5N6L9S3_9ASTR Chromatin-remodeling ATPase INO80 OS=Mikania micrantha OX=192012 GN=E3N88_45209 PE=3 SV=1;	0.94072	1.378	0	0	361110	457060	306770	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	361110	0	0	0	0	0	0	0	0	0	0	8869.3	0	0	457060	0	0	0	0	0	0	306770	0	0	0
A0A103UWC0	A0A103UWC0_CYNCS	Uncharacterized protein (Fragment)	Ccrd_025751	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					IINKPVK	tr|A0A103UWC0|A0A103UWC0_CYNCS Uncharacterized protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_025751 PE=4 SV=1	0.80812	1.378	0	0	0	0	60751	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	60751	0	0	0	0	0	0
A0A103VRI4	A0A103VRI4_CYNCS	Chromatin-remodeling ATPase INO80 (EC 3.6.4.-)	Ccrd_025665	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	"ATP-dependent chromatin remodeling [GO:0043044]; DNA repair [GO:0006281]; transcription, DNA-templated [GO:0006351]"	Ino80 complex [GO:0031011]	"Ino80 complex [GO:0031011]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0140603]; DNA binding [GO:0003677]; nucleosome-dependent ATPase activity [GO:0070615]; ATP-dependent chromatin remodeling [GO:0043044]; DNA repair [GO:0006281]; transcription, DNA-templated [GO:0006351]"	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0140603]; DNA binding [GO:0003677]; nucleosome-dependent ATPase activity [GO:0070615]	TLRPDWR	tr|A0A103VRI4|A0A103VRI4_CYNCS Chromatin-remodeling ATPase INO80 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_025665 PE=3 SV=1	0.93799	1.378	0	0	1248900	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1248900	0	0	0	0	0	34719	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103X3C3	A0A103X3C3_CYNCS	Uncharacterized protein	Ccrd_025472	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					FYYGRKK	tr|A0A103X3C3|A0A103X3C3_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_025472 PE=4 SV=1;tr|A0A118JP12|A0A118JP12_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_025473 PE=4 SV=1	0.94505	1.378	6754.4	10142	13106	12041	0	0	6754.4	0	0	0	0	0	0	0	0	0	10142	0	0	0	0	0	8301.8	0	0	0	0	0	13106	0	0	0	0	0	0	0	0	0	0	0	12041	0	0	0	0	0	0	0	0	0
A0A103XB24	A0A103XB24_CYNCS	Uncharacterized protein (Fragment)	Ccrd_025341	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					GFAKHMLK	tr|A0A103XB24|A0A103XB24_CYNCS Uncharacterized protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_025341 PE=4 SV=1;tr|A0A103XB21|A0A103XB21_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_025342 PE=4 	0.79032	2.1426	0	12677	29408	14560	0	0	0	0	0	0	0	0	0	0	8874.3	11280	0	0	0	0	12677	0	0	0	0	10610	19774	29408	0	0	0	0	0	0	0	0	0	11367	14560	0	0	0	0	0	0	0	0	0	0	0
A0A103XB97	A0A103XB97_CYNCS	Uncharacterized protein	Ccrd_025183	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					RPLEDTR	tr|A0A103XB97|A0A103XB97_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_025183 PE=4 SV=1	0.92845	1.378	0	61252	58431	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	61252	0	0	0	0	0	0	0	0	0	0	58431	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XBJ7	A0A103XBJ7_CYNCS	"IQ motif, EF-hand binding site-containing protein"	Ccrd_025032	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			calmodulin binding [GO:0005516]	calmodulin binding [GO:0005516]	ECSCISR	"tr|A0A103XBJ7|A0A103XBJ7_CYNCS IQ motif, EF-hand binding site-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_025032 PE=3 SV=1"	0.8	1.378	0	0	0	37190	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37190	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XBN6	A0A103XBN6_CYNCS	"Lipase, class 3"	Ccrd_024948	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	lipid metabolic process [GO:0006629]	nucleus [GO:0005634]	nucleus [GO:0005634]; lipid metabolic process [GO:0006629]		KKGHYMK	"tr|A0A103XBN6|A0A103XBN6_CYNCS Lipase, class 3 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_024948 PE=4 SV=1"	0.93149	1.378	0	0	0	16378	9386.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16378	0	0	0	0	0	0	0	0	9386.4	0	0	0
A0A103XBP1	A0A103XBP1_CYNCS	Protein kinase-like domain-containing protein	Ccrd_024959	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			kinase activity [GO:0016301]	kinase activity [GO:0016301]	IDDLPPK	tr|A0A103XBP1|A0A103XBP1_CYNCS Protein kinase-like domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_024959 PE=4 SV=1	0.80046	1.378	10648	0	0	17719	12977	10648	6709.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17719	0	0	0	0	0	0	12977	0	0	0	0	0	0	0
A0A103XC82	A0A103XC82_CYNCS	Ribosomal protein S3Ae (Fragment)	Ccrd_024558	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	translation [GO:0006412]	ribosome [GO:0005840]	ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	SCGGDWR	tr|A0A103XC82|A0A103XC82_CYNCS Ribosomal protein S3Ae (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_024558 PE=4 SV=1	0.80092	1.378	0	0	0	0	47388	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	47388	0	0	0	0	0	0	0	0
A0A103XDF1	A0A103XDF1_CYNCS	Ran GTPase	Ccrd_026151	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	SGWCCSS	tr|A0A103XDF1|A0A103XDF1_CYNCS Ran GTPase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_026151 PE=4 SV=1	0.93501	1.378	0	0	0	2338	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2338	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XDN8	A0A103XDN8_CYNCS	Membrane attack complex component/perforin (MACPF) domain-containing protein	Ccrd_025755	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	defense response [GO:0006952]; programmed cell death [GO:0012501]; regulation of salicylic acid mediated signaling pathway [GO:2000031]		defense response [GO:0006952]; programmed cell death [GO:0012501]; regulation of salicylic acid mediated signaling pathway [GO:2000031]		SKDHKNK	tr|A0A103XDN8|A0A103XDN8_CYNCS Membrane attack complex component/perforin (MACPF) domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_025755 PE=4 SV=1	0.9437	1.378	23437	28930	0	0	0	0	0	23437	0	0	0	0	0	0	0	0	28930	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XF78	A0A103XF78_CYNCS	Uncharacterized protein	Ccrd_008457	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			catalytic activity [GO:0003824]	catalytic activity [GO:0003824]	FHVIQDK	tr|A0A103XF78|A0A103XF78_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_008457 PE=4 SV=1	0.80157	1.378	53396	0	0	0	0	0	0	0	0	0	0	53396	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XF88	A0A103XF88_CYNCS	DDT domain-containing protein	Ccrd_008321	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		nucleus [GO:0005634]	nucleus [GO:0005634]; metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	CTYTCHK	tr|A0A103XF88|A0A103XF88_CYNCS DDT domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_008321 PE=4 SV=1;tr|A0A251SEX2|A0A251SEX2_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0430561 PE=4 SV=1;tr|A0A	0.79661	2.1527	0	0	0	0	27528	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27528	0
A0A103XFQ7	A0A103XFQ7_CYNCS	Histone-fold	Ccrd_008173	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		CCAAT-binding factor complex [GO:0016602]	"CCAAT-binding factor complex [GO:0016602]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; protein heterodimerization activity [GO:0046982]; sequence-specific DNA binding [GO:0043565]"	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; protein heterodimerization activity [GO:0046982]; sequence-specific DNA binding [GO:0043565]"	FTTSDDM	tr|A0A103XFQ7|A0A103XFQ7_CYNCS Histone-fold OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_008173 PE=3 SV=1	0.80249	1.378	0	14824	0	17091	28560	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14824	0	0	0	0	0	0	0	0	0	0	0	0	0	17091	0	0	0	0	0	0	0	20748	0	28560	0	0	0	0	0
A0A103XG03	A0A103XG03_CYNCS	Uncharacterized protein (Fragment)	Ccrd_007998	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					DDGDDHK	tr|A0A103XG03|A0A103XG03_CYNCS Uncharacterized protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_007998 PE=4 SV=1	0.80341	1.378	0	11475	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11475	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XGA3	A0A103XGA3_CYNCS	GAF domain-containing protein	Ccrd_007778	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	"detection of visible light [GO:0009584]; protein-chromophore linkage [GO:0018298]; regulation of transcription, DNA-templated [GO:0006355]"		"phosphorelay sensor kinase activity [GO:0000155]; photoreceptor activity [GO:0009881]; detection of visible light [GO:0009584]; protein-chromophore linkage [GO:0018298]; regulation of transcription, DNA-templated [GO:0006355]"	phosphorelay sensor kinase activity [GO:0000155]; photoreceptor activity [GO:0009881]	CEQQMQK	tr|A0A103XGA3|A0A103XGA3_CYNCS GAF domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_007778 PE=3 SV=1;tr|A0A2U1N0Z8|A0A2U1N0Z8_ARTAN Phytochrome OS=Artemisia annua OX=35608 GN=CTI12_AA319740 PE=3 SV=1	0.80766	1.378	0	0	9542.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9542.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XHC6	A0A103XHC6_CYNCS	Senescence regulator	Ccrd_007217	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					GYDKELK	tr|A0A103XHC6|A0A103XHC6_CYNCS Senescence regulator OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_007217 PE=4 SV=1	0.8048	1.378	0	4361.7	0	3324.7	0	0	0	0	0	0	0	0	0	0	4361.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3324.7	0	0	0	0	0	0	0	0	0
A0A103XHF5	A0A103XHF5_CYNCS	"Protein kinase, ATP binding site-containing protein"	Ccrd_007103	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	PGSCMGM	"tr|A0A103XHF5|A0A103XHF5_CYNCS Protein kinase, ATP binding site-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_007103 PE=3 SV=1"	0.80526	1.378	4809.1	0	5211.6	6241.1	4972	0	0	0	0	0	0	0	4809.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4431.1	0	5211.6	0	0	0	0	0	0	0	0	0	6241.1	0	0	0	0	3445.3	0	0	4972	0
A0A103XHF9	A0A103XHF9_CYNCS	Fatty acyl-CoA reductase	Ccrd_007299	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			fatty-acyl-CoA reductase (alcohol-forming) activity [GO:0080019]	fatty-acyl-CoA reductase (alcohol-forming) activity [GO:0080019]	VKLLSSK	tr|A0A103XHF9|A0A103XHF9_CYNCS Fatty acyl-CoA reductase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_007299 PE=4 SV=1;tr|A0A2J6KD33|A0A2J6KD33_LACSA SET domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_8X46201 PE=4 SV=1;tr|A0A6S7PC65|A0A	0.94245	1.378	7180.3	8724	9710.2	8294.1	0	0	0	0	0	0	7180.3	0	0	0	0	0	0	0	0	8724	0	0	0	0	0	0	9710.2	9178.8	0	0	0	0	0	0	8294.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XHL0	A0A103XHL0_CYNCS	EMSY N-terminal	Ccrd_007146	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	defense response to fungus [GO:0050832]; regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	nucleus [GO:0005634]; nucleosomal histone binding [GO:0031493]; defense response to fungus [GO:0050832]; regulation of transcription by RNA polymerase II [GO:0006357]	nucleosomal histone binding [GO:0031493]	CPGSGMR	tr|A0A103XHL0|A0A103XHL0_CYNCS EMSY N-terminal OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_007146 PE=4 SV=1	0.92836	1.378	5028.6	0	0	5616.6	0	0	0	0	5028.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5616.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XHP8	A0A103XHP8_CYNCS	K Homology domain-containing protein	Ccrd_007142	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			DNA binding [GO:0003677]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]	GAVGFEM	tr|A0A103XHP8|A0A103XHP8_CYNCS K Homology domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_007142 PE=4 SV=1	0.80618	1.378	0	0	5002.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5002.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XI21	A0A103XI21_CYNCS	BEACH domain-containing protein	Ccrd_006808	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					RAVVKTK	tr|A0A103XI21|A0A103XI21_CYNCS BEACH domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_006808 PE=4 SV=1	0.80627	1.378	0	6431.3	4739.1	3932.6	3501.4	0	0	0	0	0	0	0	0	0	4650.9	6431.3	0	0	0	0	0	0	0	4739.1	0	0	0	0	0	0	0	0	0	0	0	0	0	3932.6	0	0	0	0	0	0	3501.4	0	0	0	0	0
A0A103XIA8	A0A103XIA8_CYNCS	5'-3' exoribonuclease (EC 3.1.13.-)	Ccrd_006726	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	mRNA processing [GO:0006397]	nucleus [GO:0005634]	nucleus [GO:0005634]; 5'-3' exoribonuclease activity [GO:0004534]; nucleic acid binding [GO:0003676]; mRNA processing [GO:0006397]	5'-3' exoribonuclease activity [GO:0004534]; nucleic acid binding [GO:0003676]	VKLIYGK	tr|A0A103XIA8|A0A103XIA8_CYNCS 5-3 exoribonuclease OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_006726 PE=3 SV=1;tr|A0A6S7MNL9|A0A6S7MNL9_LACSI 5-3 exoribonuclease OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS17730 PE=3 SV=1;tr|A0A166DK02|A0A166DK0	0.80673	1.378	0	0	0	25847	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25847	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XIQ0	A0A103XIQ0_CYNCS	"Coactivator CBP, KIX domain-containing protein (Fragment)"	Ccrd_006504	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		nucleus [GO:0005634]	nucleus [GO:0005634]; chromatin DNA binding [GO:0031490]; transcription coactivator activity [GO:0003713]	chromatin DNA binding [GO:0031490]; transcription coactivator activity [GO:0003713]	PGNSTDM	"tr|A0A103XIQ0|A0A103XIQ0_CYNCS Coactivator CBP, KIX domain-containing protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_006504 PE=4 SV=1"	0.80356	1.378	0	0	26499	23989	45125	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26499	0	0	0	0	0	0	0	14160	0	0	0	23989	0	0	45125	0	0	0	0	0	0	0	0
A0A103XIR5	A0A103XIR5_CYNCS	Uncharacterized protein	Ccrd_006466	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					GCLPCSR	tr|A0A103XIR5|A0A103XIR5_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_006466 PE=4 SV=1	0.81361	1.378	14331	0	18820	18568	21746	0	14331	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18820	0	0	0	0	0	0	0	18568	0	0	0	0	0	0	0	21746	0	0	0	0	0	0	0
A0A103XIW2	A0A103XIW2_CYNCS	"Nucleic acid-binding, OB-fold"	Ccrd_006457	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			translation initiation factor activity [GO:0003743]	translation initiation factor activity [GO:0003743]	CVGFHVM	"tr|A0A103XIW2|A0A103XIW2_CYNCS Nucleic acid-binding, OB-fold OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_006457 PE=3 SV=1"	0.80402	1.378	0	0	0	618180	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13816	618180	0	0	0	0	0	0	0	0	0	0
A0A103XKW8	A0A103XKW8_CYNCS	Ankyrin repeat-containing protein (Fragment)	Ccrd_005435	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		YFFKTKK	tr|A0A103XKW8|A0A103XKW8_CYNCS Ankyrin repeat-containing protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_005435 PE=4 SV=1	0.92653	1.378	0	0	14759	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14759	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XL04	A0A103XL04_CYNCS	Pentatricopeptide repeat-containing protein	Ccrd_005268	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					LLLEENR	tr|A0A103XL04|A0A103XL04_CYNCS Pentatricopeptide repeat-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_005268 PE=4 SV=1	0.81148	1.378	0	6155.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6155.8	0	0	5403.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XM15	A0A103XM15_CYNCS	"Ataxin-2, C-terminal"	Ccrd_004753	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	SPDPDSK	"tr|A0A103XM15|A0A103XM15_CYNCS Ataxin-2, C-terminal OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_004753 PE=4 SV=1"	0.81119	1.378	0	0	9728.4	31428	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9728.4	0	5335.7	0	0	0	0	0	0	31428	0	0	0	0	0	0	0	0	0
A0A103XMQ1	A0A103XMQ1_CYNCS	Uncharacterized protein	Ccrd_004590	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					EACKIEK	tr|A0A103XMQ1|A0A103XMQ1_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_004590 PE=4 SV=1	0.81128	1.378	188880	318890	443420	26705	342700	25448	188880	0	0	0	0	0	49009	164540	318890	0	0	0	0	0	156350	0	0	0	0	315110	0	0	0	443420	263020	372750	0	0	0	0	26705	0	0	0	7598.2	0	0	0	342700	44776	24418	36263	267940	0
A0A103XNM7	A0A103XNM7_CYNCS	Glutaredoxin	Ccrd_003844	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			glutathione oxidoreductase activity [GO:0097573]	glutathione oxidoreductase activity [GO:0097573]	QVPNPEK	tr|A0A103XNM7|A0A103XNM7_CYNCS Glutaredoxin OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_003844 PE=4 SV=1	0.94034	1.378	0	0	0	37379	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37379	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XNV9	A0A103XNV9_CYNCS	Uncharacterized protein	Ccrd_003864	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	abscisic acid-activated signaling pathway [GO:0009738]; abscisic acid transport [GO:0080168]; export from cell [GO:0140352]; glycoside transport [GO:1901656]; intercellular transport [GO:0010496]; negative regulation of post-embryonic development [GO:0048581]; pollen wall assembly [GO:0010208]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; plasmodesma [GO:0009506]; pollen coat [GO:0070505]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; plasmodesma [GO:0009506]; pollen coat [GO:0070505]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]; efflux transmembrane transporter activity [GO:0015562]; abscisic acid transport [GO:0080168]; abscisic acid-activated signaling pathway [GO:0009738]; export from cell [GO:0140352]; glycoside transport [GO:1901656]; intercellular transport [GO:0010496]; negative regulation of post-embryonic development [GO:0048581]; pollen wall assembly [GO:0010208]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]; efflux transmembrane transporter activity [GO:0015562]	KPLLAKK	tr|A0A103XNV9|A0A103XNV9_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_003864 PE=3 SV=1	0.81063	1.378	0	0	49438	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	40715	0	0	0	0	49438	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XP41	A0A103XP41_CYNCS	"AT hook, DNA-binding motif-containing protein"	Ccrd_003567	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			DNA binding [GO:0003677]; metal ion binding [GO:0046872]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]	FGHDRVR	"tr|A0A103XP41|A0A103XP41_CYNCS AT hook, DNA-binding motif-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_003567 PE=4 SV=1"	0.81071	1.378	0	0	0	0	25715	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25715	0
A0A103XPB7	A0A103XPB7_CYNCS	"Myc-type, basic helix-loop-helix (BHLH) domain-containing protein"	Ccrd_003612	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		nucleus [GO:0005634]	nucleus [GO:0005634]; protein dimerization activity [GO:0046983]	protein dimerization activity [GO:0046983]	EGEIGHK	"tr|A0A103XPB7|A0A103XPB7_CYNCS Myc-type, basic helix-loop-helix (BHLH) domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_003612 PE=4 SV=1"	0.94187	1.378	0	13211	0	18427	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13211	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8798.4	5655.8	0	0	18427	0	0	0	0	0	0	0	0	0
A0A103XPY0	A0A103XPY0_CYNCS	TRAF-like protein (Fragment)	Ccrd_003264	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					TDQQVHR	tr|A0A103XPY0|A0A103XPY0_CYNCS TRAF-like protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_003264 PE=4 SV=1	0.81207	1.378	0	0	0	0	6049.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6049.4	0	0	0	0	0	0	0
A0A103XQA8	A0A103XQA8_CYNCS	Lipoyl-binding domain-containing protein	Ccrd_002995	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	glycine decarboxylation via glycine cleavage system [GO:0019464]	glycine cleavage complex [GO:0005960]; mitochondrion [GO:0005739]	glycine cleavage complex [GO:0005960]; mitochondrion [GO:0005739]; glycine decarboxylation via glycine cleavage system [GO:0019464]		DLTTTIS	tr|A0A103XQA8|A0A103XQA8_CYNCS Lipoyl-binding domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_002995 PE=4 SV=1	0.9376	1.378	0	0	0	0	15988	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15988	0	0	0	0
A0A103XQK4	A0A103XQK4_CYNCS	Uncharacterized protein (Fragment)	Ccrd_002914	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		IILLLLFR	tr|A0A103XQK4|A0A103XQK4_CYNCS Uncharacterized protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_002914 PE=4 SV=1	0.86441	1.378	5700000	9605500	5595600	5635200	3287300	3168100	2342100	5700000	3294500	3538100	2424100	3391100	3247300	2518100	117320	2933600	115000	700210	107410	9605500	6088500	16500	57119	2015800	1899100	4413500	5002700	5595600	3215100	100930	2091300	3464800	5635200	4901200	5088200	3600500	304500	46580	39765	53581	207380	3287300	0	31415	3228900	1886900	62911	2265400	2388900	16506
A0A103XR45	A0A103XR45_CYNCS	zinc_ribbon_12 domain-containing protein	Ccrd_002585	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	regulation of defense response to fungus [GO:1900150]		regulation of defense response to fungus [GO:1900150]		CMMGHNK	tr|A0A103XR45|A0A103XR45_CYNCS zinc_ribbon_12 domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_002585 PE=4 SV=1	0.8127	1.378	0	0	0	5584.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5584.7	0	5299.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XRA5	A0A103XRA5_CYNCS	AAA+ ATPase domain-containing protein (Fragment)	Ccrd_002514	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		spliceosomal complex [GO:0005681]	spliceosomal complex [GO:0005681]; ATP binding [GO:0005524]; helicase activity [GO:0004386]; hydrolase activity [GO:0016787]; nucleic acid binding [GO:0003676]	ATP binding [GO:0005524]; helicase activity [GO:0004386]; hydrolase activity [GO:0016787]; nucleic acid binding [GO:0003676]	AAAPDDD	tr|A0A103XRA5|A0A103XRA5_CYNCS AAA+ ATPase domain-containing protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_002514 PE=4 SV=1	0.94523	1.378	6076.5	0	0	4965.4	0	6076.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4965.4	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XRG1	A0A103XRG1_CYNCS	Agenet-like domain-containing protein	Ccrd_002405	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					FGPSKSK	tr|A0A103XRG1|A0A103XRG1_CYNCS Agenet-like domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_002405 PE=4 SV=1	0.81315	1.378	20904	4302.1	3144.8	0	0	0	0	0	0	0	0	20904	0	0	0	0	0	0	0	0	0	0	4302.1	0	0	0	0	0	0	0	3144.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XRH9	A0A103XRH9_CYNCS	Aspartic peptidase	Ccrd_002385	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		plant-type cell wall [GO:0009505]	plant-type cell wall [GO:0009505]; aspartic-type endopeptidase activity [GO:0004190]	aspartic-type endopeptidase activity [GO:0004190]	AKAVEDR	tr|A0A103XRH9|A0A103XRH9_CYNCS Aspartic peptidase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_002385 PE=3 SV=1	0.94463	1.378	0	0	0	0	8174.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8174.3	0	0	0	0
A0A103XS46	A0A103XS46_CYNCS	Tetratricopeptide-like helical	Ccrd_002043	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					RASYEQR	tr|A0A103XS46|A0A103XS46_CYNCS Tetratricopeptide-like helical OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_002043 PE=4 SV=1	0.81093	1.378	0	0	34846	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34846	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XSI8	A0A103XSI8_CYNCS	Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II	Ccrd_001806	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					VIPCNQR	tr|A0A103XSI8|A0A103XSI8_CYNCS Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_001806 PE=4 SV=1	0.81048	1.378	0	0	21742	24162	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21742	0	0	0	0	0	0	0	24162	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XSR2	A0A103XSR2_CYNCS	YABBY protein (Fragment)	Ccrd_001711	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					GFDGSFT	tr|A0A103XSR2|A0A103XSR2_CYNCS YABBY protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_001711 PE=4 SV=1	0.81002	1.378	25026	0	0	43097	16604	0	9181.9	25026	0	0	0	0	0	9734.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12765	0	0	43097	0	0	0	0	0	10730	0	0	16604	0
A0A103XT46	A0A103XT46_CYNCS	Uncharacterized protein	Ccrd_001488	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		DPPDCDM	tr|A0A103XT46|A0A103XT46_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_001488 PE=4 SV=1	0.80657	1.378	8531.8	10908	0	8968.9	0	0	0	8531.8	7171.8	5890.6	0	0	0	0	0	0	0	10908	0	0	0	8988.7	0	0	0	0	0	0	0	0	0	0	8968.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XUQ1	A0A103XUQ1_CYNCS	"Concanavalin A-like lectin/glucanase, subgroup"	Ccrd_000632	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; polysaccharide binding [GO:0030247]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; polysaccharide binding [GO:0030247]; protein kinase activity [GO:0004672]	DCGGCDR	"tr|A0A103XUQ1|A0A103XUQ1_CYNCS Concanavalin A-like lectin/glucanase, subgroup OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_000632 PE=4 SV=1"	0.80493	1.378	0	11630	0	6692.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11630	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6692.2	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XUY1	A0A103XUY1_CYNCS	"Peptidase S10, serine carboxypeptidase"	Ccrd_000557	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			serine-type carboxypeptidase activity [GO:0004185]	serine-type carboxypeptidase activity [GO:0004185]	SSGFYEM	"tr|A0A103XUY1|A0A103XUY1_CYNCS Peptidase S10, serine carboxypeptidase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_000557 PE=3 SV=1"	0.80502	1.378	4827.1	57913	0	19521	0	0	0	4827.1	0	0	0	0	0	0	57913	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15684	19521	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XVB9	A0A103XVB9_CYNCS	Prohibitin	Ccrd_000319	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		mitochondrial inner membrane [GO:0005743]	mitochondrial inner membrane [GO:0005743]		IVLHRPR	tr|A0A103XVB9|A0A103XVB9_CYNCS Prohibitin OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_000319 PE=3 SV=1	0.80548	1.378	0	4864.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4864.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XVD1	A0A103XVD1_CYNCS	"Heat shock factor (HSF)-type, DNA-binding"	Ccrd_000328	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	NLLRHQR	"tr|A0A103XVD1|A0A103XVD1_CYNCS Heat shock factor (HSF)-type, DNA-binding OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_000328 PE=3 SV=1"	0.80594	1.378	0	0	0	0	4068.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4068.1	0	0	0	0	0	0	0
A0A103XW04	A0A103XW04_CYNCS	Phospholipid-transporting ATPase (EC 7.6.2.1)	Ccrd_023844	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	phospholipid transport [GO:0015914]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase-coupled intramembrane lipid transporter activity [GO:0140326]; magnesium ion binding [GO:0000287]; phospholipid transport [GO:0015914]	ATPase-coupled intramembrane lipid transporter activity [GO:0140326]; ATP binding [GO:0005524]; magnesium ion binding [GO:0000287]	ARIGHAM	tr|A0A103XW04|A0A103XW04_CYNCS Phospholipid-transporting ATPase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_023844 PE=3 SV=1;tr|A0A2U1LFB4|A0A2U1LFB4_ARTAN Phospholipid-transporting ATPase OS=Artemisia annua OX=35608 GN=CTI12_AA500210 PE=3 SV=1;tr	0.80639	1.378	4745.5	0	0	0	0	0	0	0	0	0	0	0	0	4745.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XXV5	A0A103XXV5_CYNCS	Glucose/ribitol dehydrogenase	Ccrd_022895	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			oxidoreductase activity [GO:0016491]	oxidoreductase activity [GO:0016491]	VVTLEIK	tr|A0A103XXV5|A0A103XXV5_CYNCS Glucose/ribitol dehydrogenase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_022895 PE=4 SV=1	0.80648	1.378	0	0	6281.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6281.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XY67	A0A103XY67_CYNCS	Protein-serine/threonine phosphatase (EC 3.1.3.16)	Ccrd_022723	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; metal ion binding [GO:0046872]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]	metal ion binding [GO:0046872]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]	EEAELDK	tr|A0A103XY67|A0A103XY67_CYNCS Protein-serine/threonine phosphatase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_022723 PE=3 SV=1	0.80703	1.378	0	3987.3	9151.4	0	5471.7	0	0	0	0	0	0	0	0	0	0	3987.3	0	0	0	0	0	0	0	0	0	0	7217.8	9151.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5471.7	0	0	0	0	0	0	0
A0A103XYI4	A0A103XYI4_CYNCS	Uncharacterized protein	Ccrd_022487	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	regulation of monopolar cell growth [GO:0051513]		regulation of monopolar cell growth [GO:0051513]		FLGGGGR	tr|A0A103XYI4|A0A103XYI4_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_022487 PE=4 SV=1	0.85714	2.756	2812.2	26922	17067	24286	17314	2812.2	0	0	0	0	0	0	0	0	8558.1	0	18986	0	0	26922	0	0	15336	0	0	15242	0	0	17067	0	5171.3	0	0	0	18590	0	0	21705	24286	0	0	0	0	0	11121	0	0	17314	0	12362
A0A103XZ88	A0A103XZ88_CYNCS	"Dehydrogenase, E1 component"	Ccrd_022133	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			"oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor [GO:0016624]"	"oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor [GO:0016624]"	YLQKPVK	"tr|A0A103XZ88|A0A103XZ88_CYNCS Dehydrogenase, E1 component OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_022133 PE=4 SV=1"	0.80757	1.378	0	0	14472	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14472	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103XZM4	A0A103XZM4_CYNCS	Post-SET domain-containing protein	Ccrd_021941	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			metal ion binding [GO:0046872]; transferase activity [GO:0016740]	metal ion binding [GO:0046872]; transferase activity [GO:0016740]	EHIIDATRK	tr|A0A103XZM4|A0A103XZM4_CYNCS Post-SET domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_021941 PE=4 SV=1;tr|A0A6L2LMR9|A0A6L2LMR9_TANCI Post-SET domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_035094 P	0.89055	1.378	0	3221.3	1789.3	2725.9	0	0	0	0	0	0	0	0	0	0	3221.3	0	0	0	0	0	0	0	0	1789.3	0	0	0	0	0	0	0	0	0	0	0	0	2725.9	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y017	A0A103Y017_CYNCS	Transmembrane protein 194	Ccrd_021732	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]; nuclear inner membrane [GO:0005637]	integral component of membrane [GO:0016021]; nuclear inner membrane [GO:0005637]		NPGNLPR	tr|A0A103Y017|A0A103Y017_CYNCS Transmembrane protein 194 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_021732 PE=3 SV=1	0.80803	1.378	0	25379	0	18544	0	0	0	0	0	0	0	0	0	0	11270	0	14805	0	0	0	25379	0	15027	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18544	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y027	A0A103Y027_CYNCS	Uncharacterized protein	Ccrd_021700	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; protein kinase activity [GO:0004672]	MGITTSK	tr|A0A103Y027|A0A103Y027_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_021700 PE=4 SV=1	0.80848	1.378	0	0	0	10539	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10539	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y031	A0A103Y031_CYNCS	CS domain-containing protein	Ccrd_021728	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					LLLLTLT	tr|A0A103Y031|A0A103Y031_CYNCS CS domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_021728 PE=4 SV=1	0.85626	1.378	0	8370	0	237030	7190.3	0	0	0	0	0	0	0	0	0	0	8370	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	62072	237030	52649	0	0	0	0	0	7190.3	0	0	0
A0A103Y040	A0A103Y040_CYNCS	Double-stranded RNA-binding	Ccrd_021722	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	VNVDDEA	tr|A0A103Y040|A0A103Y040_CYNCS Double-stranded RNA-binding OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_021722 PE=4 SV=1	0.85702	1.378	0	29928	35652	688440	196520	0	0	0	0	0	0	0	0	0	0	0	25478	0	0	0	0	0	29928	0	0	0	0	0	35652	0	0	0	610890	0	688440	0	7426.4	0	438640	0	0	18366	0	0	196520	0	0	0	0	0
A0A103Y082	A0A103Y082_CYNCS	K Homology domain-containing protein	Ccrd_021641	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	GFHPNRK	tr|A0A103Y082|A0A103Y082_CYNCS K Homology domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_021641 PE=4 SV=1	0.80894	1.378	3164400	3223100	2596700	3184400	3407000	0	0	3164400	0	0	0	1113700	0	0	0	0	0	3223100	0	0	0	2206600	0	2596700	0	0	0	0	0	2481300	0	20157	0	2896700	0	0	3184400	0	0	0	0	1886800	0	3407000	0	0	0	0	0	0
A0A103Y0A5	A0A103Y0A5_CYNCS	Uncharacterized protein	Ccrd_021625	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			polysaccharide binding [GO:0030247]	polysaccharide binding [GO:0030247]	SMCGSCR	tr|A0A103Y0A5|A0A103Y0A5_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_021625 PE=4 SV=1	0.80939	1.378	0	17365	0	0	13256	0	0	0	0	0	0	0	0	0	0	17365	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13256	0	0	0	0	0
A0A103Y0F1	A0A103Y0F1_CYNCS	Uncharacterized protein	Ccrd_021484	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					VRPRGLK	tr|A0A103Y0F1|A0A103Y0F1_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_021484 PE=4 SV=1	0.85733	1.378	23634	26107	0	0	0	0	0	0	0	0	0	23634	0	0	0	0	0	0	26107	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y108	A0A103Y108_CYNCS	Armadillo-type fold	Ccrd_021197	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	AKGNTSK	tr|A0A103Y108|A0A103Y108_CYNCS Armadillo-type fold OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_021197 PE=4 SV=1	0.84506	1.378	0	0	0	139000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	139000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y1K8	A0A103Y1K8_CYNCS	AAA+ ATPase domain-containing protein	Ccrd_020896	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	FKISWLR	tr|A0A103Y1K8|A0A103Y1K8_CYNCS AAA+ ATPase domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_020896 PE=4 SV=1	0.84455	1.378	11801	9967.1	0	0	0	0	0	0	0	0	11801	0	0	0	0	0	0	0	0	9967.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y2A3	A0A103Y2A3_CYNCS	Dual specificity phosphatase	Ccrd_020515	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	phosphatidylglycerol biosynthetic process [GO:0006655]		phosphatidylglycerophosphatase activity [GO:0008962]; protein tyrosine phosphatase activity [GO:0004725]; protein tyrosine/serine/threonine phosphatase activity [GO:0008138]; phosphatidylglycerol biosynthetic process [GO:0006655]	phosphatidylglycerophosphatase activity [GO:0008962]; protein tyrosine/serine/threonine phosphatase activity [GO:0008138]; protein tyrosine phosphatase activity [GO:0004725]	LTEAPAC	tr|A0A103Y2A3|A0A103Y2A3_CYNCS Dual specificity phosphatase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_020515 PE=3 SV=1;tr|A0A251V3A1|A0A251V3A1_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr03g0060611 PE=3 SV=1;tr|A0A6	0.89189	1.378	213430	125390	175820	103930	270410	101860	101320	74251	105670	84354	0	213430	159130	93956	0	0	0	74582	125390	0	68457	73694	59859	87901	28117	0	175820	129650	115050	113560	0	64989	86336	103930	0	0	91358	0	0	0	0	270410	0	0	40524	0	70612	0	85863	0
A0A103Y2A8	A0A103Y2A8_CYNCS	Senescence/spartin-associated	Ccrd_020506	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					MSCCGTK	tr|A0A103Y2A8|A0A103Y2A8_CYNCS Senescence/spartin-associated OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_020506 PE=4 SV=1	0.8436	1.378	0	8282.3	0	0	0	0	0	0	0	0	0	0	0	0	8282.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y2G8	A0A103Y2G8_CYNCS	"Alcohol dehydrogenase, C-terminal (Fragment)"	Ccrd_020423	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			oxidoreductase activity [GO:0016491]	oxidoreductase activity [GO:0016491]	IVQVSED	"tr|A0A103Y2G8|A0A103Y2G8_CYNCS Alcohol dehydrogenase, C-terminal (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_020423 PE=4 SV=1"	0.8487	1.378	0	399200	0	0	0	0	0	0	0	0	0	0	0	0	0	399200	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y2K6	A0A103Y2K6_CYNCS	"Extracellular solute-binding protein, family 3"	Ccrd_020372	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ligand-gated ion channel activity [GO:0015276]	ligand-gated ion channel activity [GO:0015276]	YGSDYMK	"tr|A0A103Y2K6|A0A103Y2K6_CYNCS Extracellular solute-binding protein, family 3 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_020372 PE=4 SV=1;tr|A0A251TSD5|A0A251TSD5_HELAN Putative ionotropic glutamate receptor, metazoa OS=Helianthus annuus OX=4232 "	0.9451	1.378	0	0	0	5663.9	4549	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5663.9	0	0	0	0	0	0	0	0	0	4549	0	0	0	0	0	0
A0A103Y2P1	A0A103Y2P1_CYNCS	Uncharacterized protein	Ccrd_020295	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					GACCSCR	tr|A0A103Y2P1|A0A103Y2P1_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_020295 PE=4 SV=1	0.84819	1.378	0	0	0	57184	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	57184	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y2R3	A0A103Y2R3_CYNCS	Uncharacterized protein (Fragment)	Ccrd_020292	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					LMASYVQ	tr|A0A103Y2R3|A0A103Y2R3_CYNCS Uncharacterized protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_020292 PE=4 SV=1	0.8485	1.378	7298.4	0	7382.2	0	0	0	0	0	0	0	7298.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7382.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y2S8	A0A103Y2S8_CYNCS	Cytochrome P450	Ccrd_020265	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	YSSNVFK	tr|A0A103Y2S8|A0A103Y2S8_CYNCS Cytochrome P450 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_020265 PE=3 SV=1;sp|I7C6E8|C7A52_PANGI Beta-amyrin 28-monooxygenase OS=Panax ginseng OX=4054 GN=CYP716A52v2 PE=1 SV=1;tr|F4YF72|F4YF72_9APIA Cytochrome P450	0.93588	1.378	0	0	0	15882	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9208.7	15882	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y381	A0A103Y381_CYNCS	"Protein phosphatase 2A, regulatory subunit PR55"	Ccrd_020028	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		protein phosphatase type 2A complex [GO:0000159]	protein phosphatase type 2A complex [GO:0000159]; protein phosphatase regulator activity [GO:0019888]	protein phosphatase regulator activity [GO:0019888]	ACSANGA	"tr|A0A103Y381|A0A103Y381_CYNCS Protein phosphatase 2A, regulatory subunit PR55 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_020028 PE=4 SV=1"	0.84792	1.378	10912	12570	12458	18647	9735.7	6750	10912	10051	0	0	0	0	0	0	12570	0	0	0	0	0	0	0	0	12458	0	0	0	0	0	0	0	0	0	0	0	7541.8	18647	0	0	0	0	0	0	0	0	5529.5	0	9735.7	0	0
A0A103Y3G3	A0A103Y3G3_CYNCS	"Zinc finger, RING/FYVE/PHD-type"	Ccrd_019906	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	ACVPCVK	"tr|A0A103Y3G3|A0A103Y3G3_CYNCS Zinc finger, RING/FYVE/PHD-type OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_019906 PE=4 SV=1"	0.80311	1.378	0	0	19778	0	16337	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19778	0	0	0	0	0	0	0	0	0	0	0	0	0	16337	8531.8	0	0	0	0	0	0	0
A0A103Y3H5	A0A103Y3H5_CYNCS	Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase)	Ccrd_019863	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	carbon utilization [GO:0015976]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; carbonate dehydratase activity [GO:0004089]; zinc ion binding [GO:0008270]; carbon utilization [GO:0015976]	carbonate dehydratase activity [GO:0004089]; zinc ion binding [GO:0008270]	KPVKLPK	tr|A0A103Y3H5|A0A103Y3H5_CYNCS Carbonic anhydrase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_019863 PE=3 SV=1	0.78901	1.378	21061	170720	48668	40477	106990	7150.2	3084.4	5153.9	0	0	21061	0	10182	0	38489	0	75741	0	0	170720	86913	0	0	17035	34736	48668	0	0	45241	0	0	0	0	0	22061	0	40477	35156	5412	12529	13951	106990	27613	0	0	3547.7	2884.8	0	30167	0
A0A103Y452	A0A103Y452_CYNCS	"Zinc finger, C2H2"	Ccrd_019453	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					RALMVCR	"tr|A0A103Y452|A0A103Y452_CYNCS Zinc finger, C2H2 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_019453 PE=4 SV=1"	0.86667	1.378	0	16627	21740	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16627	0	0	0	0	0	21740	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y458	A0A103Y458_CYNCS	Basic-leucine zipper domain-containing protein	Ccrd_019527	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			DNA-binding transcription factor activity [GO:0003700]	DNA-binding transcription factor activity [GO:0003700]	MAQLPPK	tr|A0A103Y458|A0A103Y458_CYNCS Basic-leucine zipper domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_019527 PE=4 SV=1;tr|A0A251V6Z9|A0A251V6Z9_HELAN Putative basic-leucine zipper domain-containing protein OS=Helianthus annuus 	0.86704	1.378	0	13683	14129	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13683	0	0	0	0	0	0	14129	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y4B3	A0A103Y4B3_CYNCS	t-SNARE coiled-coil homology domain-containing protein	Ccrd_019408	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	protein transport [GO:0015031]; vesicle-mediated transport [GO:0016192]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; protein transport [GO:0015031]; vesicle-mediated transport [GO:0016192]		PADAMSR	tr|A0A103Y4B3|A0A103Y4B3_CYNCS t-SNARE coiled-coil homology domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_019408 PE=3 SV=1;tr|A0A2U1Q0D5|A0A2U1Q0D5_ARTAN Syntaxin of plants 52 OS=Artemisia annua OX=35608 GN=CTI12_AA028230 P	0.86687	1.378	0	0	223200	0	206880	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	223200	0	0	0	0	0	0	0	0	0	0	206880	0	0	0	0	0	0	0	0
A0A103Y4G7	A0A103Y4G7_CYNCS	Leucine-rich repeat-containing protein	Ccrd_019397	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					RALLIRR	tr|A0A103Y4G7|A0A103Y4G7_CYNCS Leucine-rich repeat-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_019397 PE=4 SV=1	0.78328	1.378	0	0	0	13138	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13138	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y548	A0A103Y548_CYNCS	BTB/POZ fold	Ccrd_018999	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	protein ubiquitination [GO:0016567]		protein ubiquitination [GO:0016567]		GFELAAK	tr|A0A103Y548|A0A103Y548_CYNCS BTB/POZ fold OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_018999 PE=3 SV=1	0.8693	1.378	0	0	28682	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28682	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y5B7	A0A103Y5B7_CYNCS	K Homology domain-containing protein	Ccrd_018910	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	GNLDVET	tr|A0A103Y5B7|A0A103Y5B7_CYNCS K Homology domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_018910 PE=4 SV=1	0.86919	1.378	0	354000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	354000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y5D8	A0A103Y5D8_CYNCS	CRAL-TRIO domain-containing protein	Ccrd_018868	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					IFQAFYK	tr|A0A103Y5D8|A0A103Y5D8_CYNCS CRAL-TRIO domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_018868 PE=4 SV=1	0.86913	1.378	0	20554	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20554	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y5Y4	A0A103Y5Y4_CYNCS	Cytochrome P450	Ccrd_018609	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	KALKVPK	tr|A0A103Y5Y4|A0A103Y5Y4_CYNCS Cytochrome P450 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_018609 PE=3 SV=1	0.78348	1.378	12686	18462	0	9581.9	0	0	0	0	10078	8794.9	0	0	12686	6226.1	0	0	0	0	0	0	0	0	18462	0	0	0	0	0	0	0	0	0	0	4037.5	0	9581.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y632	A0A103Y632_CYNCS	Pentatricopeptide repeat-containing protein	Ccrd_018502	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					PTGELVK	tr|A0A103Y632|A0A103Y632_CYNCS Pentatricopeptide repeat-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_018502 PE=4 SV=1	0.78395	1.378	1781.5	1097.6	0	1280.6	0	0	0	0	0	0	0	0	0	1781.5	0	0	1097.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1280.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y6L3	A0A103Y6L3_CYNCS	Methyltransferase (EC 2.1.1.-)	Ccrd_018230	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	methylation [GO:0032259]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; methyltransferase activity [GO:0008168]; methylation [GO:0032259]	methyltransferase activity [GO:0008168]	LHPIPPK	tr|A0A103Y6L3|A0A103Y6L3_CYNCS Methyltransferase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_018230 PE=3 SV=1	0.78441	1.378	414960	526490	382220	429440	273780	12812	0	414960	0	0	0	0	0	0	25388	0	0	25690	0	0	526490	0	0	0	0	361110	382220	0	0	0	368020	313630	0	0	0	0	429440	0	0	0	0	0	0	273780	0	0	0	0	0	0
A0A103Y6M4	A0A103Y6M4_CYNCS	Pentatricopeptide repeat-containing protein	Ccrd_018218	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					SSVDVSK	tr|A0A103Y6M4|A0A103Y6M4_CYNCS Pentatricopeptide repeat-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_018218 PE=4 SV=1	0.86713	1.378	46206	8292	32924	47205	69548	8631.6	0	38125	0	0	0	0	0	46206	8292	0	0	0	0	0	0	0	0	32924	0	0	0	0	0	0	0	0	47205	0	0	0	0	0	0	0	0	0	0	0	0	0	39521	69548	0	0
A0A103Y6S3	A0A103Y6S3_CYNCS	Tetratricopeptide-like helical (Fragment)	Ccrd_018152	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	positive regulation of catalase activity [GO:1902553]	cytosol [GO:0005829]; nucleus [GO:0005634]	cytosol [GO:0005829]; nucleus [GO:0005634]; positive regulation of catalase activity [GO:1902553]		SSSVDDR	tr|A0A103Y6S3|A0A103Y6S3_CYNCS Tetratricopeptide-like helical (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_018152 PE=4 SV=1	0.78488	1.378	0	31907	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31907	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y7I5	A0A103Y7I5_CYNCS	"Protein kinase, ATP binding site-containing protein (Fragment)"	Ccrd_017758	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	AFLEEYK	"tr|A0A103Y7I5|A0A103Y7I5_CYNCS Protein kinase, ATP binding site-containing protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_017758 PE=3 SV=1"	0.78581	1.378	0	0	0	11160	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11160	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y7J2	A0A103Y7J2_CYNCS	Hexosyltransferase (EC 2.4.1.-)	Ccrd_017753	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			glycosyltransferase activity [GO:0016757]	glycosyltransferase activity [GO:0016757]	SSKHIFD	tr|A0A103Y7J2|A0A103Y7J2_CYNCS Hexosyltransferase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_017753 PE=3 SV=1	0.85971	1.378	0	0	17032	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15706	0	0	0	0	0	17032	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y7N3	A0A103Y7N3_CYNCS	Nnf1 (Fragment)	Ccrd_017669	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	cell cycle [GO:0007049]; cell division [GO:0051301]	nuclear MIS12/MIND complex [GO:0000818]	nuclear MIS12/MIND complex [GO:0000818]; cell cycle [GO:0007049]; cell division [GO:0051301]		NAGMLNQ	tr|A0A103Y7N3|A0A103Y7N3_CYNCS Nnf1 (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_017669 PE=4 SV=1	0.90638	1.378	32665	0	6942.9	0	8084.1	7062.7	18999	0	21243	0	0	0	32665	18554	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6942.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8084.1	0	7255.2	0
A0A103Y7Z4	A0A103Y7Z4_CYNCS	"F-box domain, cyclin-like protein"	Ccrd_017502	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	carpel development [GO:0048440]; stamen development [GO:0048443]; vegetative to reproductive phase transition of meristem [GO:0010228]	membrane [GO:0016020]	membrane [GO:0016020]; histone methyltransferase activity (H3-K4 specific) [GO:0042800]; carpel development [GO:0048440]; stamen development [GO:0048443]; vegetative to reproductive phase transition of meristem [GO:0010228]	histone methyltransferase activity (H3-K4 specific) [GO:0042800]	LELLPPK	"tr|A0A103Y7Z4|A0A103Y7Z4_CYNCS F-box domain, cyclin-like protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_017502 PE=4 SV=1"	0.78628	1.378	0	0	0	48216	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	48216	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y8B4	A0A103Y8B4_CYNCS	Uncharacterized protein	Ccrd_017298	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					SSTTTIK	tr|A0A103Y8B4|A0A103Y8B4_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_017298 PE=4 SV=1	0.85909	1.378	0	0	7375	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7375	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103Y8L1	A0A103Y8L1_CYNCS	Leucine-rich repeat-containing protein	Ccrd_017162	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	RPCHHNM	tr|A0A103Y8L1|A0A103Y8L1_CYNCS Leucine-rich repeat-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_017162 PE=3 SV=1	0.78685	1.378	31775	33879	18712	29917	29777	0	0	0	31775	26022	0	0	0	25699	0	0	0	0	33879	0	0	0	0	0	0	0	0	0	0	0	18712	0	29917	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29777
A0A103Y9P5	A0A103Y9P5_CYNCS	Ran GTPase	Ccrd_016601	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	HTNCCTL	tr|A0A103Y9P5|A0A103Y9P5_CYNCS Ran GTPase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_016601 PE=4 SV=1	0.86334	1.378	0	25163	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25163	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103YBA4	A0A103YBA4_CYNCS	Homeodomain-containing protein (Fragment)	Ccrd_015714	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; lipid binding [GO:0008289]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; lipid binding [GO:0008289]	MMAMSLK	tr|A0A103YBA4|A0A103YBA4_CYNCS Homeodomain-containing protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_015714 PE=3 SV=1	0.82552	1.378	78688	0	0	46672	0	0	0	0	78688	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	46672	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103YBM6	A0A103YBM6_CYNCS	Ribonuclease	Ccrd_015547	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	gene silencing by RNA [GO:0031047]	cytoplasm [GO:0005737]; RISC complex [GO:0016442]	cytoplasm [GO:0005737]; RISC complex [GO:0016442]; nuclease activity [GO:0004518]; gene silencing by RNA [GO:0031047]	nuclease activity [GO:0004518]	DFLPFLQRNRR	tr|A0A103YBM6|A0A103YBM6_CYNCS Ribonuclease OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_015547 PE=4 SV=1	0.82536	1.378	0	0	3288.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3288.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103YBP3	A0A103YBP3_CYNCS	Uncharacterized protein	Ccrd_015544	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		KNYASTK	tr|A0A103YBP3|A0A103YBP3_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_015544 PE=4 SV=1	0.82573	1.378	13258	13427	2007200	1138900	6883.6	9511.3	8880.3	12574	0	0	0	0	13258	0	9343.6	0	11274	13427	0	0	0	0	0	6616.7	0	0	0	0	2007200	0	326760	14762	0	11689	1138900	0	0	0	0	0	0	0	0	0	0	6883.6	0	0	0	0
A0A103YC24	A0A103YC24_CYNCS	Homeodomain-like protein	Ccrd_015286	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]	DNA binding [GO:0003677]	ATCMSYK	tr|A0A103YC24|A0A103YC24_CYNCS Homeodomain-like protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_015286 PE=4 SV=1	0.82538	1.378	17327	15865	14659	150240	0	0	0	0	15602	16705	0	0	0	17327	0	0	0	0	15865	0	0	0	0	0	0	0	0	0	0	0	14659	0	150240	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103YCY6	A0A103YCY6_CYNCS	UDP-glucuronosyl/UDP-glucosyltransferase	Ccrd_014840	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		cytosol [GO:0005829]	cytosol [GO:0005829]; UDP-glycosyltransferase activity [GO:0008194]	UDP-glycosyltransferase activity [GO:0008194]	LPKIPPK	tr|A0A103YCY6|A0A103YCY6_CYNCS UDP-glucuronosyl/UDP-glucosyltransferase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_014840 PE=4 SV=1	0.83929	1.4072	52668000	79683000	38477000	46453000	42245000	42746000	528520	35635000	45428000	46203000	32732000	52668000	48395000	41652000	31927000	34640000	79683000	51449000	55681000	47769000	42944000	37569000	50337000	36841000	26859000	31080000	38477000	35185000	34739000	37936000	30591000	806750	35874000	35350000	38951000	35560000	40882000	46453000	40775000	32650000	31827000	42245000	41642000	39713000	29359000	29659000	36249000	36524000	36712000	29805000
A0A103YD35	A0A103YD35_CYNCS	Aspartic peptidase	Ccrd_014762	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			aspartic-type endopeptidase activity [GO:0004190]	aspartic-type endopeptidase activity [GO:0004190]	SMSAGGM	tr|A0A103YD35|A0A103YD35_CYNCS Aspartic peptidase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_014762 PE=4 SV=1	0.78695	1.378	52003	19413	0	0	4609.4	0	0	0	0	6387.5	0	52003	0	14490	0	0	0	15434	0	0	0	0	19413	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4609.4	0	0	0	0	0	0
A0A103YDB6	A0A103YDB6_CYNCS	Chloramphenicol acetyltransferase-like domain-containing protein	Ccrd_014640	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	VPGGAPR	tr|A0A103YDB6|A0A103YDB6_CYNCS Chloramphenicol acetyltransferase-like domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_014640 PE=3 SV=1;tr|A0A5N6NDN9|A0A5N6NDN9_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E	0.78741	1.378	19433	0	21936	22210	15456	18238	0	0	0	0	0	0	19433	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17466	21936	17364	0	0	0	0	0	0	0	22210	0	0	11827	0	15456	0	0	0	0
A0A103YDE9	A0A103YDE9_CYNCS	Nucleoside phosphatase GDA1/CD39	Ccrd_014598	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; hydrolase activity [GO:0016787]	ATP binding [GO:0005524]; hydrolase activity [GO:0016787]	ARLYNYR	tr|A0A103YDE9|A0A103YDE9_CYNCS Nucleoside phosphatase GDA1/CD39 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_014598 PE=3 SV=1	0.82533	1.378	0	0	20181	17897	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20181	0	0	0	0	0	0	17897	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103YDF6	A0A103YDF6_CYNCS	"Zinc finger, RING/FYVE/PHD-type"	Ccrd_014581	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SGDGGGG	"tr|A0A103YDF6|A0A103YDF6_CYNCS Zinc finger, RING/FYVE/PHD-type OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_014581 PE=4 SV=1"	0.8257	1.378	22295	0	0	0	13653	0	22295	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13653	0	0	0	0	11257	0
A0A103YDJ3	A0A103YDJ3_CYNCS	CAAD domain-containing protein	Ccrd_014529	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]; thylakoid [GO:0009579]	integral component of membrane [GO:0016021]; thylakoid [GO:0009579]		KKIIGTE	tr|A0A103YDJ3|A0A103YDJ3_CYNCS CAAD domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_014529 PE=4 SV=1	0.82599	1.378	0	0	0	11197	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11197	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103YDN8	A0A103YDN8_CYNCS	Uncharacterized protein	Ccrd_014461	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					RASKNLK	tr|A0A103YDN8|A0A103YDN8_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_014461 PE=4 SV=1;tr|A0A6L2P0U8|A0A6L2P0U8_TANCI Putative ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci	0.78751	1.378	63367	122410	56845	72697	43369	0	40168	0	0	0	0	55314	0	63367	0	0	0	38725	0	0	0	101510	122410	0	0	0	0	0	0	56845	0	0	0	37882	0	64261	72697	0	0	62044	0	0	0	0	0	43369	0	0	32602	0
A0A103YE53	A0A103YE53_CYNCS	Ethylene receptor	Ccrd_014245	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ethylene binding [GO:0051740]; ethylene receptor activity [GO:0038199]; metal ion binding [GO:0046872]; phosphorelay sensor kinase activity [GO:0000155]	ATP binding [GO:0005524]; ethylene binding [GO:0051740]; ethylene receptor activity [GO:0038199]; metal ion binding [GO:0046872]; phosphorelay sensor kinase activity [GO:0000155]	RPMGHSMK	tr|A0A103YE53|A0A103YE53_CYNCS Ethylene receptor OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_014245 PE=3 SV=1;tr|A0A5N6N9L8|A0A5N6N9L8_9ASTR Ethylene receptor OS=Mikania micrantha OX=192012 GN=E3N88_21598 PE=3 SV=1;tr|A0A251USZ5|A0A251USZ5_HELAN E	0.79487	2.3966	8819.8	0	14654	0	7964	0	0	0	0	0	8819.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14654	6175.1	0	0	0	0	0	0	0	0	0	0	0	0	7964	7148.9	0	0	0	0	0	0	0
A0A103YER1	A0A103YER1_CYNCS	DNA/RNA-binding protein Alba-like protein	Ccrd_013886	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	TTGDCDM	tr|A0A103YER1|A0A103YER1_CYNCS DNA/RNA-binding protein Alba-like protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_013886 PE=4 SV=1	0.78844	1.378	27046	115020	196910	83328	83607	0	0	27046	0	0	0	0	0	0	0	0	0	34336	115020	0	0	72560	0	0	0	0	0	0	94096	196910	65634	88549	0	0	0	83328	0	0	0	55192	0	55420	60510	0	24441	0	19651	59095	83607	0
A0A103YF31	A0A103YF31_CYNCS	Uncharacterized protein	Ccrd_013711	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					VVLIHLK	tr|A0A103YF31|A0A103YF31_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_013711 PE=4 SV=1	0.78318	1.378	26656	25251	21024	0	0	0	0	0	26656	0	0	0	0	0	0	0	0	0	25251	0	0	0	0	0	0	0	0	0	0	21024	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103YGI8	A0A103YGI8_CYNCS	Band 4.1 domain-containing protein	Ccrd_012925	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	microtubule-based movement [GO:0007018]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]; microtubule-based movement [GO:0007018]	ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]	ADNRHSM	tr|A0A103YGI8|A0A103YGI8_CYNCS Band 4.1 domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_012925 PE=3 SV=1	0.82788	1.378	3370.7	3838	0	10248	0	0	0	0	0	0	0	3370.7	0	0	0	0	0	0	0	0	0	3838	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10248	0	0	0	0	0	0	0	0	0
A0A103YGS2	A0A103YGS2_CYNCS	Forkhead-associated (FHA) domain-containing protein	Ccrd_012829	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		Ino80 complex [GO:0031011]; MLL1 complex [GO:0071339]	Ino80 complex [GO:0031011]; MLL1 complex [GO:0071339]; G-quadruplex RNA binding [GO:0002151]	G-quadruplex RNA binding [GO:0002151]	AIYHMLR	tr|A0A103YGS2|A0A103YGS2_CYNCS Forkhead-associated (FHA) domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_012829 PE=4 SV=1	0.78308	1.378	0	30876	17111	22746	0	0	0	0	0	0	0	0	0	0	0	11019	0	0	0	30876	0	0	0	0	0	17111	0	0	0	0	0	0	0	0	0	0	19818	22746	0	16173	0	0	0	0	0	0	0	0	0	0
A0A103YHK7	A0A103YHK7_CYNCS	Ribosomal protein S21	Ccrd_012398	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	translation [GO:0006412]	ribosome [GO:0005840]	ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	ASPQPPK	tr|A0A103YHK7|A0A103YHK7_CYNCS Ribosomal protein S21 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_012398 PE=3 SV=1	0.78116	1.378	0	0	0	0	11385	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11385	0	0	0	0	0	0
A0A103YHY1	A0A103YHY1_CYNCS	Sucrose-phosphatase (EC 3.1.3.24)	Ccrd_012160	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	sucrose biosynthetic process [GO:0005986]		magnesium ion binding [GO:0000287]; sucrose-phosphate phosphatase activity [GO:0050307]; sucrose biosynthetic process [GO:0005986]	magnesium ion binding [GO:0000287]; sucrose-phosphate phosphatase activity [GO:0050307]	DCSGDKK	tr|A0A103YHY1|A0A103YHY1_CYNCS Sucrose-phosphatase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_012160 PE=3 SV=1	0.83608	1.378	0	0	53213	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	53213	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103YIG4	A0A103YIG4_CYNCS	EEIG1/EHBP1 N-terminal domain-containing protein	Ccrd_011942	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					ESCSPNR	tr|A0A103YIG4|A0A103YIG4_CYNCS EEIG1/EHBP1 N-terminal domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011942 PE=4 SV=1	0.83556	1.378	10953	12965	15568	8758.6	6748	0	0	0	0	0	10953	0	0	0	0	0	0	0	0	12965	0	0	0	0	0	0	0	15568	0	0	0	0	0	0	8758.6	0	0	0	0	0	0	6748	0	0	0	0	0	0	0	0
A0A103YIH0	A0A103YIH0_CYNCS	Dual specificity phosphatase	Ccrd_011832	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			protein tyrosine phosphatase activity [GO:0004725]; protein tyrosine/serine/threonine phosphatase activity [GO:0008138]	protein tyrosine/serine/threonine phosphatase activity [GO:0008138]; protein tyrosine phosphatase activity [GO:0004725]	SSAFVFK	tr|A0A103YIH0|A0A103YIH0_CYNCS Dual specificity phosphatase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011832 PE=4 SV=1	0.77778	1.378	161350	216050	0	123450	23270	0	0	161350	0	0	0	0	0	0	0	0	0	0	0	0	216050	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	123450	0	0	0	0	0	0	0	0	0	23270	0	0	0
A0A103YII3	A0A103YII3_CYNCS	Homeodomain-like protein	Ccrd_011874	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]	DNA binding [GO:0003677]	CAEMNER	tr|A0A103YII3|A0A103YII3_CYNCS Homeodomain-like protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011874 PE=4 SV=1;tr|A0A251SYS8|A0A251SYS8_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr12g0357391 PE=4 SV=1;tr|A0A251T6	0.8169	2.0968	0	16738	0	0	7833.9	0	0	0	0	0	0	0	0	0	0	16738	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7833.9	0	0	0
A0A103YIJ2	A0A103YIJ2_CYNCS	Actin-related protein 2/3 complex subunit 5	Ccrd_011901	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	Arp2/3 complex-mediated actin nucleation [GO:0034314]	Arp2/3 protein complex [GO:0005885]; cytoplasm [GO:0005737]	Arp2/3 protein complex [GO:0005885]; cytoplasm [GO:0005737]; Arp2/3 complex-mediated actin nucleation [GO:0034314]		AREDCAK	tr|A0A103YIJ2|A0A103YIJ2_CYNCS Actin-related protein 2/3 complex subunit 5 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011901 PE=3 SV=1	0.84061	1.378	0	25786	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25786	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103YIP0	A0A103YIP0_CYNCS	Mannose-binding lectin	Ccrd_011818	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			ATP binding [GO:0005524]; carbohydrate binding [GO:0030246]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; carbohydrate binding [GO:0030246]; protein serine/threonine kinase activity [GO:0004674]	SYIKRYR	tr|A0A103YIP0|A0A103YIP0_CYNCS Mannose-binding lectin OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011818 PE=3 SV=1	0.84023	1.378	0	0	0	0	14054	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14054	0	0	0	0	0	0
A0A103YIP9	A0A103YIP9_CYNCS	"Protein kinase, ATP binding site-containing protein"	Ccrd_011829	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	RDMSDAL	"tr|A0A103YIP9|A0A103YIP9_CYNCS Protein kinase, ATP binding site-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011829 PE=3 SV=1"	0.83986	1.378	34734	23005	44912	17379	19315	34734	0	16816	13288	0	0	0	0	0	0	0	0	0	23005	0	0	0	0	0	25423	0	0	0	0	14546	44912	8970.8	0	17379	0	0	12258	0	0	0	0	0	0	0	0	0	0	0	19315	0
A0A103YJ41	A0A103YJ41_CYNCS	Uncharacterized protein	Ccrd_011610	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					KSSSRYK	tr|A0A103YJ41|A0A103YJ41_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011610 PE=4 SV=1	0.77825	1.378	3164400	12896	0	0	0	0	0	3164400	0	0	0	0	0	0	0	0	0	12896	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103YJA6	A0A103YJA6_CYNCS	J domain-containing protein	Ccrd_011405	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					LAYNHRR	tr|A0A103YJA6|A0A103YJA6_CYNCS J domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011405 PE=4 SV=1	0.84028	1.378	13330	14360	0	11165	0	0	0	0	0	0	0	10999	0	13330	0	0	0	0	14360	0	0	0	0	0	0	0	0	0	0	0	0	0	11165	0	0	8512.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103YJL7	A0A103YJL7_CYNCS	Uncharacterized protein	Ccrd_011296	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					DSCPGWK	tr|A0A103YJL7|A0A103YJL7_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011296 PE=4 SV=1	0.77918	1.378	0	13901	20594	17245	10489	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13901	0	0	0	0	0	7577.9	16771	20594	0	0	0	0	0	0	17245	0	0	0	7689.3	0	0	0	0	0	10489	0	0	0	0	0
A0A103YJQ3	A0A103YJQ3_CYNCS	SWAP/Surp	Ccrd_011290	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	RNA processing [GO:0006396]		RNA binding [GO:0003723]; RNA processing [GO:0006396]	RNA binding [GO:0003723]	NIIPADK	tr|A0A103YJQ3|A0A103YJQ3_CYNCS SWAP/Surp OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011290 PE=4 SV=1	0.77965	1.378	0	8007.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5871.4	8007.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103YJW9	A0A103YJW9_CYNCS	40S ribosomal protein S8	Ccrd_011182	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	translation [GO:0006412]	ribosome [GO:0005840]	ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	GKSAGAA	tr|A0A103YJW9|A0A103YJW9_CYNCS 40S ribosomal protein S8 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011182 PE=3 SV=1	0.84014	1.378	0	6946	9456.6	16274	14837	0	0	0	0	0	0	0	0	0	6946	0	0	0	0	0	0	0	0	0	0	0	0	0	9456.6	0	0	0	0	0	0	0	8297.5	0	0	16274	8047.5	10289	14837	0	0	0	2752.9	0	0	0
A0A103YKP2	A0A103YKP2_CYNCS	DnaJ domain-containing protein	Ccrd_010673	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	defense response [GO:0006952]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; defense response [GO:0006952]		GGDEDHK	tr|A0A103YKP2|A0A103YKP2_CYNCS DnaJ domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_010673 PE=4 SV=1	0.78069	1.378	4174.9	0	0	0	0	0	0	0	0	4174.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103YKU7	A0A103YKU7_CYNCS	"Zinc finger, RING/FYVE/PHD-type (Fragment)"	Ccrd_010601	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					MSLRPRR	"tr|A0A103YKU7|A0A103YKU7_CYNCS Zinc finger, RING/FYVE/PHD-type (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_010601 PE=4 SV=1"	0.82842	1.378	0	0	6525.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6525.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103YLI7	A0A103YLI7_CYNCS	Photosystem I PsaA/PsaB	Ccrd_010284	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	photosynthesis [GO:0015979]	integral component of membrane [GO:0016021]; plastid [GO:0009536]; thylakoid [GO:0009579]	integral component of membrane [GO:0016021]; plastid [GO:0009536]; thylakoid [GO:0009579]; photosynthesis [GO:0015979]		KPGAVGR	tr|A0A103YLI7|A0A103YLI7_CYNCS Photosystem I PsaA/PsaB OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_010284 PE=4 SV=1	0.82729	1.378	0	0	0	17272	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17272	0	0	0	0	0	0	0	0	0	0	0
A0A103YLI9	A0A103YLI9_CYNCS	"Protein kinase, catalytic domain-containing protein"	Ccrd_010215	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	NLLHCSR	"tr|A0A103YLI9|A0A103YLI9_CYNCS Protein kinase, catalytic domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_010215 PE=4 SV=1;tr|A0A6S7PM61|A0A6S7PM61_LACSI Non-specific serine/threonine protein kinase OS=Lactuca saligna OX=75948"	0.82766	1.378	24642	40784	60397	30058	30104	0	0	0	0	0	24642	0	0	0	0	14620	0	0	0	40784	21432	0	0	0	0	14770	60397	17933	17035	0	0	0	0	0	29897	0	6484.9	7925.9	30058	0	0	30104	20884	0	0	0	23401	0	0	0
A0A103YMK3	A0A103YMK3_CYNCS	Chlorophyllase (EC 3.1.1.14)	Ccrd_009801	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	chlorophyll catabolic process [GO:0015996]		chlorophyllase activity [GO:0047746]; pheophytinase b activity [GO:0102293]; chlorophyll catabolic process [GO:0015996]	chlorophyllase activity [GO:0047746]; pheophytinase b activity [GO:0102293]	NCMCNAK	tr|A0A103YMK3|A0A103YMK3_CYNCS Chlorophyllase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_009801 PE=3 SV=1	0.78126	1.378	0	0	0	15912	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15912	0	0	0	0	0	0	0	0	0
A0A103YMS6	A0A103YMS6_CYNCS	"Argonaute/Dicer protein, PAZ (Fragment)"	Ccrd_009704	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	gene silencing by RNA [GO:0031047]; RNA processing [GO:0006396]		ATP binding [GO:0005524]; helicase activity [GO:0004386]; ribonuclease III activity [GO:0004525]; RNA binding [GO:0003723]; gene silencing by RNA [GO:0031047]; RNA processing [GO:0006396]	ATP binding [GO:0005524]; helicase activity [GO:0004386]; ribonuclease III activity [GO:0004525]; RNA binding [GO:0003723]	GCGGDGR	"tr|A0A103YMS6|A0A103YMS6_CYNCS Argonaute/Dicer protein, PAZ (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_009704 PE=4 SV=1"	0.78173	1.378	7244.4	0	4153.6	0	0	7244.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4153.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103YMV4	A0A103YMV4_CYNCS	"Protein kinase, catalytic domain-containing protein"	Ccrd_009549	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			ATP binding [GO:0005524]; protein tyrosine kinase activity [GO:0004713]	ATP binding [GO:0005524]; protein tyrosine kinase activity [GO:0004713]	KECCCQM	"tr|A0A103YMV4|A0A103YMV4_CYNCS Protein kinase, catalytic domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_009549 PE=4 SV=1"	0.7822	1.378	0	0	11217	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11217	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A103YMZ5	A0A103YMZ5_CYNCS	Calcium-binding EF-hand	Ccrd_009579	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	"integral component of membrane [GO:0016021]; calcium ion binding [GO:0005509]; oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor [GO:0050664]; peroxidase activity [GO:0004601]"	"calcium ion binding [GO:0005509]; oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor [GO:0050664]; peroxidase activity [GO:0004601]"	DSGFDHK	tr|A0A103YMZ5|A0A103YMZ5_CYNCS Calcium-binding EF-hand OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_009579 PE=3 SV=1	0.83274	1.378	0	0	0	26081	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26081	0	0	0	0	0	0	0	0	0	0	0	0
A0A118HQX0	A0A118HQX0_CYNCS	Uncharacterized protein	Ccrd_026284	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					GGGGEEK	tr|A0A118HQX0|A0A118HQX0_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_026284 PE=4 SV=1	0.78241	1.378	0	40366	0	40783	9465.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	40366	0	0	0	0	0	0	0	0	0	40783	0	0	0	0	0	0	0	0	0	0	9465.4	0	0	0	0	0	0
A0A118JLN6	A0A118JLN6_CYNCS	Protein kinase-like domain-containing protein (Fragment)	Ccrd_025506	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			kinase activity [GO:0016301]	kinase activity [GO:0016301]	ADEHADQ	tr|A0A118JLN6|A0A118JLN6_CYNCS Protein kinase-like domain-containing protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_025506 PE=4 SV=1	0.83036	1.378	51792	0	0	0	0	0	0	51792	0	0	0	0	16812	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118JS43	A0A118JS43_CYNCS	Protein FAR1-RELATED SEQUENCE	Ccrd_024443	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	"regulation of transcription, DNA-templated [GO:0006355]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; zinc ion binding [GO:0008270]; regulation of transcription, DNA-templated [GO:0006355]"	zinc ion binding [GO:0008270]	KASIFTP	tr|A0A118JS43|A0A118JS43_CYNCS Protein FAR1-RELATED SEQUENCE OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_024443 PE=3 SV=1	0.84176	1.378	31069	0	0	0	0	0	0	0	0	31069	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118JSB4	A0A118JSB4_CYNCS	Uncharacterized protein	Ccrd_024840	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					ARQESSA	tr|A0A118JSB4|A0A118JSB4_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_024840 PE=4 SV=1	0.90156	1.378	0	59593	0	0	0	0	0	0	0	0	0	0	0	0	0	59593	0	0	0	0	0	48877	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118JSR4	A0A118JSR4_CYNCS	Uncharacterized protein	Ccrd_008345	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					TTLKLRR	tr|A0A118JSR4|A0A118JSR4_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_008345 PE=4 SV=1	0.90101	1.378	2831	4388.3	0	2888.9	18488	0	0	0	0	0	0	0	2831	0	1988.1	3427.1	0	0	0	4388.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2888.9	1454.1	0	0	0	18488	0	0	0	0	0	0	0	0
A0A118JTD0	A0A118JTD0_CYNCS	PMR5N domain-containing protein (Fragment)	Ccrd_008524	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					CQSGFGM	tr|A0A118JTD0|A0A118JTD0_CYNCS PMR5N domain-containing protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_008524 PE=3 SV=1	0.78854	1.378	6041.1	5559.8	0	0	9200.6	0	0	0	0	0	0	6041.1	0	0	0	0	0	0	0	0	0	5559.8	4577.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9200.6	0	0	0	0	0	0	0	0
A0A118JTJ0	A0A118JTJ0_CYNCS	Uncharacterized protein	Ccrd_008043	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					NSSPNAR	tr|A0A118JTJ0|A0A118JTJ0_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_008043 PE=4 SV=1	0.78947	1.378	0	0	0	266370	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	266370	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118JTX9	A0A118JTX9_CYNCS	Bax inhibitor 1-related protein	Ccrd_006528	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		MLRQGDN	tr|A0A118JTX9|A0A118JTX9_CYNCS Bax inhibitor 1-related protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_006528 PE=3 SV=1;tr|A0A6S7NIW3|A0A6S7NIW3_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS24199 PE=3 SV=1;tr|A0A2J6K3	0.90244	1.378	0	0	17289	14255	19861	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17289	0	0	0	0	0	0	14255	0	0	0	9472.4	6372.1	0	19861	18731	0	0	0	0	0	0	0
A0A118JUB8	A0A118JUB8_CYNCS	rRNA adenine N(6)-methyltransferase (EC 2.1.1.-)	Ccrd_006164	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			"RNA binding [GO:0003723]; rRNA (adenine-N6,N6-)-dimethyltransferase activity [GO:0000179]"	"RNA binding [GO:0003723]; rRNA (adenine-N6,N6-)-dimethyltransferase activity [GO:0000179]"	TGPGGQL	tr|A0A118JUB8|A0A118JUB8_CYNCS rRNA adenine N(6)-methyltransferase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_006164 PE=3 SV=1	0.90189	1.378	11012	0	0	0	0	0	0	0	0	0	0	11012	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118JUE6	A0A118JUE6_CYNCS	Leucine-rich repeat-containing protein (Fragment)	Ccrd_006908	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					VHLPNLK	tr|A0A118JUE6|A0A118JUE6_CYNCS Leucine-rich repeat-containing protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_006908 PE=4 SV=1	0.90185	1.378	6541.6	0	0	5663.5	4552.4	0	0	0	0	0	6541.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5663.5	0	0	0	0	0	0	4475.7	4552.4	0	0	0	0	0	0	0
A0A118JUU3	A0A118JUU3_CYNCS	Uncharacterized protein	Ccrd_005311	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	signal transduction [GO:0007165]	nucleus [GO:0005634]	nucleus [GO:0005634]; signal transduction [GO:0007165]		GDGPDGK	"tr|A0A118JUU3|A0A118JUU3_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_005311 PE=3 SV=1;tr|A0A251U0Q0|A0A251U0Q0_HELAN Putative ninja family, Jas TPL-binding domain, Putative nuclear localization signal OS=Helianthus an"	0.9018	1.378	15887	14002	0	15087	0	0	0	0	0	15887	0	0	0	0	0	0	14002	0	0	0	0	0	12923	0	0	0	0	0	0	0	0	0	0	0	0	15087	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118JV81	A0A118JV81_CYNCS	Uncharacterized protein (Fragment)	Ccrd_004674	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					MCSSNAR	tr|A0A118JV81|A0A118JV81_CYNCS Uncharacterized protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_004674 PE=4 SV=1	0.79545	1.378	0	93073	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	93073	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118JV96	A0A118JV96_CYNCS	"Glycine cleavage T-protein, C-terminal barrel"	Ccrd_005233	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			transferase activity [GO:0016740]	transferase activity [GO:0016740]	GFGLCNR	"tr|A0A118JV96|A0A118JV96_CYNCS Glycine cleavage T-protein, C-terminal barrel OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_005233 PE=4 SV=1"	0.79592	1.378	8635.4	0	0	0	0	0	0	0	0	0	0	0	0	8635.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118JW29	A0A118JW29_CYNCS	Calcium uniporter protein	Ccrd_003787	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	mitochondrial calcium ion homeostasis [GO:0051560]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; calcium channel activity [GO:0005262]; uniporter activity [GO:0015292]; mitochondrial calcium ion homeostasis [GO:0051560]	calcium channel activity [GO:0005262]; uniporter activity [GO:0015292]	LRQLLFR	tr|A0A118JW29|A0A118JW29_CYNCS Calcium uniporter protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_003787 PE=3 SV=1	0.79638	1.378	7691.2	0	0	0	0	7691.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118JW65	A0A118JW65_CYNCS	Rab3 GTPase-activating protein catalytic subunit	Ccrd_003841	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; GTPase activator activity [GO:0005096]	GTPase activator activity [GO:0005096]	KNSSSAM	tr|A0A118JW65|A0A118JW65_CYNCS Rab3 GTPase-activating protein catalytic subunit OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_003841 PE=3 SV=1	0.79685	1.378	0	0	0	0	6564.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6564.8	0	0
A0A118JWK8	A0A118JWK8_CYNCS	Uncharacterized protein (Fragment)	Ccrd_002066	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					SYGWLPE	tr|A0A118JWK8|A0A118JWK8_CYNCS Uncharacterized protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_002066 PE=4 SV=1	0.89255	1.378	0	41072	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	41072	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118JWM2	A0A118JWM2_CYNCS	"Zinc finger, CW-type"	Ccrd_003481	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	GQNGNER	"tr|A0A118JWM2|A0A118JWM2_CYNCS Zinc finger, CW-type OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_003481 PE=4 SV=1"	0.89331	1.378	0	0	16243	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15764	16243	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118JWQ1	A0A118JWQ1_CYNCS	"Zinc finger, AN1-type"	Ccrd_003186	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	DGDGPSR	"tr|A0A118JWQ1|A0A118JWQ1_CYNCS Zinc finger, AN1-type OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_003186 PE=4 SV=1"	0.89327	1.378	0	0	7173.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7173.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118JX91	A0A118JX91_CYNCS	Uncharacterized protein	Ccrd_002006	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					NAMASKK	tr|A0A118JX91|A0A118JX91_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_002006 PE=4 SV=1	0.79787	1.378	13951	28989	15711	14648	19353	13890	13372	13951	0	0	0	0	12381	0	8192.4	0	0	28989	0	0	0	0	0	15711	7965	0	0	0	0	0	0	12335	0	0	0	13222	14648	0	0	0	0	0	0	19353	0	16382	0	16976	0	0
A0A118JXV2	A0A118JXV2_CYNCS	Cystatin	Ccrd_001197	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			cysteine-type endopeptidase inhibitor activity [GO:0004869]	cysteine-type endopeptidase inhibitor activity [GO:0004869]	LISFEIL	tr|A0A118JXV2|A0A118JXV2_CYNCS Cystatin OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_001197 PE=4 SV=1	0.89709	1.378	0	28626	11116	16734	24789	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28626	0	0	0	4250.3	0	0	0	0	11116	0	0	0	0	0	0	0	16734	10919	0	0	0	0	24789	0	0	0	0	0	0	0
A0A118JYV2	A0A118JYV2_CYNCS	"Concanavalin A-like lectin/glucanase, subgroup"	Ccrd_023127	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; carbohydrate binding [GO:0030246]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; carbohydrate binding [GO:0030246]; protein kinase activity [GO:0004672]	VDGPHAK	"tr|A0A118JYV2|A0A118JYV2_CYNCS Concanavalin A-like lectin/glucanase, subgroup OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_023127 PE=4 SV=1;tr|A0A5N6L952|A0A5N6L952_9ASTR Protein kinase domain-containing protein OS=Mikania micrantha OX=192012 GN=E3"	0.79796	1.378	0	0	23030	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23030	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118JYV7	A0A118JYV7_CYNCS	Diacylglycerol kinase (DAG kinase) (EC 2.7.1.107)	Ccrd_022665	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	defense response [GO:0006952]; protein kinase C-activating G protein-coupled receptor signaling pathway [GO:0007205]		ATP binding [GO:0005524]; diacylglycerol kinase activity [GO:0004143]; NAD+ kinase activity [GO:0003951]; defense response [GO:0006952]; protein kinase C-activating G protein-coupled receptor signaling pathway [GO:0007205]	ATP binding [GO:0005524]; diacylglycerol kinase activity [GO:0004143]; NAD+ kinase activity [GO:0003951]	SSGASHR	tr|A0A118JYV7|A0A118JYV7_CYNCS Diacylglycerol kinase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_022665 PE=3 SV=1	0.79842	1.378	0	0	0	0	22571	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22571	0	0	0	0
A0A118JZE5	A0A118JZE5_CYNCS	Pentatricopeptide repeat-containing protein	Ccrd_022418	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					PGFLSYK	tr|A0A118JZE5|A0A118JZE5_CYNCS Pentatricopeptide repeat-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_022418 PE=3 SV=1	0.79815	1.378	3104200	2591300	0	0	2154500	3104200	0	2584300	0	0	0	0	0	0	0	0	0	0	2591300	0	0	2575300	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1907000	2154500	0	0
A0A118JZJ8	A0A118JZJ8_CYNCS	Cdc23	Ccrd_022875	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	cell cycle [GO:0007049]; cell division [GO:0051301]; regulation of mitotic metaphase/anaphase transition [GO:0030071]	anaphase-promoting complex [GO:0005680]	anaphase-promoting complex [GO:0005680]; cell cycle [GO:0007049]; cell division [GO:0051301]; regulation of mitotic metaphase/anaphase transition [GO:0030071]		DYYFAAK	tr|A0A118JZJ8|A0A118JZJ8_CYNCS Cdc23 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_022875 PE=4 SV=1	0.7987	1.378	0	0	10968	8662.2	13306	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8187.5	0	10968	0	0	0	0	0	0	0	0	0	8662.2	0	0	0	13306	0	0	4763.2	0	0	0	0	0
A0A118JZK7	A0A118JZK7_CYNCS	GTD-binding domain-containing protein	Ccrd_021708	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					YCGCECK	tr|A0A118JZK7|A0A118JZK7_CYNCS GTD-binding domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_021708 PE=4 SV=1	0.79917	1.378	0	0	13148	22505	8117.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13148	0	0	0	0	0	0	0	0	22505	0	0	0	0	0	0	0	0	0	8117.9	0	7960.8	0	0	0
A0A118K040	A0A118K040_CYNCS	Uncharacterized protein	Ccrd_021072	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	floral organ development [GO:0048437]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of organ growth [GO:0046621]; positive regulation of leaf senescence [GO:1900057]; protein autoubiquitination [GO:0051865]		ubiquitin conjugating enzyme binding [GO:0031624]; ubiquitin-protein transferase activity [GO:0004842]; floral organ development [GO:0048437]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of organ growth [GO:0046621]; positive regulation of leaf senescence [GO:1900057]; protein autoubiquitination [GO:0051865]	ubiquitin conjugating enzyme binding [GO:0031624]; ubiquitin-protein transferase activity [GO:0004842]	QNGNGDM	tr|A0A118K040|A0A118K040_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_021072 PE=4 SV=1;tr|A0A2J6K858|A0A2J6K858_LACSA RING-type domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_1X107200 PE=4 SV=1;tr|A0A6S7M5	0.80009	1.378	8158.2	0	0	11795	19473	0	0	0	8158.2	5211.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11795	0	0	19473	0	4146.6	0	9095.8	0	0	0
A0A118K0B4	A0A118K0B4_CYNCS	Small GTPase superfamily	Ccrd_020707	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	SVGCCSS	tr|A0A118K0B4|A0A118K0B4_CYNCS Small GTPase superfamily OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_020707 PE=4 SV=1;tr|A0A6S7LX53|A0A6S7LX53_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS1497 PE=4 SV=1;tr|A0A2J6M302|A0A2J	0.91413	1.378	0	5407.6	0	0	0	0	0	0	0	0	0	0	0	0	4935.1	5407.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118K0P9	A0A118K0P9_CYNCS	DNA glycosylase	Ccrd_020107	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	DNA repair [GO:0006281]		catalytic activity [GO:0003824]; DNA repair [GO:0006281]	catalytic activity [GO:0003824]	TLRRPLR	tr|A0A118K0P9|A0A118K0P9_CYNCS DNA glycosylase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_020107 PE=4 SV=1	0.91708	1.378	8242.4	9486	0	0	0	0	0	8242.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9486	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118K0W1	A0A118K0W1_CYNCS	Uncharacterized protein	Ccrd_019746	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					PNTDGDV	tr|A0A118K0W1|A0A118K0W1_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_019746 PE=4 SV=1	0.92017	1.378	0	271860	0	220190	196630	0	0	0	0	0	0	0	0	0	0	0	271860	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	220190	0	0	0	0	0	0	0	0	196630
A0A118K102	A0A118K102_CYNCS	"Elongation factor Ts, mitochondrial (EF-Ts) (EF-TsMt)"	EFTS Ccrd_019606	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		mitochondrion [GO:0005739]	mitochondrion [GO:0005739]; translation elongation factor activity [GO:0003746]	translation elongation factor activity [GO:0003746]	QAGGSFM	"tr|A0A118K102|A0A118K102_CYNCS Elongation factor Ts, mitochondrial OS=Cynara cardunculus var. scolymus OX=59895 GN=EFTS PE=3 SV=1"	0.7949	1.378	0	0	4952.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4952.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118K113	A0A118K113_CYNCS	Potassium transporter	Ccrd_019896	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; potassium ion transmembrane transporter activity [GO:0015079]	potassium ion transmembrane transporter activity [GO:0015079]	LLLVLVLAVISAVRGLK	tr|A0A118K113|A0A118K113_CYNCS Potassium transporter OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_019896 PE=3 SV=1	0.88652	1.378	0	0	0	0	6104.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6104.8	0	0
A0A118K1B1	A0A118K1B1_CYNCS	Uncharacterized protein (Fragment)	Ccrd_019253	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					KKTILAK	tr|A0A118K1B1|A0A118K1B1_CYNCS Uncharacterized protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_019253 PE=4 SV=1;tr|A0A699J0Z9|A0A699J0Z9_TANCI DNA-directed DNA polymerase (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_5739	0.9201	1.378	248200	8121.3	0	6689.6	5202.4	0	0	0	248200	8814.1	0	11207	0	0	0	0	0	0	7068.9	0	0	0	8121.3	0	0	0	0	0	0	0	0	0	6689.6	0	0	0	0	0	0	0	0	0	0	5202.4	0	0	0	0	0	0
A0A118K1N2	A0A118K1N2_CYNCS	Uncharacterized protein	Ccrd_018963	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					AGNPSCR	tr|A0A118K1N2|A0A118K1N2_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_018963 PE=3 SV=1	0.79443	1.378	1101000	1229800	814070	0	540990	34956	0	454200	1101000	0	0	0	0	0	0	0	0	1229800	0	0	0	0	0	0	0	814070	0	0	0	0	239280	299320	0	0	0	0	0	0	0	0	0	0	0	0	0	0	540990	0	0	0
A0A118K2B5	A0A118K2B5_CYNCS	O-fucosyltransferase family protein	Ccrd_017582	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	fucose metabolic process [GO:0006004]		glycosyltransferase activity [GO:0016757]; fucose metabolic process [GO:0006004]	glycosyltransferase activity [GO:0016757]	LKLPPLK	tr|A0A118K2B5|A0A118K2B5_CYNCS O-fucosyltransferase family protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_017582 PE=3 SV=1	0.7892	1.378	0	0	6449	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6449	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118K2D2	A0A118K2D2_CYNCS	Formin-like protein	Ccrd_017501	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		DDTPAGK	tr|A0A118K2D2|A0A118K2D2_CYNCS Formin-like protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_017501 PE=3 SV=1	0.91757	1.378	49352	73288	26789	55813	36973	0	0	0	0	0	49352	0	0	0	32731	67449	0	0	0	73288	40129	0	0	26032	26789	0	0	0	0	0	0	25673	0	0	0	45233	0	55813	0	20387	0	0	0	0	12231	6857.8	13885	27757	36973	0
A0A118K2G9	A0A118K2G9_CYNCS	SPARK domain-containing protein	Ccrd_017321	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		HGSGPLR	tr|A0A118K2G9|A0A118K2G9_CYNCS SPARK domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_017321 PE=4 SV=1	0.91753	1.378	0	0	0	0	27447	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27447	0	0	0	0
A0A118K345	A0A118K345_CYNCS	Non-specific serine/threonine protein kinase (EC 2.7.11.1)	Ccrd_016314	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	"mRNA cis splicing, via spliceosome [GO:0045292]"		"ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; mRNA cis splicing, via spliceosome [GO:0045292]"	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	YRTKPLR	tr|A0A118K345|A0A118K345_CYNCS Non-specific serine/threonine protein kinase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_016314 PE=3 SV=1	0.91197	1.378	0	38922	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38922	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118K395	A0A118K395_CYNCS	Glucose/Sorbosone dehydrogenase	Ccrd_016083	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			catalytic activity [GO:0003824]	catalytic activity [GO:0003824]	DASDCCR	tr|A0A118K395|A0A118K395_CYNCS Glucose/Sorbosone dehydrogenase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_016083 PE=4 SV=1	0.78967	1.378	0	12805	0	0	19445	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12805	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19445	0	0	0	0	0	0	0
A0A118K3J0	A0A118K3J0_CYNCS	Helicase ATP-binding domain-containing protein	Ccrd_015675	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	nucleobase-containing compound metabolic process [GO:0006139]		"ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [GO:0016818]; nucleobase-containing compound metabolic process [GO:0006139]"	"ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [GO:0016818]"	LILLGHK	tr|A0A118K3J0|A0A118K3J0_CYNCS Helicase ATP-binding domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_015675 PE=4 SV=1	0.87857	1.378	0	174630	82183	165420	177070	0	0	0	0	0	0	0	0	0	0	0	174630	0	0	0	55550	0	60523	0	82183	27594	35013	33522	31998	0	0	0	0	0	22318	165420	39611	27362	35340	37968	0	37818	177070	0	37968	0	35112	0	0	0
A0A118K439	A0A118K439_CYNCS	Alpha/beta hydrolase fold-1	Ccrd_014758	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			hydrolase activity [GO:0016787]	hydrolase activity [GO:0016787]	AIGGGDP	tr|A0A118K439|A0A118K439_CYNCS Alpha/beta hydrolase fold-1 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_014758 PE=4 SV=1	0.90582	1.378	4684.4	0	0	8768.7	0	0	0	4684.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8768.7	0	4490.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118K4H9	A0A118K4H9_CYNCS	BolA protein	Ccrd_014095	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					FGRQQLVK	tr|A0A118K4H9|A0A118K4H9_CYNCS BolA protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_014095 PE=3 SV=1	0.85455	2.1591	26209	102440	37983	26777	2770.5	11408	0	26209	6740.1	6313.7	0	0	0	0	21239	15839	0	3670.9	0	0	0	3519.4	102440	0	37983	0	0	0	0	3878.7	4785.6	24785	4811.6	5492.8	0	0	16083	0	0	26777	0	0	0	2770.5	0	0	0	0	0	0
A0A118K4L2	A0A118K4L2_CYNCS	RING-type E3 ubiquitin transferase (EC 2.3.2.27)	Ccrd_013935	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			ubiquitin-protein transferase activity [GO:0004842]	ubiquitin-protein transferase activity [GO:0004842]	EPTPPPK	tr|A0A118K4L2|A0A118K4L2_CYNCS RING-type E3 ubiquitin transferase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_013935 PE=4 SV=1	0.9049	1.378	14792	0	0	0	0	0	0	0	14792	9175.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118K4T9	A0A118K4T9_CYNCS	"Heavy metal-associated domain, HMA"	Ccrd_013574	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	VLKAVTK	"tr|A0A118K4T9|A0A118K4T9_CYNCS Heavy metal-associated domain, HMA OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_013574 PE=4 SV=1;tr|A0A2U1KMB5|A0A2U1KMB5_ARTAN Heavy metal-associated domain, HMA OS=Artemisia annua OX=35608 GN=CTI12_AA587540 PE=4 SV="	0.90757	1.378	6195.9	0	0	0	0	6195.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118K4V3	A0A118K4V3_CYNCS	Phosphopyruvate hydratase (EC 4.2.1.11)	Ccrd_013501	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	glycolytic process [GO:0006096]	phosphopyruvate hydratase complex [GO:0000015]	phosphopyruvate hydratase complex [GO:0000015]; magnesium ion binding [GO:0000287]; phosphopyruvate hydratase activity [GO:0004634]; glycolytic process [GO:0006096]	magnesium ion binding [GO:0000287]; phosphopyruvate hydratase activity [GO:0004634]	EGDNNEK	tr|A0A118K4V3|A0A118K4V3_CYNCS Phosphopyruvate hydratase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_013501 PE=3 SV=1;tr|A0A1B2H9Q1|A0A1B2H9Q1_AMBAR Phosphopyruvate hydratase OS=Ambrosia artemisiifolia OX=4212 PE=2 SV=1;tr|A0A1B2H9Q5|A0A1B2H9Q5_AM	0.79013	1.378	0	0	24043	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24043	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118K543	A0A118K543_CYNCS	Uncharacterized protein	Ccrd_013123	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	mitochondrial translation [GO:0032543]	mitochondrion [GO:0005739]	mitochondrion [GO:0005739]; structural constituent of ribosome [GO:0003735]; mitochondrial translation [GO:0032543]	structural constituent of ribosome [GO:0003735]	HVEEMEK	tr|A0A118K543|A0A118K543_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_013123 PE=4 SV=1	0.9111	1.378	0	9665.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9665.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118K587	A0A118K587_CYNCS	Uncharacterized protein	Ccrd_012933	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					QQNDDDK	tr|A0A118K587|A0A118K587_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_012933 PE=4 SV=1	0.79023	1.378	26672	29672	31288	6455.6	0	0	26672	0	0	0	0	0	24044	0	0	0	29672	0	0	0	0	22797	0	0	0	0	0	0	0	0	0	31288	0	0	0	0	0	0	0	0	6455.6	0	0	0	0	0	0	0	0	0
A0A118K5F2	A0A118K5F2_CYNCS	Uncharacterized protein	Ccrd_012639	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		CAEANER	tr|A0A118K5F2|A0A118K5F2_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_012639 PE=4 SV=1	0.7907	1.378	9697.5	0	20801	0	0	0	0	0	0	0	9697.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15533	20801	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118K5N8	A0A118K5N8_CYNCS	Nuclear transcription factor Y subunit	Ccrd_012211	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		CCAAT-binding factor complex [GO:0016602]	CCAAT-binding factor complex [GO:0016602]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	GMATSSM	tr|A0A118K5N8|A0A118K5N8_CYNCS Nuclear transcription factor Y subunit OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_012211 PE=3 SV=1	0.88612	1.378	63329	23346	18080	17114	13139	0	0	0	0	45447	0	63329	0	28644	0	0	0	0	23346	0	0	17701	22854	0	0	0	0	0	0	18080	14242	0	0	17114	0	0	0	0	0	0	0	0	0	13139	0	0	0	0	0	0
A0A118K6B5	A0A118K6B5_CYNCS	Uncharacterized protein	Ccrd_011194	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	auxin homeostasis [GO:0010252]; methylation [GO:0032259]; polarity specification of adaxial/abaxial axis [GO:0009944]		identical protein binding [GO:0042802]; indole acetic acid carboxyl methyltransferase activity [GO:0051749]; magnesium ion binding [GO:0000287]; auxin homeostasis [GO:0010252]; methylation [GO:0032259]; polarity specification of adaxial/abaxial axis [GO:0009944]	identical protein binding [GO:0042802]; indole acetic acid carboxyl methyltransferase activity [GO:0051749]; magnesium ion binding [GO:0000287]	ALANSCR	tr|A0A118K6B5|A0A118K6B5_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011194 PE=3 SV=1;tr|A0A165YZQ7|A0A165YZQ7_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_013200 PE=3 SV=1;tr|A0A6S7P	0.89237	1.378	0	0	0	6043	6392.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6043	6392.5	0	0	0	0	0	0	0	0
A0A118K6B8	A0A118K6B8_CYNCS	Leucine-rich repeat-containing protein	Ccrd_011223	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	GFAGHAR	tr|A0A118K6B8|A0A118K6B8_CYNCS Leucine-rich repeat-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011223 PE=3 SV=1	0.89275	1.378	0	0	0	0	6147.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6147.1	0	0	0	0	0	0	0
A0A118K6J7	A0A118K6J7_CYNCS	Cyclin N-terminal domain-containing protein	Ccrd_010801	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	cell cycle [GO:0007049]; cell division [GO:0051301]		cell cycle [GO:0007049]; cell division [GO:0051301]		CEALILR	tr|A0A118K6J7|A0A118K6J7_CYNCS Cyclin N-terminal domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_010801 PE=3 SV=1	0.87941	1.378	0	0	159720	288280	63617	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	159720	0	0	0	94465	0	107020	44079	0	288280	77689	0	63617	51129	0	0	0	0	0	0	0
A0A118K6S4	A0A118K6S4_CYNCS	Kinesin-like protein	Ccrd_010473	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	microtubule-based movement [GO:0007018]	microtubule [GO:0005874]	microtubule [GO:0005874]; ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]; microtubule-based movement [GO:0007018]	ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]	TAHIPYR	tr|A0A118K6S4|A0A118K6S4_CYNCS Kinesin-like protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_010473 PE=3 SV=1;tr|A0A5N6M137|A0A5N6M137_9ASTR Kinesin-like protein OS=Mikania micrantha OX=192012 GN=E3N88_35311 PE=3 SV=1;tr|A0A5N6M0X1|A0A5N6M0X1_9	0.87845	1.378	0	0	0	137740	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	137740	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118K6Z0	A0A118K6Z0_CYNCS	"Lipase, GDSL"	Ccrd_010160	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					YQCWENR	"tr|A0A118K6Z0|A0A118K6Z0_CYNCS Lipase, GDSL OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_010160 PE=4 SV=1"	0.79079	1.378	0	0	0	6928.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6928.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118K7C5	A0A118K7C5_CYNCS	Auxin responsive SAUR protein	Ccrd_009557	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	response to auxin [GO:0009733]		response to auxin [GO:0009733]		VVKMALK	tr|A0A118K7C5|A0A118K7C5_CYNCS Auxin responsive SAUR protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_009557 PE=3 SV=1	0.79126	1.378	0	0	0	11232	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11232	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118K7K0	A0A118K7K0_CYNCS	Histone H1/H5	Ccrd_009185	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	nucleosome assembly [GO:0006334]	nucleosome [GO:0000786]; nucleus [GO:0005634]	nucleosome [GO:0000786]; nucleus [GO:0005634]; DNA binding [GO:0003677]; nucleosome assembly [GO:0006334]	DNA binding [GO:0003677]	KPAAKTK	"tr|A0A118K7K0|A0A118K7K0_CYNCS Histone H1/H5 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_009185 PE=3 SV=1;tr|A0A2U1M7N9|A0A2U1M7N9_ARTAN PB1 domain, RWP-RK domain protein OS=Artemisia annua OX=35608 GN=CTI12_AA409980 PE=4 SV=1"	0.77557	1.378	5181.1	0	0	5022.1	0	0	0	0	0	0	5181.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5022.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A118K7M2	A0A118K7M2_CYNCS	Pentatricopeptide repeat-containing protein	Ccrd_009104	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					RGHGSHK	tr|A0A118K7M2|A0A118K7M2_CYNCS Pentatricopeptide repeat-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_009104 PE=4 SV=1	0.87705	1.378	0	16004	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16004	0	0	0	11245	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A124Q7H2	A0A124Q7H2_CYNCS	Uncharacterized protein	Ccrd_026779	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					KKTIGNK	tr|A0A124Q7H2|A0A124Q7H2_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_026779 PE=4 SV=1	0.88076	1.378	0	6338.7	7439.6	0	0	0	0	0	0	0	0	0	0	0	0	6338.7	0	0	0	0	0	0	0	0	0	0	0	0	7439.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A124R304	A0A124R304_CYNCS	Chalcone isomerase	Ccrd_026445	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		chloroplast stroma [GO:0009570]	chloroplast stroma [GO:0009570]; fatty acid binding [GO:0005504]; intramolecular lyase activity [GO:0016872]	fatty acid binding [GO:0005504]; intramolecular lyase activity [GO:0016872]	PGEDLGM	tr|A0A124R304|A0A124R304_CYNCS Chalcone isomerase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_026445 PE=4 SV=1	0.79136	1.378	243270	72633	75063	98208	28800	0	0	0	0	243270	0	0	131580	0	0	0	0	0	0	0	0	72633	0	0	0	0	0	0	0	75063	0	44679	0	0	0	0	98208	0	0	0	0	0	0	0	0	14437	0	0	0	28800
A0A124SAJ2	A0A124SAJ2_CYNCS	PseudoU_synth_1 domain-containing protein	Ccrd_025063	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	pseudouridine synthesis [GO:0001522]; tRNA processing [GO:0008033]		pseudouridine synthase activity [GO:0009982]; RNA binding [GO:0003723]; pseudouridine synthesis [GO:0001522]; tRNA processing [GO:0008033]	pseudouridine synthase activity [GO:0009982]; RNA binding [GO:0003723]	EETEGDNLPFIYLRRYK	tr|A0A124SAJ2|A0A124SAJ2_CYNCS PseudoU_synth_1 domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_025063 PE=3 SV=1	0.89825	1.378	0	33954	0	13597	8241.2	0	0	0	0	0	0	0	0	0	0	0	0	0	33954	0	7782.7	0	0	0	0	0	0	0	0	0	0	0	8789.3	0	0	0	13597	0	0	0	0	0	0	0	0	0	0	8241.2	0	0
A0A124SAU0	A0A124SAU0_CYNCS	Putative AB-hydrolase YheT	Ccrd_026511	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; hydrolase activity [GO:0016787]	hydrolase activity [GO:0016787]	HAMAYAK	tr|A0A124SAU0|A0A124SAU0_CYNCS Putative AB-hydrolase YheT OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_026511 PE=3 SV=1	0.79397	1.378	0	130250	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	130250	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A124SB65	A0A124SB65_CYNCS	Transmembrane protein TauE like protein	Ccrd_008340	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		LIILLGR	tr|A0A124SB65|A0A124SB65_CYNCS Transmembrane protein TauE like protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_008340 PE=4 SV=1	0.8822	1.378	0	0	38413	25254	12953	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38413	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25254	0	0	0	0	0	0	0	12953	0	0
A0A124SBF2	A0A124SBF2_CYNCS	[2Fe-2S]-binding	Ccrd_007586	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			"2 iron, 2 sulfur cluster binding [GO:0051537]; FAD binding [GO:0071949]; iron ion binding [GO:0005506]; oxidoreductase activity [GO:0016491]"	"2 iron, 2 sulfur cluster binding [GO:0051537]; FAD binding [GO:0071949]; iron ion binding [GO:0005506]; oxidoreductase activity [GO:0016491]"	FDYHEVK	tr|A0A124SBF2|A0A124SBF2_CYNCS [2Fe-2S]-binding OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_007586 PE=3 SV=1	0.79182	1.378	22766	19102	11533	0	10330	0	0	0	0	22766	0	21233	0	0	0	0	0	0	0	0	0	19102	0	0	0	0	0	0	0	0	11533	0	0	0	0	0	0	0	0	0	0	0	0	10330	0	0	0	0	0	0
A0A124SBV4	A0A124SBV4_CYNCS	FAD-dependent pyridine nucleotide-disulfide oxidoreductase	Ccrd_006129	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			flavin adenine dinucleotide binding [GO:0050660]; oxidoreductase activity [GO:0016491]	flavin adenine dinucleotide binding [GO:0050660]; oxidoreductase activity [GO:0016491]	LLPKLAR	tr|A0A124SBV4|A0A124SBV4_CYNCS FAD-dependent pyridine nucleotide-disulfide oxidoreductase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_006129 PE=4 SV=1	0.85047	1.4337	7408800	5584100	3339800	3268100	4633000	1927700	5847400	5062200	7408800	3443900	534200	3605800	3090300	2638900	1184300	1452000	1317200	1707700	4464900	4141100	4501400	2726400	5584100	575840	941010	1514100	3054000	2194500	1908900	3339800	1124800	2646400	2128500	1480100	1499600	3268100	2203800	2158100	0	0	146930	4633000	3367700	121600	246990	114740	875410	501520	768880	208810
A0A124SBW6	A0A124SBW6_CYNCS	Uncharacterized protein	Ccrd_006063	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		PPDEFGK	tr|A0A124SBW6|A0A124SBW6_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_006063 PE=4 SV=1;tr|A0A5N6MV96|A0A5N6MV96_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_26930 PE=4 SV=1	0.91065	1.378	0	172030	0	0	236330	0	0	0	0	0	0	0	0	0	0	0	172030	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	236330	0	0	0	0	0
A0A124SC50	A0A124SC50_CYNCS	No apical meristem (NAM) protein	Ccrd_005253	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	"regulation of transcription, DNA-templated [GO:0006355]"		"DNA binding [GO:0003677]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]	PTSKNKR	tr|A0A124SC50|A0A124SC50_CYNCS No apical meristem (NAM) protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_005253 PE=4 SV=1	0.90722	1.378	287460	189290	209890	190990	189160	287460	0	0	0	0	211230	0	0	249830	0	0	0	189290	0	0	0	0	0	0	0	143510	209890	0	0	193750	0	0	0	0	0	0	0	0	0	0	190990	0	0	0	0	0	0	0	189160	159480
A0A124SC58	A0A124SC58_CYNCS	DUF1336 domain-containing protein	Ccrd_005218	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					ASGCVGM	tr|A0A124SC58|A0A124SC58_CYNCS DUF1336 domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_005218 PE=4 SV=1;tr|A0A5N6Q3S2|A0A5N6Q3S2_9ASTR DUF1336 domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_01793 PE=4 SV=1;	0.90378	1.378	0	26412	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26412	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A124SCM8	A0A124SCM8_CYNCS	Uncharacterized protein	Ccrd_003681	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					APEHKFK	tr|A0A124SCM8|A0A124SCM8_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_003681 PE=4 SV=1	0.79229	1.378	0	13650	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13650	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A124SD60	A0A124SD60_CYNCS	Leucine-rich repeat-containing protein	Ccrd_001983	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]		PIKTIVK	tr|A0A124SD60|A0A124SD60_CYNCS Leucine-rich repeat-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_001983 PE=4 SV=1	0.87034	1.378	0	0	0	0	3896.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3896.3	0	0	0	0	0	0	0
A0A124SE51	A0A124SE51_CYNCS	Uncharacterized protein	Ccrd_022767	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	PDEGGDK	tr|A0A124SE51|A0A124SE51_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_022767 PE=4 SV=1	0.8743	1.378	31510	827610	28640	26870	21346	0	25399	0	0	0	31510	0	12749	0	0	16701	0	827610	24222	0	0	0	0	0	0	0	0	0	28640	0	0	0	0	0	0	0	0	25318	26870	0	0	0	0	0	0	0	0	0	21346	0
A0A124SEC0	A0A124SEC0_CYNCS	Uncharacterized protein (Fragment)	Ccrd_022105	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					ILKPDDR	tr|A0A124SEC0|A0A124SEC0_CYNCS Uncharacterized protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_022105 PE=4 SV=1	0.79275	1.378	12414	13691	0	0	7499.9	0	0	0	0	0	0	12414	0	8380.8	0	0	0	0	13691	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7499.9	0	0	0	0	0	0
A0A124SES4	A0A124SES4_CYNCS	Membrane attack complex component/perforin (MACPF) domain-containing protein	Ccrd_020718	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	defense response [GO:0006952]; programmed cell death [GO:0012501]; regulation of salicylic acid mediated signaling pathway [GO:2000031]		defense response [GO:0006952]; programmed cell death [GO:0012501]; regulation of salicylic acid mediated signaling pathway [GO:2000031]		LCTEGGR	tr|A0A124SES4|A0A124SES4_CYNCS Membrane attack complex component/perforin (MACPF) domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_020718 PE=4 SV=1	0.87451	1.378	0	0	0	131810	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	131810	0	0	0	0	0	0	0	0	0	0
A0A124SF03	A0A124SF03_CYNCS	Uncharacterized protein (Fragment)	Ccrd_020030	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					TGGGGGR	tr|A0A124SF03|A0A124SF03_CYNCS Uncharacterized protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_020030 PE=4 SV=1;tr|A0A6L2NX57|A0A6L2NX57_TANCI Unconventional myosin OS=Tanacetum cinerariifolium OX=118510 GN=Tci_061927 PE=4 SV=1	0.88983	1.378	54077	73062	54022	68236	5124.9	0	33378	40248	53537	54077	0	47202	0	30544	0	0	0	14266	73062	0	0	0	48949	0	11026	0	0	0	0	48645	50314	54022	0	0	0	52241	37331	0	0	68236	0	0	0	0	0	0	5124.9	0	0	0
A0A124SFC1	A0A124SFC1_CYNCS	GTP binding domain-containing protein	Ccrd_018983	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			GTP binding [GO:0005525]; metal ion binding [GO:0046872]	GTP binding [GO:0005525]; metal ion binding [GO:0046872]	MMLMPVR	tr|A0A124SFC1|A0A124SFC1_CYNCS GTP binding domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_018983 PE=3 SV=1	0.88969	1.378	303120	0	0	146990	0	0	0	228250	0	0	0	303120	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	146990	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A124SFF5	A0A124SFF5_CYNCS	"Zinc finger, FYVE/PHD-type"	Ccrd_018635	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	TKVTLVK	"tr|A0A124SFF5|A0A124SFF5_CYNCS Zinc finger, FYVE/PHD-type OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_018635 PE=4 SV=1"	0.90311	1.378	16152	16364	5303.9	0	28600	0	0	0	0	16152	0	13724	0	14178	0	0	0	16364	0	0	0	10028	0	0	0	0	0	0	0	3865.5	5303.9	0	0	0	0	0	0	0	0	0	0	0	0	7342.5	0	0	0	0	0	28600
A0A124SFH6	A0A124SFH6_CYNCS	"Ribosomal protein S27/S33, mitochondrial"	Ccrd_018436	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		mitochondrion [GO:0005739]; ribosome [GO:0005840]	mitochondrion [GO:0005739]; ribosome [GO:0005840]		SLSTMSK	"tr|A0A124SFH6|A0A124SFH6_CYNCS Ribosomal protein S27/S33, mitochondrial OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_018436 PE=3 SV=1"	0.79248	1.378	0	17164	12401	15040	0	0	0	0	0	0	0	0	0	0	0	11327	0	0	0	17164	0	0	0	0	0	12401	0	0	0	0	0	0	0	0	0	0	0	0	15040	0	0	0	0	0	0	0	0	0	0	0
A0A124SFH7	A0A124SFH7_CYNCS	Glutamate receptor	Ccrd_018403	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ligand-gated ion channel activity [GO:0015276]	ligand-gated ion channel activity [GO:0015276]	VGVPGAK	tr|A0A124SFH7|A0A124SFH7_CYNCS Glutamate receptor OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_018403 PE=3 SV=1	0.94371	1.378	0	21560	20842	19199	15737	0	0	0	0	0	0	0	0	0	0	13493	0	21560	0	0	0	0	0	0	0	0	0	0	20842	0	0	0	0	0	0	0	0	15972	0	0	19199	0	0	0	9132	0	15737	0	0	0
A0A124SFN2	A0A124SFN2_CYNCS	Uncharacterized protein	Ccrd_017899	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		RNGGHVK	tr|A0A124SFN2|A0A124SFN2_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_017899 PE=4 SV=1	0.79294	1.378	14655	0	0	20060	18530	0	0	0	0	0	0	0	0	14655	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20060	0	0	0	0	0	0	0	0	0	3584.7	0	0	0	18530	0	0
A0A124SFS6	A0A124SFS6_CYNCS	Galactosyl transferase	Ccrd_017569	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)		Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; glycosyltransferase activity [GO:0016757]	glycosyltransferase activity [GO:0016757]	PIKNWDK	tr|A0A124SFS6|A0A124SFS6_CYNCS Galactosyl transferase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_017569 PE=3 SV=1	0.8896	1.378	0	16261	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16261	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A124SFX9	A0A124SFX9_CYNCS	"Histidine kinase-like ATPase, ATP-binding domain-containing protein"	Ccrd_017030	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			ATP binding [GO:0005524]; kinase activity [GO:0016301]	ATP binding [GO:0005524]; kinase activity [GO:0016301]	VTAGYGR	"tr|A0A124SFX9|A0A124SFX9_CYNCS Histidine kinase-like ATPase, ATP-binding domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_017030 PE=4 SV=1;tr|A0A6S7P0G0|A0A6S7P0G0_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=L"	0.76	2.756	0	40936	0	2792.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	40936	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2792.1	0	0	0	0	0	0	0	0	0	0
A0A124SGC4	A0A124SGC4_CYNCS	"N-terminal acetyltransferase A, auxiliary subunit"	Ccrd_015664	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			transferase activity [GO:0016740]	transferase activity [GO:0016740]	PVRKHGK	"tr|A0A124SGC4|A0A124SGC4_CYNCS N-terminal acetyltransferase A, auxiliary subunit OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_015664 PE=4 SV=1"	0.79304	1.378	0	16280	12759	14846	3466.1	0	0	0	0	0	0	0	0	0	13937	16280	0	0	0	0	10901	0	0	0	0	0	0	0	12759	0	0	0	0	0	0	0	0	12264	8884.3	14846	0	0	0	0	3466.1	0	0	0	0	0
A0A124SGN6	A0A124SGN6_CYNCS	Putative domain XH	Ccrd_014692	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	gene silencing by RNA [GO:0031047]		gene silencing by RNA [GO:0031047]		HMGDDDK	tr|A0A124SGN6|A0A124SGN6_CYNCS Putative domain XH OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_014692 PE=4 SV=1	0.89266	1.378	0	0	15786	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15786	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A124SH46	A0A124SH46_CYNCS	Uncharacterized protein	Ccrd_013234	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					FSDRFYMRLEMFDEK	tr|A0A124SH46|A0A124SH46_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_013234 PE=4 SV=1	0.7935	1.378	0	0	3773.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3773.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A124SH91	A0A124SH91_CYNCS	Uncharacterized protein	Ccrd_012794	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					KRLHLPR	tr|A0A124SH91|A0A124SH91_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_012794 PE=4 SV=1	0.89007	1.378	0	37690	15099	23984	30020	0	0	0	0	0	0	0	0	0	30858	17832	14584	37690	0	0	0	0	0	15099	0	0	0	0	0	0	0	0	0	13282	0	0	0	0	0	0	23984	30020	0	0	0	0	14800	0	0	0
A0A124SHK6	A0A124SHK6_CYNCS	"Heat shock protein 70, conserved site-containing protein"	Ccrd_011809	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			ATP binding [GO:0005524]	ATP binding [GO:0005524]	APNGSIK	"tr|A0A124SHK6|A0A124SHK6_CYNCS Heat shock protein 70, conserved site-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011809 PE=4 SV=1;tr|A0A5N6NTK7|A0A5N6NTK7_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_175"	0.86257	1.378	159050	0	0	14993	82297	0	0	0	58232	159050	0	25041	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14993	0	0	0	0	0	0	0	0	0	0	0	0	0	17478	82297	0
A0A124SHL1	A0A124SHL1_CYNCS	Ran GTPase	Ccrd_011736	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	GTTCCSN	tr|A0A124SHL1|A0A124SHL1_CYNCS Ran GTPase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011736 PE=4 SV=1	0.8896	1.378	8308.9	0	5129.6	0	4454.5	0	8308.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5129.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4454.5	0
A0A124SHM0	A0A124SHM0_CYNCS	Mad3/BUB1 homology region 1	Ccrd_011682	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	mitotic spindle assembly checkpoint signaling [GO:0007094]		mitotic spindle assembly checkpoint signaling [GO:0007094]		FFVVTDK	tr|A0A124SHM0|A0A124SHM0_CYNCS Mad3/BUB1 homology region 1 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011682 PE=4 SV=1	0.86205	1.378	0	0	0	21550	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21550	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A124SHN8	A0A124SHN8_CYNCS	"Prolyl 4-hydroxylase, alpha subunit"	Ccrd_011499	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			"dioxygenase activity [GO:0051213]; iron ion binding [GO:0005506]; L-ascorbic acid binding [GO:0031418]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"dioxygenase activity [GO:0051213]; iron ion binding [GO:0005506]; L-ascorbic acid binding [GO:0031418]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	MMGDRKK	"tr|A0A124SHN8|A0A124SHN8_CYNCS Prolyl 4-hydroxylase, alpha subunit OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011499 PE=4 SV=1"	0.88997	1.378	10333	0	0	0	0	0	0	0	0	0	0	0	0	10333	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A124SHS5	A0A124SHS5_CYNCS	Uncharacterized protein	Ccrd_011110	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					RMALYYK	tr|A0A124SHS5|A0A124SHS5_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011110 PE=4 SV=1	0.88908	1.378	71918	0	0	0	0	71918	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A124SHZ6	A0A124SHZ6_CYNCS	23 kDa subunit of oxygen evolving system of photosystem II (23 kDa thylakoid membrane protein) (OEC 23 kDa subunit)	Ccrd_010496	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	photosynthesis [GO:0015979]	chloroplast thylakoid membrane [GO:0009535]; extrinsic component of membrane [GO:0019898]; photosystem II oxygen evolving complex [GO:0009654]	chloroplast thylakoid membrane [GO:0009535]; extrinsic component of membrane [GO:0019898]; photosystem II oxygen evolving complex [GO:0009654]; calcium ion binding [GO:0005509]; photosynthesis [GO:0015979]	calcium ion binding [GO:0005509]	GFSRCIK	tr|A0A124SHZ6|A0A124SHZ6_CYNCS 23 kDa subunit of oxygen evolving system of photosystem II OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_010496 PE=3 SV=1	0.88565	1.378	0	0	24384	9803.4	16714	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24384	0	0	0	0	0	0	0	0	0	9803.4	0	0	0	16714	14966	0	0	0	0	0	0	0
A0A124SHZ8	A0A124SHZ8_CYNCS	Uncharacterized protein	Ccrd_010448	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)					ARQIFLR	tr|A0A124SHZ8|A0A124SHZ8_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_010448 PE=4 SV=1	0.88603	1.378	12963	0	11643	0	0	0	0	0	0	0	0	0	12963	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11643	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A124SI07	A0A124SI07_CYNCS	Pentatricopeptide repeat-containing protein	Ccrd_010414	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	PLNMVLRKLFIDIAEIK	tr|A0A124SI07|A0A124SI07_CYNCS Pentatricopeptide repeat-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_010414 PE=3 SV=1	0.90909	1.378	137940	0	34020	21801	8450.1	0	0	0	110550	88859	0	137940	17614	13016	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34020	28654	0	0	0	0	21801	0	0	0	0	0	0	0	0	0	0	0	0	8450.1	0
A0A124SI28	A0A124SI28_CYNCS	Armadillo-like helical	Ccrd_010187	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)	response to auxin [GO:0009733]; SCF complex assembly [GO:0010265]; vegetative to reproductive phase transition of meristem [GO:0010228]; xylem and phloem pattern formation [GO:0010051]	cell wall [GO:0005618]; cytosol [GO:0005829]; plasma membrane [GO:0005886]	cell wall [GO:0005618]; cytosol [GO:0005829]; plasma membrane [GO:0005886]; response to auxin [GO:0009733]; SCF complex assembly [GO:0010265]; vegetative to reproductive phase transition of meristem [GO:0010228]; xylem and phloem pattern formation [GO:0010051]		LVVAITK	tr|A0A124SI28|A0A124SI28_CYNCS Armadillo-like helical OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_010187 PE=3 SV=1	0.86153	1.378	0	12695	13072	0	4744.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12695	8805	0	0	0	0	0	13072	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4744.6	0	0	0
A0A124SI78	A0A124SI78_CYNCS	Uncharacterized protein	Ccrd_009712	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	LLRMKVK	tr|A0A124SI78|A0A124SI78_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_009712 PE=3 SV=1	0.83987	1.378	9068	0	12996	7483.7	6044.9	0	0	0	0	0	9068	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7109.5	0	12996	0	0	0	0	0	0	7483.7	0	0	0	0	0	0	6044.9	0	0	0	0	0	0	0	0
A0A124SIE7	A0A124SIE7_CYNCS	BRCT domain-containing protein	Ccrd_009055	Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	SSTSNKK	tr|A0A124SIE7|A0A124SIE7_CYNCS BRCT domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_009055 PE=4 SV=1	0.88465	1.378	0	0	0	0	40597	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	40597	0	0	0	0	0	0
A0A1L5JHR8	A0A1L5JHR8_DAUCA	Nuclear matrix constituent protein	NMCP4	Daucus carota (Wild carrot)	nucleus organization [GO:0006997]	nuclear lamina [GO:0005652]	nuclear lamina [GO:0005652]; nucleus organization [GO:0006997]		AELDGVKK	tr|A0A1L5JHR8|A0A1L5JHR8_DAUCA Nuclear matrix constituent protein OS=Daucus carota OX=4039 GN=NMCP4 PE=2 SV=1;tr|A0A162AVA2|A0A162AVA2_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_007220 PE=3 SV=1	0.86047	1.7566	0	0	0	97651	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	97651	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A451FTZ2	A0A451FTZ2_DAUCA	Transcription factor MYB6 (Fragment)	MYB6	Daucus carota (Wild carrot)		nucleus [GO:0005634]	nucleus [GO:0005634]		RAPVLHK	tr|A0A451FTZ2|A0A451FTZ2_DAUCA Transcription factor MYB6 (Fragment) OS=Daucus carota OX=4039 GN=MYB6 PE=2 SV=1;tr|A0A166AVP4|A0A166AVP4_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_010746 PE=4 SV=1;tr|A0A166AVM2|A0A166AVM2	0.76002	1.378	0	0	21689	5844.5	15601	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21689	0	0	0	0	0	0	0	0	0	0	5844.5	0	0	0	0	15601	0	0	0	0	0	0	0
H2DF84	H2DF84_DAUCA	Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8)		Daucus carota (Wild carrot)	protein folding [GO:0006457]		peptidyl-prolyl cis-trans isomerase activity [GO:0003755]; protein folding [GO:0006457]	peptidyl-prolyl cis-trans isomerase activity [GO:0003755]	VGSGSGK	tr|H2DF84|H2DF84_DAUCA Peptidyl-prolyl cis-trans isomerase OS=Daucus carota OX=4039 PE=2 SV=1;tr|A0A164V1L1|A0A164V1L1_DAUCS Peptidyl-prolyl cis-trans isomerase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_022952 PE=3 SV=1;tr|A0A6L2LAM1|A0A6L2LAM1_TANC	0.83977	1.378	0	0	24990	22628	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24990	0	0	0	0	0	0	22628	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
Q42390	Q42390_DAUCA	Daucus carota globulin-like protein (Globulin-like protein)	Gea8	Daucus carota (Wild carrot)					VMGGAEK	tr|Q42390|Q42390_DAUCA Daucus carota globulin-like protein OS=Daucus carota OX=4039 GN=Gea8 PE=2 SV=1;tr|A0A164ZA59|A0A164ZA59_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_018830 PE=4 SV=1	0.78478	1.378	0	0	6376.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6376.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
Q8H955	Q8H955_DAUCA	B1 type cyclin	Dauca;CycB1;1	Daucus carota (Wild carrot)	cell cycle [GO:0007049]; cell division [GO:0051301]		cell cycle [GO:0007049]; cell division [GO:0051301]		LKAVYKK	tr|Q8H955|Q8H955_DAUCA B1 type cyclin OS=Daucus carota OX=4039 GN=Dauca;CycB1;1 PE=2 SV=1;tr|Q2PHL0|Q2PHL0_DAUCA Cyclin B1-1 OS=Daucus carota OX=4039 GN=DcCycB1-1 PE=2 SV=1;tr|A0A175YBF1|A0A175YBF1_DAUCS Cyclin N-terminal domain-containing protein OS=Daucu	0.88235	1.378	0	880.46	0	0	0	0	0	0	0	0	0	0	0	0	880.46	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161WPR5	A0A161WPR5_DAUCS	Uncharacterized protein	DCAR_023431	Daucus carota subsp. sativus (Carrot)					GVVFALR	tr|A0A161WPR5|A0A161WPR5_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_023431 PE=4 SV=1;tr|A0A6L2LWC4|A0A6L2LWC4_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_038064 PE=4 SV=1;tr|A0A164SLN3|A0A	0.9	2.1774	0	1508.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1508.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161WQ00	A0A161WQ00_DAUCS	Peroxidase (EC 1.11.1.7)	DCAR_023521	Daucus carota subsp. sativus (Carrot)	hydrogen peroxide catabolic process [GO:0042744]; response to oxidative stress [GO:0006979]	extracellular region [GO:0005576]	extracellular region [GO:0005576]; heme binding [GO:0020037]; metal ion binding [GO:0046872]; peroxidase activity [GO:0004601]; hydrogen peroxide catabolic process [GO:0042744]; response to oxidative stress [GO:0006979]	heme binding [GO:0020037]; metal ion binding [GO:0046872]; peroxidase activity [GO:0004601]	GCPSSGR	tr|A0A161WQ00|A0A161WQ00_DAUCS Peroxidase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_023521 PE=3 SV=1	0.88856	1.378	0	13790	0	12385	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13790	0	0	0	0	0	0	0	0	0	12385	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161WQ99	A0A161WQ99_DAUCS	Helicase ATP-binding domain-containing protein	DCAR_023641	Daucus carota subsp. sativus (Carrot)			ATP binding [GO:0005524]; nucleic acid binding [GO:0003676]	ATP binding [GO:0005524]; nucleic acid binding [GO:0003676]	KQVIYFLR	tr|A0A161WQ99|A0A161WQ99_DAUCS Helicase ATP-binding domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_023641 PE=4 SV=1	0.78788	2.5638	0	0	5647.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5647.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161WQM6	A0A161WQM6_DAUCS	Epidermal patterning factor-like protein	DCAR_009739	Daucus carota subsp. sativus (Carrot)	guard cell differentiation [GO:0010052]	extracellular region [GO:0005576]	extracellular region [GO:0005576]; guard cell differentiation [GO:0010052]		KAKHVLR	tr|A0A161WQM6|A0A161WQM6_DAUCS Epidermal patterning factor-like protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_009739 PE=3 SV=1	0.79531	1.378	0	0	0	0	5187.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5187.5	0
A0A161WQU2	A0A161WQU2_DAUCS	Uncharacterized protein	DCAR_009819	Daucus carota subsp. sativus (Carrot)	male meiosis II [GO:0007142]		male meiosis II [GO:0007142]		PRAVRVR	tr|A0A161WQU2|A0A161WQU2_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_009819 PE=4 SV=1	0.79585	1.378	0	0	0	0	3597.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3597.3
A0A161WSV2	A0A161WSV2_DAUCS	Agenet domain-containing protein	DCAR_010509	Daucus carota subsp. sativus (Carrot)					DSRPLRR	tr|A0A161WSV2|A0A161WSV2_DAUCS Agenet domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_010509 PE=4 SV=1	0.7964	1.378	7780	0	2749.7	0	0	0	0	0	0	0	0	7780	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2749.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161WTE5	A0A161WTE5_DAUCS	TRASH domain-containing protein	DCAR_020788	Daucus carota subsp. sativus (Carrot)					TQKTSGK	tr|A0A161WTE5|A0A161WTE5_DAUCS TRASH domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_020788 PE=3 SV=1	0.88808	1.378	0	0	19439	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19439	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161X2D3	A0A161X2D3_DAUCS	Uncharacterized protein	DCAR_023627	Daucus carota subsp. sativus (Carrot)					EDATDDR	tr|A0A161X2D3|A0A161X2D3_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_023627 PE=4 SV=1	0.79694	1.378	30698	32470	26650	48899	31710	19466	0	22826	30698	0	0	0	30456	0	0	0	32470	0	0	0	0	13291	0	26650	0	0	0	0	0	0	0	20602	19598	48899	0	0	0	0	0	0	0	0	0	20069	0	0	0	31710	0	0
A0A161X3Q8	A0A161X3Q8_DAUCS	BAH domain-containing protein	DCAR_006422	Daucus carota subsp. sativus (Carrot)	amino acid transport [GO:0006865]; chromatin organization [GO:0006325]; methylation [GO:0032259]	integral component of membrane [GO:0016021]; nucleus [GO:0005634]	integral component of membrane [GO:0016021]; nucleus [GO:0005634]; chromatin binding [GO:0003682]; DNA binding [GO:0003677]; methyltransferase activity [GO:0008168]; amino acid transport [GO:0006865]; chromatin organization [GO:0006325]; methylation [GO:0032259]	chromatin binding [GO:0003682]; DNA binding [GO:0003677]; methyltransferase activity [GO:0008168]	DFYLGPK	tr|A0A161X3Q8|A0A161X3Q8_DAUCS BAH domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_006422 PE=3 SV=1	0.79662	1.378	0	14086	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14086	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161X4I0	A0A161X4I0_DAUCS	Uncharacterized protein	DCAR_024487	Daucus carota subsp. sativus (Carrot)			DNA-binding transcription factor activity [GO:0003700]	DNA-binding transcription factor activity [GO:0003700]	KKLPFVR	tr|A0A161X4I0|A0A161X4I0_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_024487 PE=4 SV=1;tr|A0A175YLE8|A0A175YLE8_DAUCS FAD-binding PCMH-type domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_028159 	0.88641	1.378	17319	0	16233	11468	0	0	0	0	0	0	17319	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16233	0	0	0	0	0	0	0	11468	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161X4Z8	A0A161X4Z8_DAUCS	SEC7 domain-containing protein	DCAR_006872	Daucus carota subsp. sativus (Carrot)	protein transport [GO:0015031]; regulation of ARF protein signal transduction [GO:0032012]	cytosol [GO:0005829]; membrane [GO:0016020]	cytosol [GO:0005829]; membrane [GO:0016020]; guanyl-nucleotide exchange factor activity [GO:0005085]; protein transport [GO:0015031]; regulation of ARF protein signal transduction [GO:0032012]	guanyl-nucleotide exchange factor activity [GO:0005085]	VSISPHK	tr|A0A161X4Z8|A0A161X4Z8_DAUCS SEC7 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_006872 PE=4 SV=1	0.89228	1.378	5076.5	0	0	0	3772	0	0	0	0	0	0	5076.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3772
A0A161X5P2	A0A161X5P2_DAUCS	ULP_PROTEASE domain-containing protein	DCAR_007092	Daucus carota subsp. sativus (Carrot)			cysteine-type peptidase activity [GO:0008234]	cysteine-type peptidase activity [GO:0008234]	LNSEEEM	tr|A0A161X5P2|A0A161X5P2_DAUCS ULP_PROTEASE domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_007092 PE=3 SV=1	0.79716	1.378	5322.2	9750.8	0	0	12510	5322.2	0	0	0	0	0	0	0	0	0	0	0	9750.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12510	0	0	0	0	0	0	0
A0A161X6X1	A0A161X6X1_DAUCS	Protein kinase domain-containing protein	DCAR_007512	Daucus carota subsp. sativus (Carrot)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	RAPYHKK	tr|A0A161X6X1|A0A161X6X1_DAUCS Protein kinase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_007512 PE=4 SV=1	0.79771	1.378	10424	0	0	0	13960	0	9519.7	0	0	0	0	10424	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13960
A0A161X7F6	A0A161X7F6_DAUCS	AB hydrolase-1 domain-containing protein	DCAR_025468	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; catalytic activity [GO:0003824]	catalytic activity [GO:0003824]	GSSAMMM	tr|A0A161X7F6|A0A161X7F6_DAUCS AB hydrolase-1 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_025468 PE=4 SV=1	0.79826	1.378	0	0	7584.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7584.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161X7L6	A0A161X7L6_DAUCS	Uncharacterized protein	DCAR_025538	Daucus carota subsp. sativus (Carrot)	phosphate ion transport [GO:0006817]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; phosphate ion transport [GO:0006817]		VHSVGYR	tr|A0A161X7L6|A0A161X7L6_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_025538 PE=3 SV=1	0.88258	1.378	0	0	0	27188	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27188	0	0	0	0	0	0	0	0	0	0	0
A0A161X7P0	A0A161X7P0_DAUCS	Uncharacterized protein	DCAR_025568	Daucus carota subsp. sativus (Carrot)					FGVVVLR	tr|A0A161X7P0|A0A161X7P0_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_025568 PE=4 SV=1	0.7988	1.378	10980	0	10639	11014	0	0	0	0	0	0	0	0	10980	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10639	0	0	0	0	0	0	0	5498.1	11014	8593.6	0	0	0	0	0	0	0	0	0	0	0
A0A161X9I4	A0A161X9I4_DAUCS	Uncharacterized protein	DCAR_026318	Daucus carota subsp. sativus (Carrot)	protein transport [GO:0015031]		protein transport [GO:0015031]		QEFCSDR	tr|A0A161X9I4|A0A161X9I4_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_026318 PE=3 SV=1	0.87359	1.378	7328.5	0	0	0	7805.1	0	0	0	0	0	0	0	0	7328.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6053.3	7805.1	0
A0A161XBG8	A0A161XBG8_DAUCS	Uncharacterized protein	DCAR_022704	Daucus carota subsp. sativus (Carrot)					EEDDEEE	tr|A0A161XBG8|A0A161XBG8_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_022704 PE=4 SV=1	0.88182	1.378	10985	0	0	0	0	0	0	10985	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161XEX2	A0A161XEX2_DAUCS	Glyco_transf_20 domain-containing protein	DCAR_021302	Daucus carota subsp. sativus (Carrot)	trehalose biosynthetic process [GO:0005992]		catalytic activity [GO:0003824]; trehalose biosynthetic process [GO:0005992]	catalytic activity [GO:0003824]	RPKALPK	tr|A0A161XEX2|A0A161XEX2_DAUCS Glyco_transf_20 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_021302 PE=3 SV=1	0.79935	1.378	0	14620	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14620	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161XGB6	A0A161XGB6_DAUCS	Uncharacterized protein	DCAR_006836	Daucus carota subsp. sativus (Carrot)					YVPHAGR	tr|A0A161XGB6|A0A161XGB6_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_006836 PE=4 SV=1	0.89654	1.378	14912	0	0	0	0	0	0	0	0	0	0	0	0	14912	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161XI52	A0A161XI52_DAUCS	Uncharacterized protein	DCAR_007566	Daucus carota subsp. sativus (Carrot)					VVVPVGK	tr|A0A161XI52|A0A161XI52_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_007566 PE=4 SV=1	0.79989	1.378	77924	11478	8153.6	26991	3286.1	0	0	0	0	0	77924	0	5837.5	0	6155.7	6766.1	4445.8	0	0	11478	8766	0	0	3418.4	0	8153.6	0	0	7086.3	0	0	0	0	0	13355	0	11371	26991	5486.9	12907	0	0	0	0	0	0	3286.1	0	0	0
A0A161XIU2	A0A161XIU2_DAUCS	Coatomer subunit zeta	DCAR_007906	Daucus carota subsp. sativus (Carrot)	"protein transport [GO:0015031]; retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum [GO:0006890]"	COPI vesicle coat [GO:0030126]; Golgi membrane [GO:0000139]	"COPI vesicle coat [GO:0030126]; Golgi membrane [GO:0000139]; protein transport [GO:0015031]; retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum [GO:0006890]"		EACPSVK	tr|A0A161XIU2|A0A161XIU2_DAUCS Coatomer subunit zeta OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_007906 PE=3 SV=1;tr|A0A6L5BAU0|A0A6L5BAU0_APIGR Coatomer subunit zeta OS=Apium graveolens OX=4045 GN=AG4045_017589 PE=3 SV=1	0.90168	1.378	0	0	0	0	4028.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4028.5	0	0	0
A0A161XIV0	A0A161XIV0_DAUCS	Bromo domain-containing protein	DCAR_007916	Daucus carota subsp. sativus (Carrot)					CESMNPK	tr|A0A161XIV0|A0A161XIV0_DAUCS Bromo domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_007916 PE=4 SV=1	0.9013	1.378	0	0	0	112540	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	112540	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161XJL1	A0A161XJL1_DAUCS	PPM-type phosphatase domain-containing protein	DCAR_008286	Daucus carota subsp. sativus (Carrot)			protein serine/threonine phosphatase activity [GO:0004722]	protein serine/threonine phosphatase activity [GO:0004722]	LKHGLVR	tr|A0A161XJL1|A0A161XJL1_DAUCS PPM-type phosphatase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_008286 PE=4 SV=1	0.90092	1.378	2265	7825.7	3290.5	0	0	0	0	0	2265	0	0	0	0	0	0	0	0	0	3027	0	0	3057.3	7825.7	0	0	0	0	0	0	3290.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161XK99	A0A161XK99_DAUCS	Uncharacterized protein	DCAR_008526	Daucus carota subsp. sativus (Carrot)					RWPMMYK	tr|A0A161XK99|A0A161XK99_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_008526 PE=4 SV=1	0.80044	1.378	11171	74325	0	73596	24329	11171	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	74325	0	0	0	0	0	0	0	0	0	0	0	73596	0	0	68473	0	0	0	0	0	0	0	0	0	24329	0	0
A0A161XQ96	A0A161XQ96_DAUCS	acidPPc domain-containing protein	DCAR_017041	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		PESPPVR	tr|A0A161XQ96|A0A161XQ96_DAUCS acidPPc domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_017041 PE=4 SV=1	0.90147	1.378	14586	17061	9873.1	0	11354	0	6435.7	14586	0	0	0	0	0	0	17061	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9873.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11354	0	0	0	0
A0A161XSH1	A0A161XSH1_DAUCS	Uncharacterized protein	DCAR_017869	Daucus carota subsp. sativus (Carrot)	regulation of DNA endoreduplication [GO:0032875]		regulation of DNA endoreduplication [GO:0032875]		SLAEDDR	tr|A0A161XSH1|A0A161XSH1_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_017869 PE=4 SV=1	0.80098	1.378	0	0	3491300	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3491300	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161XV59	A0A161XV59_DAUCS	Uncharacterized protein	DCAR_018908	Daucus carota subsp. sativus (Carrot)			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	CCDSGCGK	tr|A0A161XV59|A0A161XV59_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_018908 PE=3 SV=1;tr|A0A5N6PCJ4|A0A5N6PCJ4_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_11086 PE=3 SV=1;tr|A0A2U1KUG1|A0A2U1KUG1	0.88462	1.9368	23144	0	15218	8108.3	17842	0	0	0	0	0	23144	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15218	0	0	0	0	0	0	0	0	0	0	0	8108.3	0	0	17842	0	0	0	0	0	0	0
A0A161XX01	A0A161XX01_DAUCS	Uncharacterized protein	DCAR_009881	Daucus carota subsp. sativus (Carrot)					CDTGFCR	tr|A0A161XX01|A0A161XX01_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_009881 PE=4 SV=1	0.82796	1.378	0	0	0	6709.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6709.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161XXE6	A0A161XXE6_DAUCS	Uncharacterized protein	DCAR_010051	Daucus carota subsp. sativus (Carrot)					DGLNACR	tr|A0A161XXE6|A0A161XXE6_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_010051 PE=4 SV=1	0.80153	1.378	10420	17238	10127	13146	6788.7	8906.8	7799.2	10420	0	0	0	0	0	0	11391	17238	10127	0	0	0	0	0	13103	7883.1	0	0	0	0	10127	0	0	0	0	0	0	13146	12748	0	0	0	0	0	0	0	0	6788.7	0	0	0	0
A0A161XYR3	A0A161XYR3_DAUCS	GH18 domain-containing protein	DCAR_010641	Daucus carota subsp. sativus (Carrot)	carbohydrate metabolic process [GO:0005975]		"hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]; carbohydrate metabolic process [GO:0005975]"	"hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]"	TFSSAIK	tr|A0A161XYR3|A0A161XYR3_DAUCS GH18 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_010641 PE=3 SV=1	0.82803	1.378	12872	13672	7374.1	0	0	0	0	0	0	12872	0	6683.8	0	3626.1	0	0	0	0	0	0	0	13672	0	0	0	0	0	0	0	7374.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161Y305	A0A161Y305_DAUCS	Uncharacterized protein	DCAR_023653	Daucus carota subsp. sativus (Carrot)			transferase activity [GO:0016740]	transferase activity [GO:0016740]	GQQHLTK	tr|A0A161Y305|A0A161Y305_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_023653 PE=4 SV=1	0.80207	1.378	0	14798	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14798	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161Y4S5	A0A161Y4S5_DAUCS	PseudoU_synth_2 domain-containing protein	DCAR_024363	Daucus carota subsp. sativus (Carrot)	pseudouridine synthesis [GO:0001522]		pseudouridine synthase activity [GO:0009982]; RNA binding [GO:0003723]; pseudouridine synthesis [GO:0001522]	pseudouridine synthase activity [GO:0009982]; RNA binding [GO:0003723]	PPKLPVK	tr|A0A161Y4S5|A0A161Y4S5_DAUCS PseudoU_synth_2 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_024363 PE=4 SV=1	0.81666	1.378	36878	32277	26491	6014.3	20669	28483	32454	26147	29077	0	0	0	36878	0	25570	0	0	24980	0	0	0	32277	0	0	0	0	0	0	0	0	25621	26491	0	6014.3	0	0	0	0	0	0	0	0	0	20669	0	9864.3	0	0	0	0
A0A161Y530	A0A161Y530_DAUCS	Uncharacterized protein	DCAR_024473	Daucus carota subsp. sativus (Carrot)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]	DNA binding [GO:0003677]	PRPAPRK	tr|A0A161Y530|A0A161Y530_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_024473 PE=4 SV=1	0.87726	1.378	0	28991	20391	11649	13205	0	0	0	0	0	0	0	0	0	0	4697.2	0	0	0	19607	28991	0	0	0	0	20391	0	0	0	0	0	0	0	0	0	0	0	7452.8	0	11649	0	13205	0	0	0	0	9310.5	0	0	0
A0A161Y5P1	A0A161Y5P1_DAUCS	Response regulatory domain-containing protein	DCAR_005494	Daucus carota subsp. sativus (Carrot)	phosphorelay signal transduction system [GO:0000160]		phosphorelay signal transduction system [GO:0000160]		NLLHKPK	tr|A0A161Y5P1|A0A161Y5P1_DAUCS Response regulatory domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_005494 PE=4 SV=1	0.80174	1.378	4372.9	0	0	0	0	0	0	0	0	0	0	4372.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161Y706	A0A161Y706_DAUCS	3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)	DCAR_025214	Daucus carota subsp. sativus (Carrot)	pantothenate biosynthetic process [GO:0015940]		3-methyl-2-oxobutanoate hydroxymethyltransferase activity [GO:0003864]; pantothenate biosynthetic process [GO:0015940]	3-methyl-2-oxobutanoate hydroxymethyltransferase activity [GO:0003864]	VVASVIK	tr|A0A161Y706|A0A161Y706_DAUCS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_025214 PE=3 SV=1	0.80229	1.378	76008	26565	90533	66148	9311.5	0	22792	0	76008	71440	0	0	25928	0	0	0	0	26565	13058	0	0	0	0	33272	36668	0	0	0	0	82619	0	90533	66148	59782	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9311.5	0
A0A161Y8P1	A0A161Y8P1_DAUCS	ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)	DCAR_025884	Daucus carota subsp. sativus (Carrot)			ATP-dependent peptidase activity [GO:0004176]; serine-type endopeptidase activity [GO:0004252]	ATP-dependent peptidase activity [GO:0004176]; serine-type endopeptidase activity [GO:0004252]	YCMPNAR	tr|A0A161Y8P1|A0A161Y8P1_DAUCS ATP-dependent Clp protease proteolytic subunit OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_025884 PE=3 SV=1	0.82611	1.378	45113	44631	38294	49142	0	0	45113	35877	0	0	0	0	0	0	41542	0	0	44631	0	0	0	0	0	37741	0	0	0	0	0	38294	0	0	36348	33847	0	49142	47044	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161YA61	A0A161YA61_DAUCS	Lipase_3 domain-containing protein	DCAR_026434	Daucus carota subsp. sativus (Carrot)	lipid metabolic process [GO:0006629]		triglyceride lipase activity [GO:0004806]; lipid metabolic process [GO:0006629]	triglyceride lipase activity [GO:0004806]	QLLRKHK	tr|A0A161YA61|A0A161YA61_DAUCS Lipase_3 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_026434 PE=4 SV=1;tr|A0A2J6JZJ6|A0A2J6JZJ6_LACSA O-fucosyltransferase family protein OS=Lactuca sativa OX=4236 GN=LSAT_8X82321 PE=3 SV=1	0.82477	1.378	0	71034	51441	65484	56182	0	0	0	0	0	0	0	0	0	0	0	71034	0	0	0	0	0	0	51441	0	0	0	0	0	0	0	0	0	0	65484	0	54945	59567	0	0	0	0	0	0	0	0	46838	0	56182	0
A0A161YJD7	A0A161YJD7_DAUCS	MBOAT_2 domain-containing protein	DCAR_016644	Daucus carota subsp. sativus (Carrot)	lipid metabolic process [GO:0006629]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; O-acyltransferase activity [GO:0008374]; lipid metabolic process [GO:0006629]	O-acyltransferase activity [GO:0008374]	LNMEGEM	tr|A0A161YJD7|A0A161YJD7_DAUCS MBOAT_2 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_016644 PE=3 SV=1	0.79367	1.378	139870	41919	0	0	0	0	0	0	0	139870	0	0	0	0	0	0	0	41919	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161YJH4	A0A161YJH4_DAUCS	Uncharacterized protein	DCAR_016694	Daucus carota subsp. sativus (Carrot)	mismatch repair [GO:0006298]	mismatch repair complex [GO:0032300]	mismatch repair complex [GO:0032300]; ATP binding [GO:0005524]; mismatched DNA binding [GO:0030983]; mismatch repair [GO:0006298]	ATP binding [GO:0005524]; mismatched DNA binding [GO:0030983]	IAIVHLK	tr|A0A161YJH4|A0A161YJH4_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_016694 PE=3 SV=1	0.86881	1.378	0	0	0	0	41010	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	41010	0	0
A0A161YKK0	A0A161YKK0_DAUCS	Uncharacterized protein	DCAR_017194	Daucus carota subsp. sativus (Carrot)					EGEECCK	tr|A0A161YKK0|A0A161YKK0_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_017194 PE=4 SV=1	0.79312	1.378	15288	12859	0	19324	12715	0	15288	7277.2	0	0	0	0	0	0	0	6693.1	0	0	0	0	0	12859	0	0	0	0	0	0	0	0	0	0	0	11791	0	19324	6179.6	0	0	0	13955	0	8240.2	0	12715	0	0	0	0	0
A0A161YLN1	A0A161YLN1_DAUCS	t-SNARE coiled-coil homology domain-containing protein	DCAR_017712	Daucus carota subsp. sativus (Carrot)	intracellular protein transport [GO:0006886]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; SNAP receptor activity [GO:0005484]; intracellular protein transport [GO:0006886]	SNAP receptor activity [GO:0005484]	VETICQK	tr|A0A161YLN1|A0A161YLN1_DAUCS t-SNARE coiled-coil homology domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_017712 PE=3 SV=1	0.86699	1.378	7077.4	12732	0	0	0	0	0	0	7077.4	0	0	0	0	0	0	0	0	12732	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161YN19	A0A161YN19_DAUCS	Uncharacterized protein	DCAR_018401	Daucus carota subsp. sativus (Carrot)					ISEMNYY	tr|A0A161YN19|A0A161YN19_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_018401 PE=4 SV=1	0.86672	1.378	7613.9	0	0	0	0	0	0	0	7613.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161YNG3	A0A161YNG3_DAUCS	Uncharacterized protein	DCAR_018601	Daucus carota subsp. sativus (Carrot)					STGDAGR	tr|A0A161YNG3|A0A161YNG3_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_018601 PE=4 SV=1	0.79258	1.378	6220.5	0	0	0	0	0	0	0	0	6220.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161ZI46	A0A161ZI46_DAUCS	Uncharacterized protein	DCAR_023666	Daucus carota subsp. sativus (Carrot)	phosphate ion transport [GO:0006817]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857]; phosphate ion transport [GO:0006817]	transmembrane transporter activity [GO:0022857]	GCPPRPK	tr|A0A161ZI46|A0A161ZI46_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_023666 PE=3 SV=1	0.78939	1.378	8363.6	6921.1	9112	6517.4	6190.8	8363.6	7846.1	7786	0	0	0	0	7580.8	0	6921.1	0	0	0	0	0	0	0	0	5926.1	0	0	0	0	0	0	0	9112	0	0	0	0	0	0	0	0	6517.4	0	0	0	0	0	0	0	6190.8	0
A0A161ZJI2	A0A161ZJI2_DAUCS	Uncharacterized protein	DCAR_024296	Daucus carota subsp. sativus (Carrot)	phosphate ion transport [GO:0006817]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; phosphate ion transport [GO:0006817]		EECCDMR	tr|A0A161ZJI2|A0A161ZJI2_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_024296 PE=3 SV=1	0.90551	1.378	11324	0	18839	0	0	0	0	0	0	0	0	0	11324	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18839	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161ZJJ5	A0A161ZJJ5_DAUCS	Uncharacterized protein	DCAR_024316	Daucus carota subsp. sativus (Carrot)					DEVPCGM	tr|A0A161ZJJ5|A0A161ZJJ5_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_024316 PE=4 SV=1	0.78587	1.378	8264.7	0	0	0	6890.9	0	0	0	0	0	0	0	8264.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6890.9	0	0	0	0	0	0
A0A161ZKA3	A0A161ZKA3_DAUCS	IPPc domain-containing protein	DCAR_023544	Daucus carota subsp. sativus (Carrot)	phosphatidylinositol dephosphorylation [GO:0046856]		phosphatase activity [GO:0016791]; phosphatidylinositol dephosphorylation [GO:0046856]	phosphatase activity [GO:0016791]	RAILSNK	tr|A0A161ZKA3|A0A161ZKA3_DAUCS IPPc domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_023544 PE=3 SV=1;tr|A0A251S2L3|A0A251S2L3_HELAN Putative endonuclease/exonuclease/phosphatase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr16g05275	0.78642	1.378	786020	747440	837270	513990	542580	445500	363490	414960	482310	549810	786020	445420	0	429890	415610	0	542940	500850	582760	567620	526490	479040	747440	303770	312410	361110	382220	604860	425250	457140	368020	837270	430960	426830	375750	513990	429440	433500	418980	457060	460070	466120	542580	273780	304590	286150	306770	362700	358250	328240
A0A161ZKB4	A0A161ZKB4_DAUCS	ENTH domain-containing protein	DCAR_023554	Daucus carota subsp. sativus (Carrot)	clathrin coat assembly [GO:0048268]; endocytosis [GO:0006897]	clathrin-coated pit [GO:0005905]; clathrin-coated vesicle [GO:0030136]; Golgi apparatus [GO:0005794]	clathrin-coated pit [GO:0005905]; clathrin-coated vesicle [GO:0030136]; Golgi apparatus [GO:0005794]; 1-phosphatidylinositol binding [GO:0005545]; clathrin binding [GO:0030276]; clathrin coat assembly [GO:0048268]; endocytosis [GO:0006897]	1-phosphatidylinositol binding [GO:0005545]; clathrin binding [GO:0030276]	CLVLLHR	tr|A0A161ZKB4|A0A161ZKB4_DAUCS ENTH domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_023554 PE=4 SV=1	0.84857	1.378	0	3482.6	0	0	0	0	0	0	0	0	0	0	0	0	0	3482.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161ZML3	A0A161ZML3_DAUCS	Uncharacterized protein	DCAR_024614	Daucus carota subsp. sativus (Carrot)					NLILHAK	tr|A0A161ZML3|A0A161ZML3_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_024614 PE=3 SV=1	0.78654	1.378	0	0	6596.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6596.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161ZPB3	A0A161ZPB3_DAUCS	Uncharacterized protein	DCAR_025295	Daucus carota subsp. sativus (Carrot)		nucleus [GO:0005634]	nucleus [GO:0005634]		VQLGMHK	tr|A0A161ZPB3|A0A161ZPB3_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_025295 PE=4 SV=1	0.85727	1.378	73288	0	0	0	0	0	73288	0	0	18221	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161ZQF7	A0A161ZQF7_DAUCS	SKP1-like protein	DCAR_022815	Daucus carota subsp. sativus (Carrot)	protein ubiquitination [GO:0016567]; ubiquitin-dependent protein catabolic process [GO:0006511]		cullin family protein binding [GO:0097602]; protein ubiquitination [GO:0016567]; ubiquitin-dependent protein catabolic process [GO:0006511]	cullin family protein binding [GO:0097602]	REVEEEEEPTFDKNINFK	"tr|A0A161ZQF7|A0A161ZQF7_DAUCS SKP1-like protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_022815 PE=3 SV=1;tr|A0A251T406|A0A251T406_HELAN Putative SKP1 component, dimerization OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr12g0374721 PE=4 SV=1;tr|A0A6S"	0.82051	2.3659	0	0	372810	6217.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	372810	0	0	0	0	0	0	0	0	0	0	0	0	0	6217.7	0	0	0	0	0	0	0	0	0	0
A0A161ZR31	A0A161ZR31_DAUCS	Rab-GAP TBC domain-containing protein	DCAR_022533	Daucus carota subsp. sativus (Carrot)					SMNREEK	tr|A0A161ZR31|A0A161ZR31_DAUCS Rab-GAP TBC domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_022533 PE=4 SV=1	0.78665	1.378	264160	155660	333510	25686	33466	0	0	0	0	0	264160	0	0	0	0	0	0	0	0	0	0	155660	0	0	0	25369	0	0	0	0	333510	0	0	0	0	0	0	25686	23693	0	0	33466	21359	0	0	0	0	0	0	0
A0A161ZSY5	A0A161ZSY5_DAUCS	C2 NT-type domain-containing protein	DCAR_021770 DCAR_021773	Daucus carota subsp. sativus (Carrot)		nuclear pore [GO:0005643]	nuclear pore [GO:0005643]		GSNSTTM	tr|A0A161ZSY5|A0A161ZSY5_DAUCS C2 NT-type domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_021770 PE=3 SV=1	0.7872	1.378	0	0	6932.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6932.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161ZTU7	A0A161ZTU7_DAUCS	LEA_2 domain-containing protein	DCAR_022525	Daucus carota subsp. sativus (Carrot)	defense response to other organism [GO:0098542]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; defense response to other organism [GO:0098542]		GFFMQHR	tr|A0A161ZTU7|A0A161ZTU7_DAUCS LEA_2 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_022525 PE=4 SV=1	0.78775	1.378	0	0	15485	18471	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15485	0	0	0	0	0	0	0	18471	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161ZV52	A0A161ZV52_DAUCS	IU_nuc_hydro domain-containing protein	DCAR_020763	Daucus carota subsp. sativus (Carrot)	metabolic process [GO:0008152]		"hydrolase activity, acting on ester bonds [GO:0016788]; hydrolase activity, acting on glycosyl bonds [GO:0016798]; metabolic process [GO:0008152]"	"hydrolase activity, acting on ester bonds [GO:0016788]; hydrolase activity, acting on glycosyl bonds [GO:0016798]"	VVVKKGK	tr|A0A161ZV52|A0A161ZV52_DAUCS IU_nuc_hydro domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_020763 PE=3 SV=1	0.78829	1.378	0	25113	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25113	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161ZXX4	A0A161ZXX4_DAUCS	Uncharacterized protein	DCAR_020595	Daucus carota subsp. sativus (Carrot)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	LLHVGKK	tr|A0A161ZXX4|A0A161ZXX4_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_020595 PE=4 SV=1	0.94149	1.378	0	9760.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8322.1	9760.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A161ZZ36	A0A161ZZ36_DAUCS	Vps54 domain-containing protein	DCAR_001341	Daucus carota subsp. sativus (Carrot)	"protein transport [GO:0015031]; retrograde transport, endosome to Golgi [GO:0042147]"	cytosol [GO:0005829]; GARP complex [GO:0000938]	"cytosol [GO:0005829]; GARP complex [GO:0000938]; protein transport [GO:0015031]; retrograde transport, endosome to Golgi [GO:0042147]"		FGGEDGQ	tr|A0A161ZZ36|A0A161ZZ36_DAUCS Vps54 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_001341 PE=3 SV=1	0.94372	1.378	0	0	4463.1	0	3580	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4463.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3580	0	0	0	0
A0A161ZZ42	A0A161ZZ42_DAUCS	Protein kinase domain-containing protein	DCAR_020025	Daucus carota subsp. sativus (Carrot)			ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	NEFAHVR	tr|A0A161ZZ42|A0A161ZZ42_DAUCS Protein kinase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_020025 PE=4 SV=1	0.94915	1.378	0	0	0	0	7434.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7434.6	0	0	0	0	0	0	0
A0A161ZZQ4	A0A161ZZQ4_DAUCS	15-cis-phytoene desaturase	PDS DCAR_016085	Daucus carota subsp. sativus (Carrot)			oxidoreductase activity [GO:0016491]	oxidoreductase activity [GO:0016491]	FTRTRPR	tr|A0A161ZZQ4|A0A161ZZQ4_DAUCS 15-cis-phytoene desaturase OS=Daucus carota subsp. sativus OX=79200 GN=PDS PE=4 SV=1;tr|Q2VER7|Q2VER7_DAUCS Phytoene dehydrogenase OS=Daucus carota subsp. sativus OX=79200 GN=PDS PE=2 SV=1	0.92186	1.378	12572	22286	16624	0	13307	0	0	12572	0	0	0	0	0	0	12794	0	21695	0	0	0	0	0	22286	16570	0	0	0	0	0	0	0	16624	0	0	0	0	0	0	0	0	0	0	0	0	0	13307	0	0	0	0
A0A161ZZS0	A0A161ZZS0_DAUCS	Lipoxygenase (EC 1.13.11.-)	DCAR_016115	Daucus carota subsp. sativus (Carrot)	fatty acid biosynthetic process [GO:0006633]; oxylipin biosynthetic process [GO:0031408]		"metal ion binding [GO:0046872]; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702]; fatty acid biosynthetic process [GO:0006633]; oxylipin biosynthetic process [GO:0031408]"	"metal ion binding [GO:0046872]; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702]"	DEDPIRR	tr|A0A161ZZS0|A0A161ZZS0_DAUCS Lipoxygenase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_016115 PE=3 SV=1;tr|A0A6L5B9V3|A0A6L5B9V3_APIGR Lipoxygenase OS=Apium graveolens OX=4045 GN=AG4045_007851 PE=3 SV=1	0.78884	1.378	0	0	0	29569	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27697	0	0	29569	0	0	0	0	0	0	0	0	0	0	0
A0A162A1B6	A0A162A1B6_DAUCS	Histone H2A	DCAR_017885	Daucus carota subsp. sativus (Carrot)		nucleosome [GO:0000786]; nucleus [GO:0005634]	nucleosome [GO:0000786]; nucleus [GO:0005634]; DNA binding [GO:0003677]; protein heterodimerization activity [GO:0046982]	DNA binding [GO:0003677]; protein heterodimerization activity [GO:0046982]	SPGGGGK	tr|A0A162A1B6|A0A162A1B6_DAUCS Histone H2A OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_017885 PE=3 SV=1	0.78993	1.378	0	0	16132	3987.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16132	0	0	0	0	0	0	0	0	0	3987.6	0	0	0	0	0	0	0	0	0	0	0	0
A0A162A246	A0A162A246_DAUCS	Uncharacterized protein	DCAR_018244	Daucus carota subsp. sativus (Carrot)	RNA processing [GO:0006396]		RNA processing [GO:0006396]		AECVRSR	tr|A0A162A246|A0A162A246_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_018244 PE=4 SV=1	0.79005	1.378	0	34209	0	325480	59951	0	0	0	0	0	0	0	0	0	0	0	34209	0	0	0	20637	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	70064	0	325480	53419	0	0	59951	0	0	0	0	0	0
A0A162A342	A0A162A342_DAUCS	Uncharacterized protein	DCAR_017713	Daucus carota subsp. sativus (Carrot)					SGCYVRK	tr|A0A162A342|A0A162A342_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_017713 PE=4 SV=1	0.94557	1.378	0	0	26867	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26867	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A162A3I5	A0A162A3I5_DAUCS	Uncharacterized protein	DCAR_017932	Daucus carota subsp. sativus (Carrot)			ATP binding [GO:0005524]	ATP binding [GO:0005524]	HGCAVRR	tr|A0A162A3I5|A0A162A3I5_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_017932 PE=3 SV=1	0.79016	1.378	0	0	18578	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18578	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A162A5C7	A0A162A5C7_DAUCS	GH18 domain-containing protein	DCAR_018862	Daucus carota subsp. sativus (Carrot)	carbohydrate metabolic process [GO:0005975]		"hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]; carbohydrate metabolic process [GO:0005975]"	"hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]"	DKHSNVR	tr|A0A162A5C7|A0A162A5C7_DAUCS GH18 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_018862 PE=3 SV=1;tr|A0A6L2NTC1|A0A6L2NTC1_TANCI Phospholipase-like protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_061589 PE=4 SV=1;tr|A0A6	0.93355	1.378	0	0	28783	25809	35590	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28783	0	0	0	0	0	0	25809	0	0	0	0	0	0	0	35590	0	0	0	0	0	0	0
A0A162A6D8	A0A162A6D8_DAUCS	Uncharacterized protein	DCAR_015806	Daucus carota subsp. sativus (Carrot)		nucleus [GO:0005634]	nucleus [GO:0005634]		VHNQHHK	tr|A0A162A6D8|A0A162A6D8_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_015806 PE=4 SV=1	0.79071	1.378	0	0	0	9699.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9699.2	0	0	0	0	0	0	0	0	0	0	0
A0A162A733	A0A162A733_DAUCS	Vacuolar protein sorting-associated protein 41 homolog	DCAR_015496	Daucus carota subsp. sativus (Carrot)	endosomal vesicle fusion [GO:0034058]; intracellular protein transport [GO:0006886]; vacuolar transport [GO:0007034]	HOPS complex [GO:0030897]; late endosome [GO:0005770]	HOPS complex [GO:0030897]; late endosome [GO:0005770]; endosomal vesicle fusion [GO:0034058]; intracellular protein transport [GO:0006886]; vacuolar transport [GO:0007034]		DENDGDR	tr|A0A162A733|A0A162A733_DAUCS Vacuolar protein sorting-associated protein 41 homolog OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_015496 PE=3 SV=1	0.79126	1.378	0	0	14462	12419	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14462	0	0	0	0	0	0	0	12419	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A162A743	A0A162A743_DAUCS	Epimerase domain-containing protein	DCAR_015486	Daucus carota subsp. sativus (Carrot)			catalytic activity [GO:0003824]	catalytic activity [GO:0003824]	LVASSAM	tr|A0A162A743|A0A162A743_DAUCS Epimerase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_015486 PE=4 SV=1	0.7918	1.378	0	0	12833	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12833	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A162A8U9	A0A162A8U9_DAUCS	Uncharacterized protein	DCAR_015458	Daucus carota subsp. sativus (Carrot)					EEDGENM	tr|A0A162A8U9|A0A162A8U9_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_015458 PE=4 SV=1	0.79235	1.378	0	0	5809.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5809.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A162AAX8	A0A162AAX8_DAUCS	Glycerophosphodiester phosphodiesterase (EC 3.1.4.46)	DCAR_014488	Daucus carota subsp. sativus (Carrot)	glycerol metabolic process [GO:0006071]; lipid metabolic process [GO:0006629]; signal transduction [GO:0007165]		glycerophosphodiester phosphodiesterase activity [GO:0008889]; glycerol metabolic process [GO:0006071]; lipid metabolic process [GO:0006629]; signal transduction [GO:0007165]	glycerophosphodiester phosphodiesterase activity [GO:0008889]	LIPELIQ	tr|A0A162AAX8|A0A162AAX8_DAUCS Glycerophosphodiester phosphodiesterase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_014488 PE=4 SV=1	0.92807	1.378	0	0	0	25516	15951	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17536	25516	0	0	0	0	0	0	0	15951	0	0	0
A0A162ABU2	A0A162ABU2_DAUCS	WAT1-related protein	DCAR_014098	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857]	transmembrane transporter activity [GO:0022857]	YAAAAAK	tr|A0A162ABU2|A0A162ABU2_DAUCS WAT1-related protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_014098 PE=3 SV=1	0.79246	1.378	0	0	0	10087	2932.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10087	0	0	0	0	0	0	2932.1	0	0	0	0
A0A162ACJ9	A0A162ACJ9_DAUCS	F-box domain-containing protein	DCAR_013416	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		EEEAKRR	"tr|A0A162ACJ9|A0A162ACJ9_DAUCS F-box domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_013416 PE=4 SV=1;tr|A0A699IMT8|A0A699IMT8_TANCI F-box domain, leucine-rich repeat domain, L domain-like protein OS=Tanacetum cinerariifolium OX="	0.81944	2.0851	0	0	13901	14936	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13901	0	0	0	0	0	0	0	14936	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A162AD57	A0A162AD57_DAUCS	Uncharacterized protein	DCAR_013166	Daucus carota subsp. sativus (Carrot)					EVAGVPA	tr|A0A162AD57|A0A162AD57_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_013166 PE=4 SV=1	0.94077	1.378	20220	0	26532	40167	50235	20220	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13545	26532	0	0	0	0	0	0	0	0	0	0	40167	0	0	0	38709	0	0	50235	0	7172.5	4548.5	0	11439	0	0
A0A162ADW9	A0A162ADW9_DAUCS	Vacuolar protein sorting-associated protein 11 homolog	DCAR_012906	Daucus carota subsp. sativus (Carrot)	intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	CORVET complex [GO:0033263]; HOPS complex [GO:0030897]; plant-type vacuole membrane [GO:0009705]	CORVET complex [GO:0033263]; HOPS complex [GO:0030897]; plant-type vacuole membrane [GO:0009705]; metal ion binding [GO:0046872]; intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	metal ion binding [GO:0046872]	PGMILER	tr|A0A162ADW9|A0A162ADW9_DAUCS Vacuolar protein sorting-associated protein 11 homolog OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_012906 PE=3 SV=1	0.80294	1.378	11149	0	5312.7	0	0	0	11149	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5312.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A162AGS1	A0A162AGS1_DAUCS	Reverse transcriptase Ty1/copia-type domain-containing protein	DCAR_009587	Daucus carota subsp. sativus (Carrot)					LYVHDPK	tr|A0A162AGS1|A0A162AGS1_DAUCS Reverse transcriptase Ty1/copia-type domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_009587 PE=4 SV=1;tr|A0A6L2JMH5|A0A6L2JMH5_TANCI Copia protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_01023	0.81294	1.378	0	18931	0	18167	13821	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18931	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16362	18167	0	0	13821	0	0	0	0	0	0	0	0
A0A162AGZ2	A0A162AGZ2_DAUCS	Uncharacterized protein	DCAR_009677	Daucus carota subsp. sativus (Carrot)					LHGKILK	tr|A0A162AGZ2|A0A162AGZ2_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_009677 PE=4 SV=1	0.92863	1.378	0	0	47049	51478	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	47049	0	0	0	0	0	51478	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A162AK30	A0A162AK30_DAUCS	ATPase_AAA_core domain-containing protein	DCAR_002802	Daucus carota subsp. sativus (Carrot)	fatty acid beta-oxidation [GO:0006635]; protein import into peroxisome matrix [GO:0016558]		ATP binding [GO:0005524]; fatty acid beta-oxidation [GO:0006635]; protein import into peroxisome matrix [GO:0016558]	ATP binding [GO:0005524]	RVPNRHR	tr|A0A162AK30|A0A162AK30_DAUCS ATPase_AAA_core domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_002802 PE=4 SV=1	0.94226	1.378	32392	31217	25125	0	0	0	32392	0	0	0	0	0	0	0	0	0	0	13491	31217	0	0	0	0	0	0	0	0	0	0	0	25125	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A162AKY2	A0A162AKY2_DAUCS	BRO1 domain-containing protein	DCAR_011407	Daucus carota subsp. sativus (Carrot)					RPNGGTK	tr|A0A162AKY2|A0A162AKY2_DAUCS BRO1 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_011407 PE=3 SV=1	0.80834	1.378	6437.7	0	0	0	0	0	0	0	0	0	0	6437.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A162AQB1	A0A162AQB1_DAUCS	Uncharacterized protein	DCAR_005160	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		HVKAIIK	tr|A0A162AQB1|A0A162AQB1_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_005160 PE=4 SV=1	0.80888	1.378	2095.7	0	32812	4487.6	0	2095.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32812	0	0	0	0	0	0	0	0	4487.6	0	0	0	0	0	0	0	0	0	0	0	0
A0A162AQJ8	A0A162AQJ8_DAUCS	Glycosyltransferase (EC 2.4.1.-)	DCAR_005250	Daucus carota subsp. sativus (Carrot)	terpenoid biosynthetic process [GO:0016114]		UDP-glycosyltransferase activity [GO:0008194]; terpenoid biosynthetic process [GO:0016114]	UDP-glycosyltransferase activity [GO:0008194]	AFGSENV	tr|A0A162AQJ8|A0A162AQJ8_DAUCS Glycosyltransferase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_005250 PE=3 SV=1	0.92869	1.378	24768	0	0	19594	19534	0	0	0	0	24768	0	0	0	21627	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19594	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19534	0
A0A162AQV2	A0A162AQV2_DAUCS	F-box domain-containing protein	DCAR_005370	Daucus carota subsp. sativus (Carrot)					MSIEQWK	tr|A0A162AQV2|A0A162AQV2_DAUCS F-box domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_005370 PE=4 SV=1	0.80942	1.378	0	6545.5	6902.4	0	0	0	0	0	0	0	0	0	0	0	0	6545.5	0	0	0	0	0	0	0	0	0	0	0	0	6902.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A162AVH8	A0A162AVH8_DAUCS	Uncharacterized protein	DCAR_007300	Daucus carota subsp. sativus (Carrot)	nucleosome assembly [GO:0006334]	nucleosome [GO:0000786]; nucleus [GO:0005634]	nucleosome [GO:0000786]; nucleus [GO:0005634]; DNA binding [GO:0003677]; hydrolase activity [GO:0016787]; nucleosome assembly [GO:0006334]	DNA binding [GO:0003677]; hydrolase activity [GO:0016787]	GPCRPPK	tr|A0A162AVH8|A0A162AVH8_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_007300 PE=3 SV=1	0.84755	1.378	3000.5	0	0	0	492960	3000.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	492960
A0A162AWB0	A0A162AWB0_DAUCS	Uncharacterized protein	DCAR_007580	Daucus carota subsp. sativus (Carrot)	determination of dorsal identity [GO:0048263]; integument development [GO:0080060]; leaf morphogenesis [GO:0009965]; meristem initiation [GO:0010014]; phloem or xylem histogenesis [GO:0010087]; regulation of meristem growth [GO:0010075]	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; lipid binding [GO:0008289]; transcription cis-regulatory region binding [GO:0000976]; determination of dorsal identity [GO:0048263]; integument development [GO:0080060]; leaf morphogenesis [GO:0009965]; meristem initiation [GO:0010014]; phloem or xylem histogenesis [GO:0010087]; regulation of meristem growth [GO:0010075]	DNA-binding transcription factor activity [GO:0003700]; lipid binding [GO:0008289]; transcription cis-regulatory region binding [GO:0000976]	DCSMAMM	tr|A0A162AWB0|A0A162AWB0_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_007580 PE=3 SV=1;tr|A0A5N6NBG9|A0A5N6NBG9_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_22803 PE=3 SV=1	0.80952	1.378	0	0	12011	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12011	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A162AWK5	A0A162AWK5_DAUCS	Uncharacterized protein	DCAR_007670	Daucus carota subsp. sativus (Carrot)		mitochondrial proton-transporting ATP synthase complex [GO:0005753]; plastid [GO:0009536]	mitochondrial proton-transporting ATP synthase complex [GO:0005753]; plastid [GO:0009536]		AMRNFYK	tr|A0A162AWK5|A0A162AWK5_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_007670 PE=4 SV=1	0.86675	1.378	0	8580.8	10289	16204	8238.2	0	0	0	0	0	0	0	0	0	0	8580.8	0	0	0	0	8167.9	0	0	0	0	0	10289	0	0	0	0	0	0	0	9963.6	0	0	0	0	16204	0	8238.2	0	0	0	0	0	0	0	0
A0A162AWY1	A0A162AWY1_DAUCS	Hydrolase_4 domain-containing protein	DCAR_007840	Daucus carota subsp. sativus (Carrot)					PMWPLEK	tr|A0A162AWY1|A0A162AWY1_DAUCS Hydrolase_4 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_007840 PE=4 SV=1	0.86576	1.378	49513	59220	39129	83511	66034	48763	0	26255	0	29587	49513	0	34851	0	0	35658	0	59220	36795	0	0	0	52897	0	0	0	0	0	37268	22988	39129	0	0	44508	0	0	0	0	0	83511	0	0	0	0	0	0	66034	0	0	8668.9
A0A162AZF8	A0A162AZF8_DAUCS	Gnk2-homologous domain-containing protein	DCAR_000702	Daucus carota subsp. sativus (Carrot)					NFFGAAK	tr|A0A162AZF8|A0A162AZF8_DAUCS Gnk2-homologous domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_000702 PE=4 SV=1	0.85926	1.378	0	0	3003.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3003.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A162B445	A0A162B445_DAUCS	Uncharacterized protein	DCAR_002419	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SSSSSSM	tr|A0A162B445|A0A162B445_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_002419 PE=4 SV=1;tr|A0A166AWQ0|A0A166AWQ0_DAUCS TF-B3 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_010786 PE=4 SV=1	0.81006	1.378	11389	37552	17384	30542	13060	6762.8	7074.1	0	0	0	0	0	11389	0	0	26128	15495	0	0	17174	37552	0	0	17384	0	11417	0	0	15124	0	0	0	0	0	0	0	11396	30542	21832	0	4773.5	10401	11600	0	12251	4729.5	13060	0	0	0
A0A164SIS5	A0A164SIS5_DAUCS	Uncharacterized protein	DCAR_023285	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		IRPLYKR	tr|A0A164SIS5|A0A164SIS5_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_023285 PE=4 SV=1	0.81017	1.378	0	0	14986	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14986	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164SJC3	A0A164SJC3_DAUCS	Bet_v_1 domain-containing protein	DCAR_023318	Daucus carota subsp. sativus (Carrot)	abscisic acid-activated signaling pathway [GO:0009738]; defense response [GO:0006952]		abscisic acid binding [GO:0010427]; protein phosphatase inhibitor activity [GO:0004864]; signaling receptor activity [GO:0038023]; abscisic acid-activated signaling pathway [GO:0009738]; defense response [GO:0006952]	abscisic acid binding [GO:0010427]; protein phosphatase inhibitor activity [GO:0004864]; signaling receptor activity [GO:0038023]	LIHLGDG	tr|A0A164SJC3|A0A164SJC3_DAUCS Bet_v_1 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_023318 PE=4 SV=1	0.88713	1.378	19722	38993	19127	25636	24987	0	0	0	18556	19722	0	0	0	0	0	0	0	38993	0	0	0	0	0	0	12153	0	0	0	0	0	0	19127	8908.2	23867	0	25636	0	0	0	0	0	0	0	0	0	0	24987	0	0	0
A0A164SKE4	A0A164SKE4_DAUCS	Uncharacterized protein	DCAR_023370	Daucus carota subsp. sativus (Carrot)	protein-chromophore linkage [GO:0018298]; response to stimulus [GO:0050896]		ATP binding [GO:0005524]; photoreceptor activity [GO:0009881]; protein kinase activity [GO:0004672]; protein-chromophore linkage [GO:0018298]; response to stimulus [GO:0050896]	ATP binding [GO:0005524]; photoreceptor activity [GO:0009881]; protein kinase activity [GO:0004672]	SNAGDGS	tr|A0A164SKE4|A0A164SKE4_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_023370 PE=4 SV=1	0.88761	1.378	4463.1	12471	0	0	0	0	0	0	0	0	0	0	4463.1	0	0	0	10618	0	0	0	12471	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164SMQ5	A0A164SMQ5_DAUCS	Uncharacterized protein	DCAR_023482	Daucus carota subsp. sativus (Carrot)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]	DNA binding [GO:0003677]	IGMSIPR	tr|A0A164SMQ5|A0A164SMQ5_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_023482 PE=4 SV=1	0.88537	1.378	22900	0	0	0	0	22900	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164SV02	A0A164SV02_DAUCS	Uncharacterized protein	DCAR_023809	Daucus carota subsp. sativus (Carrot)		membrane [GO:0016020]	"membrane [GO:0016020]; hydrolase activity, acting on glycosyl bonds [GO:0016798]"	"hydrolase activity, acting on glycosyl bonds [GO:0016798]"	CDYNQCPWPK	tr|A0A164SV02|A0A164SV02_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_023809 PE=3 SV=1	0.90753	1.378	0	0	0	0	3382.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3382.7	0	0	0	0	0	0
A0A164SXG9	A0A164SXG9_DAUCS	Uncharacterized protein	DCAR_023932	Daucus carota subsp. sativus (Carrot)					GFGEEDR	tr|A0A164SXG9|A0A164SXG9_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_023932 PE=4 SV=1	0.81027	1.378	23151	0	0	16944	0	0	0	0	0	0	23151	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9979	16944	0	0	0	0	0	0	0	0	0	0
A0A164T023	A0A164T023_DAUCS	J domain-containing protein	DCAR_024019	Daucus carota subsp. sativus (Carrot)					DATDAAG	tr|A0A164T023|A0A164T023_DAUCS J domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_024019 PE=4 SV=1	0.88364	1.378	0	105430	0	72608	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	105430	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	72608	0	0	0	0	0	0	0	0	0	0
A0A164T1Q3	A0A164T1Q3_DAUCS	Protein kinase domain-containing protein	DCAR_024071	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	SMDSYMK	tr|A0A164T1Q3|A0A164T1Q3_DAUCS Protein kinase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_024071 PE=4 SV=1	0.87457	1.378	0	0	0	3666.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3666.4	0	0	0	0	0	0	0	0	0	0
A0A164T362	A0A164T362_DAUCS	Purple acid phosphatase (EC 3.1.3.2)	DCAR_024120	Daucus carota subsp. sativus (Carrot)			acid phosphatase activity [GO:0003993]; metal ion binding [GO:0046872]	acid phosphatase activity [GO:0003993]; metal ion binding [GO:0046872]	LLMVNQR	tr|A0A164T362|A0A164T362_DAUCS Purple acid phosphatase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_024120 PE=3 SV=1	0.87419	1.378	18099	16114	16578	13152	15116	18099	9849	13050	0	0	0	0	16634	11374	0	0	12969	0	16114	0	0	0	13714	0	0	0	0	0	16578	0	12356	0	0	12270	0	13152	0	0	0	0	0	0	0	0	0	10683	0	15116	13397	0
A0A164TB00	A0A164TB00_DAUCS	Uncharacterized protein	DCAR_024422	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		QVGQWPK	tr|A0A164TB00|A0A164TB00_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_024422 PE=4 SV=1;tr|A0A251UK47|A0A251UK47_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr06g0174381 PE=4 SV=1	0.81081	1.378	0	0	0	0	6889.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6889.2	0
A0A164TDV6	A0A164TDV6_DAUCS	PMR5N domain-containing protein	DCAR_024531	Daucus carota subsp. sativus (Carrot)	xyloglucan metabolic process [GO:0010411]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; O-acetyltransferase activity [GO:0016413]; xyloglucan metabolic process [GO:0010411]	O-acetyltransferase activity [GO:0016413]	KGQNCMR	tr|A0A164TDV6|A0A164TDV6_DAUCS PMR5N domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_024531 PE=3 SV=1	0.87544	1.378	0	45042	0	19035	19680	0	0	0	0	0	0	0	0	0	0	0	0	45042	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19035	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19680	0
A0A164TGG0	A0A164TGG0_DAUCS	BRCT domain-containing protein	DCAR_024620	Daucus carota subsp. sativus (Carrot)					SSGLAAR	tr|A0A164TGG0|A0A164TGG0_DAUCS BRCT domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_024620 PE=4 SV=1	0.91015	1.378	74904	79154	53142	69739	55904	0	0	74904	71438	0	0	0	72720	0	48683	0	0	0	61820	0	75054	75318	79154	0	0	0	0	0	0	53142	23122	0	69739	0	0	0	0	0	0	0	0	0	0	0	55904	0	0	0	0	0
A0A164TKS9	A0A164TKS9_DAUCS	Uncharacterized protein	DCAR_024762	Daucus carota subsp. sativus (Carrot)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]	DNA binding [GO:0003677]	QNSNDCR	tr|A0A164TKS9|A0A164TKS9_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_024762 PE=3 SV=1	0.81048	1.378	0	0	0	0	7358	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7358	0	0	0	0	0	0	0	0
A0A164TNG3	A0A164TNG3_DAUCS	Cation_ATPase_N domain-containing protein	DCAR_024868	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]	ATP binding [GO:0005524]	AAYKFTR	tr|A0A164TNG3|A0A164TNG3_DAUCS Cation_ATPase_N domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_024868 PE=4 SV=1;tr|A0A166AXL5|A0A166AXL5_DAUCS Calcium-transporting ATPase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_010825 PE	0.90795	1.378	22228	5627.7	0	0	0	0	0	3291.9	0	0	0	0	0	22228	0	0	0	5627.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164U172	A0A164U172_DAUCS	Glutaredoxin domain-containing protein	DCAR_025370	Daucus carota subsp. sativus (Carrot)			glutathione oxidoreductase activity [GO:0097573]	glutathione oxidoreductase activity [GO:0097573]	IPKVVPR	tr|A0A164U172|A0A164U172_DAUCS Glutaredoxin domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_025370 PE=4 SV=1	0.89802	1.378	0	0	0	0	23861	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23861	0
A0A164U4T1	A0A164U4T1_DAUCS	Uncharacterized protein	DCAR_025502	Daucus carota subsp. sativus (Carrot)	carbohydrate metabolic process [GO:0005975]	cell wall [GO:0005618]; integral component of membrane [GO:0016021]	cell wall [GO:0005618]; integral component of membrane [GO:0016021]; polygalacturonase activity [GO:0004650]; carbohydrate metabolic process [GO:0005975]	polygalacturonase activity [GO:0004650]	AWKAMFK	tr|A0A164U4T1|A0A164U4T1_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_025502 PE=3 SV=1	0.81024	1.378	0	11808	8288.3	0	3227.3	0	0	0	0	0	0	0	0	0	0	0	0	0	11808	0	0	0	0	0	0	0	0	0	0	8288.3	0	0	0	0	0	0	0	0	0	0	0	0	0	3227.3	0	0	0	0	0	0
A0A164U6G2	A0A164U6G2_DAUCS	Uncharacterized protein	DCAR_025569	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		QQMECNR	tr|A0A164U6G2|A0A164U6G2_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_025569 PE=4 SV=1	0.81078	1.378	0	0	24265	20599	28951	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24265	0	0	0	0	0	0	0	0	0	0	20599	0	0	0	0	28951	0	0	0	0	0	0	0	0
A0A164UAV0	A0A164UAV0_DAUCS	Uncharacterized protein	DCAR_025713	Daucus carota subsp. sativus (Carrot)			catalytic activity [GO:0003824]	catalytic activity [GO:0003824]	VHHTTRR	tr|A0A164UAV0|A0A164UAV0_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_025713 PE=4 SV=1	0.81132	1.378	64288	48795	60822	41733	87809	0	52023	21078	37021	17313	0	64288	0	0	0	0	0	0	0	0	0	0	48795	40144	0	0	0	0	0	0	33434	60822	0	41733	0	19376	0	0	0	0	0	0	0	59829	87809	30700	0	0	0	33212
A0A164UCI1	A0A164UCI1_DAUCS	Uncharacterized protein	DCAR_025779 DCAR_025781	Daucus carota subsp. sativus (Carrot)					RPLARLR	tr|A0A164UCI1|A0A164UCI1_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_025779 PE=4 SV=1;tr|A0A699GDU3|A0A699GDU3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000107 PE=4 SV=1	0.89349	1.378	0	0	0	7841.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7841.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164UG90	A0A164UG90_DAUCS	RRM domain-containing protein	DCAR_025922	Daucus carota subsp. sativus (Carrot)		nucleus [GO:0005634]	nucleus [GO:0005634]; U1 snRNA binding [GO:0030619]	U1 snRNA binding [GO:0030619]	QPEQEHR	tr|A0A164UG90|A0A164UG90_DAUCS RRM domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_025922 PE=4 SV=1	0.90277	1.378	0	191080	0	0	36112	0	0	0	0	0	0	0	0	0	0	0	191080	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	36112	0	0	0	0	0	0	0
A0A164UI68	A0A164UI68_DAUCS	GATA-type domain-containing protein	DCAR_025986	Daucus carota subsp. sativus (Carrot)	"regulation of transcription, DNA-templated [GO:0006355]"		"sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]; regulation of transcription, DNA-templated [GO:0006355]"	sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	TKKPLPK	tr|A0A164UI68|A0A164UI68_DAUCS GATA-type domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_025986 PE=4 SV=1	0.81186	1.378	0	0	0	0	60507	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	60507	0	0
A0A164UTF1	A0A164UTF1_DAUCS	Protein kinase domain-containing protein	DCAR_026416	Daucus carota subsp. sativus (Carrot)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	LRAHGKK	tr|A0A164UTF1|A0A164UTF1_DAUCS Protein kinase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_026416 PE=4 SV=1	0.88	1.378	0	0	15492	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15492	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164UUL3	A0A164UUL3_DAUCS	Peptidase A1 domain-containing protein	DCAR_023256	Daucus carota subsp. sativus (Carrot)			aspartic-type endopeptidase activity [GO:0004190]	aspartic-type endopeptidase activity [GO:0004190]	CSHCDVK	tr|A0A164UUL3|A0A164UUL3_DAUCS Peptidase A1 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_023256 PE=4 SV=1	0.8124	1.378	130090	0	0	134280	0	0	0	0	0	130090	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	134280	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164UUS9	A0A164UUS9_DAUCS	ANAPC4_WD40 domain-containing protein	DCAR_023249	Daucus carota subsp. sativus (Carrot)	rRNA processing [GO:0006364]		rRNA processing [GO:0006364]		KNSTSND	tr|A0A164UUS9|A0A164UUS9_DAUCS ANAPC4_WD40 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_023249 PE=4 SV=1	0.82939	1.378	52869	0	25583	0	0	0	0	0	0	0	0	0	52869	17142	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25583	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164UWS7	A0A164UWS7_DAUCS	Sulfotransferase (EC 2.8.2.-)	DCAR_023156	Daucus carota subsp. sativus (Carrot)		cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; sulfotransferase activity [GO:0008146]	sulfotransferase activity [GO:0008146]	PGLFAAK	tr|A0A164UWS7|A0A164UWS7_DAUCS Sulfotransferase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_023156 PE=3 SV=1	0.80867	1.378	47376	76849	18413	49304	19508	0	0	8192.5	0	0	47376	0	9023.6	0	0	66019	53605	0	0	76849	23909	0	0	0	0	18413	0	0	0	0	0	0	0	0	0	10188	0	35936	0	49304	42088	0	0	0	0	15814	14569	0	19508	0
A0A164V2S4	A0A164V2S4_DAUCS	Uncharacterized protein	DCAR_022903	Daucus carota subsp. sativus (Carrot)	Notch signaling pathway [GO:0007219]; positive regulation of catalytic activity [GO:0043085]; protein processing [GO:0016485]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; Notch signaling pathway [GO:0007219]; positive regulation of catalytic activity [GO:0043085]; protein processing [GO:0016485]		MQIALVH	tr|A0A164V2S4|A0A164V2S4_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_022903 PE=3 SV=1	0.84082	1.378	10363	9845.9	9306	9945	6753.4	0	0	0	7567.6	10363	0	0	0	9660.6	0	0	0	0	0	0	0	9845.9	0	0	0	0	0	0	0	0	9306	0	9251	8158.8	0	9945	0	0	0	0	0	0	0	6753.4	0	0	0	6329.8	0	0
A0A164V359	A0A164V359_DAUCS	Uncharacterized protein	DCAR_022886	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; voltage-gated potassium channel activity [GO:0005249]	voltage-gated potassium channel activity [GO:0005249]	FGVYPTK	tr|A0A164V359|A0A164V359_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_022886 PE=3 SV=1	0.84052	1.378	13180	0	0	0	4578	0	0	0	11861	13180	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4578	0
A0A164V9B7	A0A164V9B7_DAUCS	O-fucosyltransferase family protein	DCAR_022637	Daucus carota subsp. sativus (Carrot)	fucose metabolic process [GO:0006004]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transferase activity [GO:0016740]; fucose metabolic process [GO:0006004]	transferase activity [GO:0016740]	KPILPVK	tr|A0A164V9B7|A0A164V9B7_DAUCS O-fucosyltransferase family protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_022637 PE=3 SV=1	0.80456	1.378	24397	28210	5361.3	7155	14319	3916.6	0	0	0	24397	0	0	15446	0	0	0	0	28210	0	0	0	0	0	0	2613.2	0	0	0	0	0	5361.3	0	4220.6	7155	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14319	0
A0A164VR96	A0A164VR96_DAUCS	GTD-binding domain-containing protein	DCAR_021900	Daucus carota subsp. sativus (Carrot)					SCELEDR	tr|A0A164VR96|A0A164VR96_DAUCS GTD-binding domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_021900 PE=4 SV=1	0.82607	1.378	0	0	0	23444	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23444	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164VUW2	A0A164VUW2_DAUCS	Glycerol-3-phosphate dehydrogenase [NAD(+)] (EC 1.1.1.8)	DCAR_021744	Daucus carota subsp. sativus (Carrot)	carbohydrate metabolic process [GO:0005975]; glycerol-3-phosphate catabolic process [GO:0046168]	glycerol-3-phosphate dehydrogenase complex [GO:0009331]	glycerol-3-phosphate dehydrogenase complex [GO:0009331]; glycerol-3-phosphate dehydrogenase [NAD+] activity [GO:0004367]; NAD binding [GO:0051287]; protein homodimerization activity [GO:0042803]; carbohydrate metabolic process [GO:0005975]; glycerol-3-phosphate catabolic process [GO:0046168]	glycerol-3-phosphate dehydrogenase [NAD+] activity [GO:0004367]; NAD binding [GO:0051287]; protein homodimerization activity [GO:0042803]	VKSSSAM	tr|A0A164VUW2|A0A164VUW2_DAUCS Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_021744 PE=3 SV=1	0.80261	1.378	0	39547	23222	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	39547	0	0	0	0	0	0	23222	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164W1Y5	A0A164W1Y5_DAUCS	Uncharacterized protein	DCAR_021460	Daucus carota subsp. sativus (Carrot)					GSDASST	tr|A0A164W1Y5|A0A164W1Y5_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_021460 PE=4 SV=1	0.82515	1.378	0	0	6322.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6322.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164W390	A0A164W390_DAUCS	Uncharacterized protein	DCAR_021409	Daucus carota subsp. sativus (Carrot)	cytokinesis by cell plate formation [GO:0000911]		cytokinesis by cell plate formation [GO:0000911]		FAAVNQR	tr|A0A164W390|A0A164W390_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_021409 PE=4 SV=1	0.80228	1.378	7602.9	0	0	0	0	0	0	0	0	0	0	0	0	7602.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164W3E2	A0A164W3E2_DAUCS	Uncharacterized protein	DCAR_021401	Daucus carota subsp. sativus (Carrot)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	TDCRELK	tr|A0A164W3E2|A0A164W3E2_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_021401 PE=4 SV=1	0.8244	1.378	0	0	21024	15001	19412	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21024	0	0	0	0	0	0	0	0	0	0	15001	0	0	18887	19412	0	0	0	0	0	0	0
A0A164WPH3	A0A164WPH3_DAUCS	Uncharacterized protein	DCAR_020564	Daucus carota subsp. sativus (Carrot)	glutamate biosynthetic process [GO:0006537]; glutamine metabolic process [GO:0006541]		"3 iron, 4 sulfur cluster binding [GO:0051538]; glutamate synthase activity [GO:0015930]; metal ion binding [GO:0046872]; glutamate biosynthetic process [GO:0006537]; glutamine metabolic process [GO:0006541]"	"3 iron, 4 sulfur cluster binding [GO:0051538]; glutamate synthase activity [GO:0015930]; metal ion binding [GO:0046872]"	SVKACYK	tr|A0A164WPH3|A0A164WPH3_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_020564 PE=3 SV=1	0.80239	1.378	0	0	0	0	44204	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	44204	0	0	0	0	0	0	0	0
A0A164WQU8	A0A164WQU8_DAUCS	Uncharacterized protein	DCAR_020514	Daucus carota subsp. sativus (Carrot)					VHPGGSK	tr|A0A164WQU8|A0A164WQU8_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_020514 PE=4 SV=1	0.86725	1.378	4151.4	5210.2	5793.5	0	2768.3	0	0	0	0	0	0	0	4151.4	0	4419.8	0	5210.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5793.5	0	0	0	0	0	0	0	0	0	0	0	0	0	2768.3	0	0	0	0
A0A164WR80	A0A164WR80_DAUCS	Uncharacterized protein	DCAR_020501	Daucus carota subsp. sativus (Carrot)		Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; glycosyltransferase activity [GO:0016757]	glycosyltransferase activity [GO:0016757]	HVVVKPK	tr|A0A164WR80|A0A164WR80_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_020501 PE=4 SV=1	0.86736	1.378	59101	37800	45533	20603	40715	22472	59101	0	14909	55605	0	0	0	18517	34793	0	0	16026	0	0	0	28364	37800	15175	45533	0	0	0	0	22407	0	42824	20603	15843	0	0	0	0	0	14729	18392	0	0	0	16681	25579	0	40715	0	0
A0A164WV36	A0A164WV36_DAUCS	Prolyl endopeptidase (EC 3.4.21.-)	DCAR_020340	Daucus carota subsp. sativus (Carrot)			serine-type endopeptidase activity [GO:0004252]	serine-type endopeptidase activity [GO:0004252]	PGCGHGK	tr|A0A164WV36|A0A164WV36_DAUCS Prolyl endopeptidase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_020340 PE=3 SV=1	0.80293	1.378	0	0	6644.3	14868	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6644.3	0	0	0	0	0	0	0	0	0	0	14868	14037	0	0	0	0	0	0	0	0	0
A0A164WV76	A0A164WV76_DAUCS	Uncharacterized protein	DCAR_020334	Daucus carota subsp. sativus (Carrot)					NSNPTTR	tr|A0A164WV76|A0A164WV76_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_020334 PE=3 SV=1	0.80347	1.378	0	0	0	0	53573	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	53573	0	0	0	0
A0A164WWZ2	A0A164WWZ2_DAUCS	Kinesin motor domain-containing protein	DCAR_020259	Daucus carota subsp. sativus (Carrot)	microtubule-based movement [GO:0007018]		ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]; microtubule-based movement [GO:0007018]	ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]	QVKGIMR	tr|A0A164WWZ2|A0A164WWZ2_DAUCS Kinesin motor domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_020259 PE=3 SV=1	0.84832	1.378	40633	70421	21115	32737	13956	14387	0	0	0	0	0	0	0	40633	0	0	0	0	0	0	70421	0	0	0	0	0	0	0	0	0	21115	0	0	32737	0	0	0	0	0	0	0	0	0	0	0	0	12350	13956	0	0
A0A164WXL2	A0A164WXL2_DAUCS	Uncharacterized protein	DCAR_020230	Daucus carota subsp. sativus (Carrot)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	GGSPDER	tr|A0A164WXL2|A0A164WXL2_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_020230 PE=4 SV=1	0.84735	1.378	992250	0	1416700	665350	0	0	0	0	0	0	0	0	992250	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1416700	0	0	0	0	0	0	665350	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164WXW0	A0A164WXW0_DAUCS	Uncharacterized protein	DCAR_020219	Daucus carota subsp. sativus (Carrot)	ribosome biogenesis [GO:0042254]	nucleolus [GO:0005730]	nucleolus [GO:0005730]; ribosome biogenesis [GO:0042254]		AKGHVVM	tr|A0A164WXW0|A0A164WXW0_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_020219 PE=3 SV=1	0.80402	1.378	0	13938	9451.8	0	7145.5	0	0	0	0	0	0	0	0	0	0	6652.9	13938	0	0	9038	6980	0	0	0	0	9451.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7145.5	0	0	0	0	0
A0A164WZN3	A0A164WZN3_DAUCS	WRKY domain-containing protein	DCAR_020141	Daucus carota subsp. sativus (Carrot)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	SCEEANK	tr|A0A164WZN3|A0A164WZN3_DAUCS WRKY domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_020141 PE=4 SV=1	0.8051	1.378	78979	0	0	0	0	0	0	0	0	0	0	0	78979	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164X448	A0A164X448_DAUCS	Uncharacterized protein	DCAR_019952	Daucus carota subsp. sativus (Carrot)	defense response to virus [GO:0051607]; gene silencing by RNA [GO:0031047]		defense response to virus [GO:0051607]; gene silencing by RNA [GO:0031047]		GNAPDMS	tr|A0A164X448|A0A164X448_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_019952 PE=3 SV=1	0.85771	1.378	24506	0	0	0	0	0	0	0	24506	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164X4W5	A0A164X4W5_DAUCS	Uncharacterized protein	DCAR_019927	Daucus carota subsp. sativus (Carrot)					NISTENR	tr|A0A164X4W5|A0A164X4W5_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_019927 PE=4 SV=1	0.85695	1.378	9907	8248.8	13050	10442	0	9276.2	0	0	9907	0	0	0	0	0	0	0	0	0	0	0	0	0	8248.8	0	0	0	0	0	0	0	10237	13050	0	7700.5	0	0	0	0	0	10442	0	0	0	0	0	0	0	0	0	0
A0A164X6V0	A0A164X6V0_DAUCS	Thioredoxin domain-containing protein	DCAR_019851	Daucus carota subsp. sativus (Carrot)	ubiquitin-dependent protein catabolic process [GO:0006511]	chloroplast stroma [GO:0009570]	chloroplast stroma [GO:0009570]; ubiquitin-dependent protein catabolic process [GO:0006511]		SGDDASK	tr|A0A164X6V0|A0A164X6V0_DAUCS Thioredoxin domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_019851 PE=3 SV=1	0.85721	1.378	0	7021.1	0	9075.6	17948	0	0	0	0	0	0	0	0	0	0	5676.2	0	0	0	0	7021.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9075.6	6716.5	0	0	0	17948	0	0	2017.3	0	0	0	0	0
A0A164X957	A0A164X957_DAUCS	Uncharacterized protein	DCAR_016106	Daucus carota subsp. sativus (Carrot)	chlorophyll biosynthetic process [GO:0015995]		chlorophyll biosynthetic process [GO:0015995]		QLQENRR	tr|A0A164X957|A0A164X957_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_016106 PE=4 SV=1	0.80521	1.378	0	0	0	43084	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	43084	0	0	0	0	0	0	0	0	0
A0A164XES2	A0A164XES2_DAUCS	Protein kinase domain-containing protein	DCAR_016321	Daucus carota subsp. sativus (Carrot)	lipid biosynthetic process [GO:0008610]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; iron ion binding [GO:0005506]; oxidoreductase activity [GO:0016491]; protein kinase activity [GO:0004672]; lipid biosynthetic process [GO:0008610]	ATP binding [GO:0005524]; iron ion binding [GO:0005506]; oxidoreductase activity [GO:0016491]; protein kinase activity [GO:0004672]	VKVLHPK	tr|A0A164XES2|A0A164XES2_DAUCS Protein kinase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_016321 PE=3 SV=1	0.80531	1.378	21970	29167	0	0	0	0	21970	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29167	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164XTS8	A0A164XTS8_DAUCS	RRM domain-containing protein	DCAR_016821	Daucus carota subsp. sativus (Carrot)		nucleus [GO:0005634]	nucleus [GO:0005634]; RNA binding [GO:0003723]	RNA binding [GO:0003723]	MNSPYRR	tr|A0A164XTS8|A0A164XTS8_DAUCS RRM domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_016821 PE=4 SV=1	0.94596	1.378	0	0	125320	112590	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	125320	0	0	0	0	0	0	0	112590	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164XVJ6	A0A164XVJ6_DAUCS	Uncharacterized protein	DCAR_016881	Daucus carota subsp. sativus (Carrot)	cytoskeleton organization [GO:0007010]		microtubule binding [GO:0008017]; cytoskeleton organization [GO:0007010]	microtubule binding [GO:0008017]	SEIKALK	tr|A0A164XVJ6|A0A164XVJ6_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_016881 PE=3 SV=1	0.94634	1.378	0	0	14353	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14353	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164XW84	A0A164XW84_DAUCS	"1,3-beta-glucan synthase (EC 2.4.1.34)"	DCAR_016901	Daucus carota subsp. sativus (Carrot)	(1->3)-beta-D-glucan biosynthetic process [GO:0006075]; cell wall organization [GO:0071555]; regulation of cell shape [GO:0008360]	"1,3-beta-D-glucan synthase complex [GO:0000148]; integral component of membrane [GO:0016021]"	"1,3-beta-D-glucan synthase complex [GO:0000148]; integral component of membrane [GO:0016021]; 1,3-beta-D-glucan synthase activity [GO:0003843]; (1->3)-beta-D-glucan biosynthetic process [GO:0006075]; cell wall organization [GO:0071555]; regulation of cell shape [GO:0008360]"	"1,3-beta-D-glucan synthase activity [GO:0003843]"	AHHMDPK	"tr|A0A164XW84|A0A164XW84_DAUCS 1,3-beta-glucan synthase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_016901 PE=3 SV=1"	0.94548	1.378	0	4150	7030.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4150	0	0	0	0	0	0	0	0	0	7030.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164XZ56	A0A164XZ56_DAUCS	Growth-regulating factor	DCAR_017003	Daucus carota subsp. sativus (Carrot)	"developmental process [GO:0032502]; transcription, DNA-templated [GO:0006351]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; ATP binding [GO:0005524]; developmental process [GO:0032502]; transcription, DNA-templated [GO:0006351]"	ATP binding [GO:0005524]	WDDGDEK	tr|A0A164XZ56|A0A164XZ56_DAUCS Growth-regulating factor OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_017003 PE=3 SV=1	0.93975	1.378	0	18321	0	34544	10799	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18321	0	0	0	0	0	0	0	0	0	0	0	0	0	34253	0	29616	15697	34544	0	0	0	0	0	0	0	10799	0	0	0
A0A164Y3I3	A0A164Y3I3_DAUCS	Bulb-type lectin domain-containing protein	DCAR_017168	Daucus carota subsp. sativus (Carrot)					CVGCDGK	tr|A0A164Y3I3|A0A164Y3I3_DAUCS Bulb-type lectin domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_017168 PE=4 SV=1	0.8064	1.378	4977.3	4108.3	0	0	0	4977.3	0	0	0	0	0	0	0	0	4108.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164Y3J0	A0A164Y3J0_DAUCS	Uncharacterized protein	DCAR_017169	Daucus carota subsp. sativus (Carrot)					GCTGMGM	tr|A0A164Y3J0|A0A164Y3J0_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_017169 PE=4 SV=1	0.86716	1.378	15073	9443.5	10208	10472	0	6874.3	15073	8657.8	0	0	0	0	6536.7	4735.8	0	0	9443.5	0	7469.5	0	0	0	0	6397.8	0	0	0	0	6367.7	0	0	10208	0	0	0	6893.8	0	0	0	10472	0	0	0	0	0	0	0	0	0	0
A0A164YC42	A0A164YC42_DAUCS	Uncharacterized protein	DCAR_017531	Daucus carota subsp. sativus (Carrot)			catalytic activity [GO:0003824]	catalytic activity [GO:0003824]	DPGMEEK	tr|A0A164YC42|A0A164YC42_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_017531 PE=4 SV=1	0.93022	1.378	0	15896	9935.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15896	0	0	0	0	0	0	0	0	9935.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164YCT2	A0A164YCT2_DAUCS	Uncharacterized protein	DCAR_017564	Daucus carota subsp. sativus (Carrot)	cell division [GO:0051301]; cytokinin metabolic process [GO:0009690]; defense response by callose deposition in cell wall [GO:0052544]; defense response to bacterium [GO:0042742]; detection of ethylene stimulus [GO:0009727]; hydrogen peroxide biosynthetic process [GO:0050665]; phloem or xylem histogenesis [GO:0010087]; regulation of seedling development [GO:1900140]; regulation of stomatal movement [GO:0010119]; response to abscisic acid [GO:0009737]; response to auxin [GO:0009733]; response to gibberellin [GO:0009739]; response to heat [GO:0009408]; response to insect [GO:0009625]; response to molecule of bacterial origin [GO:0002237]; response to salt stress [GO:0009651]; seed dormancy process [GO:0010162]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ethylene binding [GO:0051740]; ethylene receptor activity [GO:0038199]; identical protein binding [GO:0042802]; phosphorelay sensor kinase activity [GO:0000155]; cell division [GO:0051301]; cytokinin metabolic process [GO:0009690]; defense response by callose deposition in cell wall [GO:0052544]; defense response to bacterium [GO:0042742]; detection of ethylene stimulus [GO:0009727]; hydrogen peroxide biosynthetic process [GO:0050665]; phloem or xylem histogenesis [GO:0010087]; regulation of seedling development [GO:1900140]; regulation of stomatal movement [GO:0010119]; response to abscisic acid [GO:0009737]; response to auxin [GO:0009733]; response to gibberellin [GO:0009739]; response to heat [GO:0009408]; response to insect [GO:0009625]; response to molecule of bacterial origin [GO:0002237]; response to salt stress [GO:0009651]; seed dormancy process [GO:0010162]	ATP binding [GO:0005524]; ethylene binding [GO:0051740]; ethylene receptor activity [GO:0038199]; identical protein binding [GO:0042802]; phosphorelay sensor kinase activity [GO:0000155]	PDRHTSK	tr|A0A164YCT2|A0A164YCT2_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_017564 PE=3 SV=1	0.80694	1.378	0	13417	11574	0	0	0	0	0	0	0	0	0	0	0	2720.2	7747.3	0	0	0	13417	0	0	0	0	0	0	11574	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164YFW1	A0A164YFW1_DAUCS	Protein kinase domain-containing protein	DCAR_017696	Daucus carota subsp. sativus (Carrot)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	NGDSSWLARMLTPKLLK	tr|A0A164YFW1|A0A164YFW1_DAUCS Protein kinase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_017696 PE=4 SV=1	0.94326	1.378	0	0	0	21803	2968.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21803	0	0	0	0	0	0	0	0	0	0	0	2968.4	0	0
A0A164YKZ9	A0A164YKZ9_DAUCS	MI domain-containing protein	DCAR_017915	Daucus carota subsp. sativus (Carrot)	regulation of translation [GO:0006417]		RNA binding [GO:0003723]; regulation of translation [GO:0006417]	RNA binding [GO:0003723]	YANLAAR	tr|A0A164YKZ9|A0A164YKZ9_DAUCS MI domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_017915 PE=4 SV=1	0.80803	1.378	0	0	0	12805	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12805	0	0	0	0	0	0	0	0	0	0	0
A0A164YWV1	A0A164YWV1_DAUCS	Non-specific serine/threonine protein kinase (EC 2.7.11.1)	DCAR_018256	Daucus carota subsp. sativus (Carrot)			ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	KQSALFT	tr|A0A164YWV1|A0A164YWV1_DAUCS Non-specific serine/threonine protein kinase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_018256 PE=3 SV=1	0.92908	1.378	0	9555.4	8948.2	8002.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9555.4	0	0	0	0	0	0	8948.2	0	0	0	8002.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164Z5S2	A0A164Z5S2_DAUCS	Uncharacterized protein	DCAR_018617	Daucus carota subsp. sativus (Carrot)		extracellular region [GO:0005576]; integral component of membrane [GO:0016021]	extracellular region [GO:0005576]; integral component of membrane [GO:0016021]; copper ion binding [GO:0005507]; oxidoreductase activity [GO:0016491]; serine-type carboxypeptidase activity [GO:0004185]	copper ion binding [GO:0005507]; oxidoreductase activity [GO:0016491]; serine-type carboxypeptidase activity [GO:0004185]	IARPNMR	tr|A0A164Z5S2|A0A164Z5S2_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_018617 PE=3 SV=1	0.78532	1.378	0	0	0	2496.8	4251.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2496.8	0	0	0	0	0	0	0	0	0	0	0	0	0	4251.2	0	0
A0A164ZAE1	A0A164ZAE1_DAUCS	EF-hand domain-containing protein	DCAR_018845	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; calcium ion binding [GO:0005509]; potassium channel activity [GO:0005267]	calcium ion binding [GO:0005509]; potassium channel activity [GO:0005267]	SSHGRRR	tr|A0A164ZAE1|A0A164ZAE1_DAUCS EF-hand domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_018845 PE=3 SV=1	0.78466	1.378	6301.2	3771500	2747700	0	0	0	0	0	6301.2	0	0	0	0	0	0	0	0	0	13792	3771500	0	0	0	0	0	0	2747700	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164ZBE1	A0A164ZBE1_DAUCS	Uncharacterized protein	DCAR_018905	Daucus carota subsp. sativus (Carrot)	gene silencing by RNA [GO:0031047]		gene silencing by RNA [GO:0031047]		GFDMGRAIFSEEYMMDK	tr|A0A164ZBE1|A0A164ZBE1_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_018905 PE=4 SV=1	0.85549	1.378	0	0	0	7155.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7155.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164ZHI0	A0A164ZHI0_DAUCS	C1_2 domain-containing protein	DCAR_019175	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		FTGDIVK	tr|A0A164ZHI0|A0A164ZHI0_DAUCS C1_2 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_019175 PE=4 SV=1	0.91096	1.378	60492	30447	28459	36084	19298	0	19755	14440	30767	0	0	60492	48118	16543	0	0	0	0	0	0	0	0	30447	0	14354	0	0	0	0	8787.6	28459	0	36084	16796	0	16664	0	0	0	0	0	0	0	0	0	0	0	19298	18005	0
A0A164ZLK7	A0A164ZLK7_DAUCS	Uncharacterized protein	DCAR_019336	Daucus carota subsp. sativus (Carrot)	amino acid transport [GO:0006865]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; amino acid transport [GO:0006865]		SGDDDFK	tr|A0A164ZLK7|A0A164ZLK7_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_019336 PE=4 SV=1	0.91438	1.378	0	12002	17394	15709	16839	0	0	0	0	0	0	0	0	0	12002	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17394	0	0	0	0	0	15709	0	0	0	0	0	0	0	16839	0	0	0	0	0	0
A0A164ZR13	A0A164ZR13_DAUCS	Uncharacterized protein	DCAR_019516	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	"integral component of membrane [GO:0016021]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	TIFYGGK	tr|A0A164ZR13|A0A164ZR13_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_019516 PE=3 SV=1	0.94203	1.378	0	68040	64677	25596	36967	0	0	0	0	0	0	0	0	0	19649	0	0	68040	35618	0	0	0	0	0	0	0	0	64677	0	0	0	62845	0	0	0	0	0	0	0	25596	20474	0	0	0	0	11605	0	0	36967	0
A0A164ZU67	A0A164ZU67_DAUCS	Uncharacterized protein	DCAR_019651	Daucus carota subsp. sativus (Carrot)	response to abscisic acid [GO:0009737]	nucleus [GO:0005634]; plasma membrane [GO:0005886]	nucleus [GO:0005634]; plasma membrane [GO:0005886]; response to abscisic acid [GO:0009737]		NLLLCER	tr|A0A164ZU67|A0A164ZU67_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_019651 PE=4 SV=1	0.76791	1.378	11657	0	22756	12382	20032	0	0	0	0	0	0	0	11657	0	0	0	0	0	0	0	0	0	0	0	0	22756	0	0	0	0	0	0	0	0	0	0	0	0	0	12382	0	0	0	0	0	8033.7	20032	0	0	0
A0A164ZUX7	A0A164ZUX7_DAUCS	Peptidase A1 domain-containing protein	DCAR_019689	Daucus carota subsp. sativus (Carrot)					KYRYGGR	tr|A0A164ZUX7|A0A164ZUX7_DAUCS Peptidase A1 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_019689 PE=4 SV=1	0.76846	1.378	27175	0	0	0	0	0	0	0	0	0	0	0	27175	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A164ZVU7	A0A164ZVU7_DAUCS	Uncharacterized protein	DCAR_019730	Daucus carota subsp. sativus (Carrot)					CCMGYCK	tr|A0A164ZVU7|A0A164ZVU7_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_019730 PE=4 SV=1	0.76902	1.378	0	0	15665	0	6746.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15665	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6746.4	0	0	0	0	0
A0A164ZW67	A0A164ZW67_DAUCS	Serine/threonine protein phosphatase 2A regulatory subunit	DCAR_019748	Daucus carota subsp. sativus (Carrot)	signal transduction [GO:0007165]	protein phosphatase type 2A complex [GO:0000159]	protein phosphatase type 2A complex [GO:0000159]; protein phosphatase regulator activity [GO:0019888]; signal transduction [GO:0007165]	protein phosphatase regulator activity [GO:0019888]	TTSVSGK	tr|A0A164ZW67|A0A164ZW67_DAUCS Serine/threonine protein phosphatase 2A regulatory subunit OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_019748 PE=3 SV=1	0.89438	1.378	0	366850	20675	39640	0	0	0	0	0	0	0	0	0	0	366850	28937	36084	60990	0	0	0	0	0	20675	0	0	0	0	0	0	0	0	0	0	0	0	0	26216	31471	39640	38339	0	0	0	0	0	0	0	0	0
A0A164ZZ91	A0A164ZZ91_DAUCS	Uncharacterized protein	DCAR_015982	Daucus carota subsp. sativus (Carrot)					KHKGAQR	tr|A0A164ZZ91|A0A164ZZ91_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_015982 PE=4 SV=1	0.91781	1.378	7726.4	0	0	8219.9	6799.8	0	0	7726.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8219.9	0	0	0	0	0	0	0	0	0	6799.8	0	0	0	0	0	0	0
A0A165A3Q7	A0A165A3Q7_DAUCS	Uncharacterized protein	DCAR_015773	Daucus carota subsp. sativus (Carrot)					NLKGDKR	tr|A0A165A3Q7|A0A165A3Q7_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_015773 PE=4 SV=1	0.76957	1.378	0	287220	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	287220	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A165A485	A0A165A485_DAUCS	Uncharacterized protein	DCAR_015749	Daucus carota subsp. sativus (Carrot)					PPACGGV	tr|A0A165A485|A0A165A485_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_015749 PE=4 SV=1	0.94931	1.378	85841	119740	59763	105020	268260	35468	85841	39994	0	0	0	0	32654	0	16138	28709	98379	35384	0	119740	116290	29466	0	55950	24980	57643	57674	0	59763	0	49684	8019.7	0	0	0	35708	105020	84975	36244	42748	44015	268260	22693	11803	13637	6591.3	38904	8991.7	15220	0
A0A165A5F2	A0A165A5F2_DAUCS	NAC domain-containing protein	DCAR_015694	Daucus carota subsp. sativus (Carrot)	"regulation of transcription, DNA-templated [GO:0006355]"	integral component of membrane [GO:0016021]	"integral component of membrane [GO:0016021]; DNA binding [GO:0003677]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]	GHAPNGK	tr|A0A165A5F2|A0A165A5F2_DAUCS NAC domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_015694 PE=4 SV=1	0.94014	1.378	15597	0	19552	18084	0	0	0	0	0	0	15597	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19552	0	0	0	0	0	0	0	18084	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A165AA37	A0A165AA37_DAUCS	Uncharacterized protein	DCAR_015461	Daucus carota subsp. sativus (Carrot)	mitochondrial transport [GO:0006839]	integral component of membrane [GO:0016021]; mitochondrial membrane [GO:0031966]	integral component of membrane [GO:0016021]; mitochondrial membrane [GO:0031966]; mitochondrial transport [GO:0006839]		YPIGPAK	tr|A0A165AA37|A0A165AA37_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_015461 PE=3 SV=1	0.77013	1.378	14818	27722	0	0	0	0	0	0	0	0	0	14818	0	0	0	0	0	0	27722	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A165AA73	A0A165AA73_DAUCS	Uncharacterized protein	DCAR_015454	Daucus carota subsp. sativus (Carrot)					GDPIEWIFEM	tr|A0A165AA73|A0A165AA73_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_015454 PE=4 SV=1	0.77068	1.378	0	0	2334.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2334.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A165ABX6	A0A165ABX6_DAUCS	F-box domain-containing protein	DCAR_015372	Daucus carota subsp. sativus (Carrot)					IVSSEAM	tr|A0A165ABX6|A0A165ABX6_DAUCS F-box domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_015372 PE=4 SV=1	0.77124	1.378	0	3420.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3420.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A165WN75	A0A165WN75_DAUCS	Uncharacterized protein	DCAR_015110	Daucus carota subsp. sativus (Carrot)			DNA binding [GO:0003677]	DNA binding [GO:0003677]	ARIEHYR	tr|A0A165WN75|A0A165WN75_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_015110 PE=4 SV=1	0.85959	1.378	0	0	35969	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35969	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A165WQ34	A0A165WQ34_DAUCS	Uncharacterized protein	DCAR_015071	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GFLSYPK	tr|A0A165WQ34|A0A165WQ34_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_015071 PE=4 SV=1	0.77192	1.378	0	2541900	701900	0	2646000	0	0	0	0	0	0	0	0	0	0	0	2541900	0	0	0	0	1148200	0	0	701900	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2646000	0	0	0	0	1907000	0	2242400	0
A0A165WSI5	A0A165WSI5_DAUCS	Gln-synt_C domain-containing protein	DCAR_015012	Daucus carota subsp. sativus (Carrot)	glutamine biosynthetic process [GO:0006542]		glutamate-ammonia ligase activity [GO:0004356]; hydrolase activity [GO:0016787]; glutamine biosynthetic process [GO:0006542]	glutamate-ammonia ligase activity [GO:0004356]; hydrolase activity [GO:0016787]	RFHDSVK	tr|A0A165WSI5|A0A165WSI5_DAUCS Gln-synt_C domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_015012 PE=3 SV=1	0.86296	1.378	0	0	0	28976	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28976	0	0	0	0	0	0	0	0	0	0
A0A165WUR6	A0A165WUR6_DAUCS	PPM-type phosphatase domain-containing protein	DCAR_014954	Daucus carota subsp. sativus (Carrot)			phosphatase activity [GO:0016791]	phosphatase activity [GO:0016791]	SSMERRR	tr|A0A165WUR6|A0A165WUR6_DAUCS PPM-type phosphatase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_014954 PE=4 SV=1	0.8914	1.378	56383	0	189840	0	184320	0	0	0	0	0	56383	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	189840	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	184320	0	0
A0A165WWM8	A0A165WWM8_DAUCS	SWIM-type domain-containing protein	DCAR_014907	Daucus carota subsp. sativus (Carrot)			zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	ESCKWTK	tr|A0A165WWM8|A0A165WWM8_DAUCS SWIM-type domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_014907 PE=4 SV=1	0.8209	1.378	15607	0	0	13271	10900	0	0	9683.9	0	0	0	0	15607	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13271	0	0	0	0	0	0	0	0	0	0	0	10900	0	0
A0A165WWS9	A0A165WWS9_DAUCS	ENTH domain-containing protein	DCAR_014902	Daucus carota subsp. sativus (Carrot)	clathrin coat assembly [GO:0048268]; endocytosis [GO:0006897]	clathrin-coated pit [GO:0005905]; clathrin-coated vesicle [GO:0030136]; Golgi apparatus [GO:0005794]	clathrin-coated pit [GO:0005905]; clathrin-coated vesicle [GO:0030136]; Golgi apparatus [GO:0005794]; 1-phosphatidylinositol binding [GO:0005545]; clathrin binding [GO:0030276]; clathrin coat assembly [GO:0048268]; endocytosis [GO:0006897]	1-phosphatidylinositol binding [GO:0005545]; clathrin binding [GO:0030276]	LAGDMDK	tr|A0A165WWS9|A0A165WWS9_DAUCS ENTH domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_014902 PE=4 SV=1	0.82127	1.378	37717	20350	7755.3	0	0	34869	0	0	37717	0	0	0	0	0	0	0	0	0	0	0	0	20350	0	0	7755.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A165X0F0	A0A165X0F0_DAUCS	Formin-like protein	DCAR_014813	Daucus carota subsp. sativus (Carrot)			phosphoprotein phosphatase activity [GO:0004721]	phosphoprotein phosphatase activity [GO:0004721]	EPPRQKSSVASPANER	tr|A0A165X0F0|A0A165X0F0_DAUCS Formin-like protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_014813 PE=3 SV=1	0.88608	1.9304	8718.9	0	12149	0	88918	0	0	0	0	0	8718.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12149	10823	0	0	0	0	0	0	0	0	0	0	0	0	0	88918	0	0	0	0	4140.3	0	0	0
A0A165X1Q8	A0A165X1Q8_DAUCS	Protein kinase domain-containing protein	DCAR_014787	Daucus carota subsp. sativus (Carrot)	protein folding [GO:0006457]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; adenyl-nucleotide exchange factor activity [GO:0000774]; ATP binding [GO:0005524]; chaperone binding [GO:0051087]; protein homodimerization activity [GO:0042803]; protein kinase activity [GO:0004672]; protein folding [GO:0006457]	adenyl-nucleotide exchange factor activity [GO:0000774]; ATP binding [GO:0005524]; chaperone binding [GO:0051087]; protein homodimerization activity [GO:0042803]; protein kinase activity [GO:0004672]	SLLKVYK	tr|A0A165X1Q8|A0A165X1Q8_DAUCS Protein kinase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_014787 PE=3 SV=1	0.84089	1.378	0	0	8935.2	58590	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5953	8935.2	5937.5	0	0	0	0	0	0	0	0	0	53531	58590	19653	0	0	0	0	0	0	0	0	0
A0A165XH82	A0A165XH82_DAUCS	Phorbol-ester/DAG-type domain-containing protein	DCAR_014477	Daucus carota subsp. sativus (Carrot)	intracellular signal transduction [GO:0035556]		metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]; intracellular signal transduction [GO:0035556]	metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]	VMNINVR	tr|A0A165XH82|A0A165XH82_DAUCS Phorbol-ester/DAG-type domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_014477 PE=4 SV=1	0.8926	1.378	0	9699.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9699.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A165XW06	A0A165XW06_DAUCS	Uncharacterized protein	DCAR_014052	Daucus carota subsp. sativus (Carrot)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	DDAWGDD	tr|A0A165XW06|A0A165XW06_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_014052 PE=4 SV=1;tr|A0A6L5B9H7|A0A6L5B9H7_APIGR Uncharacterized protein OS=Apium graveolens OX=4045 GN=AG4045_023248 PE=4 SV=1	0.88979	1.378	12101	0	0	0	0	0	0	0	0	0	0	0	0	12101	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A165XY20	A0A165XY20_DAUCS	Phosphatidylinositol 4-phosphate 5-kinase (EC 2.7.1.68)	DCAR_013985	Daucus carota subsp. sativus (Carrot)			1-phosphatidylinositol-4-phosphate 5-kinase activity [GO:0016308]; ATP binding [GO:0005524]	1-phosphatidylinositol-4-phosphate 5-kinase activity [GO:0016308]; ATP binding [GO:0005524]	FYYGSGR	tr|A0A165XY20|A0A165XY20_DAUCS Phosphatidylinositol 4-phosphate 5-kinase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_013985 PE=4 SV=1	0.77205	1.378	53919	37838	38946	549650	43323	30199	53919	29168	0	28881	0	47061	12071	0	0	0	0	15292	0	0	0	37838	0	38946	0	0	0	0	0	0	0	0	549650	0	0	0	0	0	0	0	0	0	0	0	0	43323	0	0	0	0
A0A165XYZ6	A0A165XYZ6_DAUCS	ENDO3c domain-containing protein	DCAR_013953	Daucus carota subsp. sativus (Carrot)	base-excision repair [GO:0006284]	nucleus [GO:0005634]	"nucleus [GO:0005634]; 4 iron, 4 sulfur cluster binding [GO:0051539]; DNA binding [GO:0003677]; DNA demethylase activity [GO:0035514]; DNA N-glycosylase activity [GO:0019104]; metal ion binding [GO:0046872]; base-excision repair [GO:0006284]"	"4 iron, 4 sulfur cluster binding [GO:0051539]; DNA binding [GO:0003677]; DNA demethylase activity [GO:0035514]; DNA N-glycosylase activity [GO:0019104]; metal ion binding [GO:0046872]"	HQVHCSR	tr|A0A165XYZ6|A0A165XYZ6_DAUCS ENDO3c domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_013953 PE=3 SV=1	0.7726	1.378	4217.7	0	0	0	0	0	0	4217.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A165Y386	A0A165Y386_DAUCS	Uncharacterized protein	DCAR_013847	Daucus carota subsp. sativus (Carrot)			zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	FQKHGAK	tr|A0A165Y386|A0A165Y386_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_013847 PE=4 SV=1	0.77316	1.378	24350	10886	0	10095	0	0	24350	0	0	0	0	0	0	0	0	0	0	0	10886	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10095	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A165YG67	A0A165YG67_DAUCS	Guanylate kinase (EC 2.7.4.8)	DCAR_013589	Daucus carota subsp. sativus (Carrot)			ATP binding [GO:0005524]; guanylate kinase activity [GO:0004385]	ATP binding [GO:0005524]; guanylate kinase activity [GO:0004385]	AFYMNLR	tr|A0A165YG67|A0A165YG67_DAUCS Guanylate kinase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_013589 PE=3 SV=1	0.77371	1.378	25896	18608	17167	3272.7	13679	0	0	0	0	0	25896	0	0	0	0	18608	0	0	0	0	0	0	0	0	0	17138	15062	0	17167	0	0	0	0	0	0	0	0	3272.7	0	0	0	0	0	0	0	0	13679	0	0	0
A0A165YIL6	A0A165YIL6_DAUCS	S1 motif domain-containing protein	DCAR_013529	Daucus carota subsp. sativus (Carrot)	nucleobase-containing compound metabolic process [GO:0006139]; positive regulation of transcription elongation from RNA polymerase II promoter [GO:0032968]	nucleus [GO:0005634]	nucleus [GO:0005634]; nucleic acid binding [GO:0003676]; nucleobase-containing compound metabolic process [GO:0006139]; positive regulation of transcription elongation from RNA polymerase II promoter [GO:0032968]	nucleic acid binding [GO:0003676]	SGSSGWG	tr|A0A165YIL6|A0A165YIL6_DAUCS S1 motif domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_013529 PE=3 SV=1	0.92314	1.378	15722	76530	45618	92711	25370	0	0	0	0	0	9980.2	0	15722	0	8296.4	0	10827	0	0	0	76530	0	36109	12859	0	33424	0	45618	0	0	0	0	0	0	92711	10287	0	7837.4	11413	63982	18734	25370	0	0	0	7685.3	0	0	6067.9	0
A0A165YS99	A0A165YS99_DAUCS	Uncharacterized protein	DCAR_013457	Daucus carota subsp. sativus (Carrot)					QLEKEMWEQFYGTGFWR	tr|A0A165YS99|A0A165YS99_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_013457 PE=4 SV=1	0.88211	1.378	0	0	0	638160	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	603460	638160	0	0	0	0	0	0	0	0	0
A0A165YYI4	A0A165YYI4_DAUCS	Uncharacterized protein	DCAR_013243	Daucus carota subsp. sativus (Carrot)					PAIRKAR	tr|A0A165YYI4|A0A165YYI4_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_013243 PE=3 SV=1	0.93929	1.378	0	0	0	3565.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3565.4	0	0	0	0	0	0	0	0	0	0	0	0
A0A165YYS5	A0A165YYS5_DAUCS	INCENP_ARK-bind domain-containing protein	DCAR_013235	Daucus carota subsp. sativus (Carrot)		cytoplasm [GO:0005737]; nucleus [GO:0005634]; spindle [GO:0005819]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; spindle [GO:0005819]		DTCHSNK	tr|A0A165YYS5|A0A165YYS5_DAUCS INCENP_ARK-bind domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_013235 PE=3 SV=1	0.87037	2.1627	0	0	0	49884	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	49884	0	0	0	0	0	0	0	0	0	0	0
A0A165Z2B4	A0A165Z2B4_DAUCS	Uncharacterized protein	DCAR_013109	Daucus carota subsp. sativus (Carrot)			glucuronosyltransferase activity [GO:0015020]	glucuronosyltransferase activity [GO:0015020]	YGRNQCQ	tr|A0A165Z2B4|A0A165Z2B4_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_013109 PE=4 SV=1	0.93322	1.378	0	51120	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	51120	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A165Z5V2	A0A165Z5V2_DAUCS	"Lipoyl synthase, mitochondrial (EC 2.8.1.8) (Lipoate synthase) (LS) (Lip-syn) (Lipoic acid synthase)"	DCAR_012991	Daucus carota subsp. sativus (Carrot)	protein lipoylation [GO:0009249]	mitochondrion [GO:0005739]	"mitochondrion [GO:0005739]; 4 iron, 4 sulfur cluster binding [GO:0051539]; lipoate synthase activity [GO:0016992]; lipoyl synthase activity (acting on glycine-cleavage complex H protein [GO:0102552]; lipoyl synthase activity (acting on pyruvate dehydrogenase E2 protein) [GO:0102553]; metal ion binding [GO:0046872]; protein lipoylation [GO:0009249]"	"4 iron, 4 sulfur cluster binding [GO:0051539]; lipoate synthase activity [GO:0016992]; lipoyl synthase activity (acting on glycine-cleavage complex H protein [GO:0102552]; lipoyl synthase activity (acting on pyruvate dehydrogenase E2 protein) [GO:0102553]; metal ion binding [GO:0046872]"	AASSSSS	"tr|A0A165Z5V2|A0A165Z5V2_DAUCS Lipoyl synthase, mitochondrial OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_012991 PE=3 SV=1;tr|A0A2U1NXG1|A0A2U1NXG1_ARTAN Lipoyl synthase, mitochondrial OS=Artemisia annua OX=35608 GN=LIP1 PE=3 SV=1;tr|A0A6S7N2Y2|A0A6S7"	0.75	2.756	28490	17191	25951	51148	138460	0	0	11398	0	28490	0	0	13162	0	0	0	17191	0	0	0	0	14130	0	11364	0	0	0	0	0	0	25951	0	0	0	0	19195	13423	0	0	51148	0	47766	138460	0	0	0	0	14391	0	12944
A0A165ZA12	A0A165ZA12_DAUCS	Uncharacterized protein	DCAR_012844	Daucus carota subsp. sativus (Carrot)	transmembrane transport [GO:0055085]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transport [GO:0055085]		SDAHAYK	tr|A0A165ZA12|A0A165ZA12_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_012844 PE=4 SV=1	0.89674	1.378	0	440250	0	0	82347	0	0	0	0	0	0	0	0	0	440250	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	82347
A0A165ZE50	A0A165ZE50_DAUCS	Uncharacterized protein	DCAR_008676	Daucus carota subsp. sativus (Carrot)					YHSDCCR	tr|A0A165ZE50|A0A165ZE50_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_008676 PE=4 SV=1	0.77427	1.378	0	0	4693.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4693.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A165ZF47	A0A165ZF47_DAUCS	Metallophos domain-containing protein	DCAR_008714	Daucus carota subsp. sativus (Carrot)	GPI anchor biosynthetic process [GO:0006506]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; hydrolase activity [GO:0016787]; GPI anchor biosynthetic process [GO:0006506]	hydrolase activity [GO:0016787]	THYDGTR	tr|A0A165ZF47|A0A165ZF47_DAUCS Metallophos domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_008714 PE=4 SV=1	0.89848	1.378	68072	55528	56440	22747	57542	0	0	16308	0	0	68072	0	0	0	55528	0	25812	42693	0	0	21358	0	0	56440	0	29903	0	0	0	0	0	0	0	0	0	0	0	0	0	22747	0	0	0	0	0	0	57542	0	0	0
A0A165ZFB4	A0A165ZFB4_DAUCS	Uncharacterized protein	DCAR_008721	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		QNCVSEG	tr|A0A165ZFB4|A0A165ZFB4_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_008721 PE=4 SV=1	0.89394	1.378	0	0	17622	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17622	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A165ZIW5	A0A165ZIW5_DAUCS	Uncharacterized protein	DCAR_008839	Daucus carota subsp. sativus (Carrot)			"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	CQGGGEK	tr|A0A165ZIW5|A0A165ZIW5_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_008839 PE=3 SV=1	0.85589	1.378	0	11976	0	13050	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11976	0	0	0	0	0	0	0	0	0	0	13050	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A165ZL98	A0A165ZL98_DAUCS	ABC transporter domain-containing protein	DCAR_008922	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]	ATP binding [GO:0005524]	LNMQFFK	tr|A0A165ZL98|A0A165ZL98_DAUCS ABC transporter domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_008922 PE=3 SV=1	0.85664	1.378	6509.4	0	7905.3	10900	0	4785	6509.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7905.3	0	0	0	0	0	0	0	0	0	0	0	0	10900	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A165ZND0	A0A165ZND0_DAUCS	Uncharacterized protein	DCAR_008992	Daucus carota subsp. sativus (Carrot)	translation [GO:0006412]	ribosome [GO:0005840]	ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	FGCDFSK	tr|A0A165ZND0|A0A165ZND0_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_008992 PE=4 SV=1	0.77439	1.378	0	109870	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	109870	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A165ZYH8	A0A165ZYH8_DAUCS	Alpha-carbonic anhydrase domain-containing protein	DCAR_009309	Daucus carota subsp. sativus (Carrot)			carbonate dehydratase activity [GO:0004089]; zinc ion binding [GO:0008270]	carbonate dehydratase activity [GO:0004089]; zinc ion binding [GO:0008270]	TSHDVYR	tr|A0A165ZYH8|A0A165ZYH8_DAUCS Alpha-carbonic anhydrase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_009309 PE=3 SV=1	0.7682	1.378	0	0	10020	9203.2	5443.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10020	0	0	0	0	0	0	0	0	7701.5	9203.2	0	0	0	0	0	5443.3	0	0	0	0	0
A0A166A0F6	A0A166A0F6_DAUCS	C2 NT-type domain-containing protein	DCAR_009366	Daucus carota subsp. sativus (Carrot)					WNSLPPK	tr|A0A166A0F6|A0A166A0F6_DAUCS C2 NT-type domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_009366 PE=4 SV=1	0.90194	1.378	15350	16685	11830	0	11817	0	0	0	15350	0	0	0	0	14695	0	0	0	0	15664	0	0	0	16685	0	11830	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11817	0	8576.4	0	0	0	0
A0A166A331	A0A166A331_DAUCS	Uncharacterized protein	DCAR_009440	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GYTYSFR	tr|A0A166A331|A0A166A331_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_009440 PE=4 SV=1	0.76765	1.378	0	22584	0	16952	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22584	0	0	0	0	0	0	0	0	0	0	16952	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166A3L5	A0A166A3L5_DAUCS	Uncharacterized protein	DCAR_009459	Daucus carota subsp. sativus (Carrot)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; structural molecule activity [GO:0005198]	DNA binding [GO:0003677]; structural molecule activity [GO:0005198]	EGSGDDR	tr|A0A166A3L5|A0A166A3L5_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_009459 PE=4 SV=1	0.76183	1.378	8456.7	0	0	0	0	0	0	8456.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166A3N6	A0A166A3N6_DAUCS	Uncharacterized protein	DCAR_009461	Daucus carota subsp. sativus (Carrot)		nucleus [GO:0005634]	nucleus [GO:0005634]; histone-lysine N-methyltransferase activity [GO:0018024]; zinc ion binding [GO:0008270]	histone-lysine N-methyltransferase activity [GO:0018024]; zinc ion binding [GO:0008270]	DDPDNER	tr|A0A166A3N6|A0A166A3N6_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_009461 PE=4 SV=1	0.75724	1.378	0	18256	8081.9	0	15733	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18256	0	0	0	0	0	0	0	0	8081.9	0	0	0	0	0	0	0	0	0	0	0	0	0	15733	0	0	0	0	0	0	0
A0A166A4T9	A0A166A4T9_DAUCS	Uncharacterized protein	DCAR_009498	Daucus carota subsp. sativus (Carrot)					QPCVPKK	tr|A0A166A4T9|A0A166A4T9_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_009498 PE=4 SV=1	0.7578	1.378	46569	12165	15234	18434	8959.7	0	6771	46569	27969	11699	0	0	11523	7953.7	0	0	0	0	0	0	0	12165	0	6911.5	6268.4	0	0	0	0	15234	9606.1	0	12397	18434	0	14775	0	0	0	0	0	0	0	0	0	0	0	8959.7	0	0
A0A166A9X7	A0A166A9X7_DAUCS	Uncharacterized protein	DCAR_009680	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		EQCASDK	tr|A0A166A9X7|A0A166A9X7_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_009680 PE=4 SV=1	0.75835	1.378	99901	105450	0	0	0	99901	0	0	0	0	0	0	0	0	0	0	0	0	105450	0	0	33124	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166AAC5	A0A166AAC5_DAUCS	SET domain-containing protein	DCAR_009696	Daucus carota subsp. sativus (Carrot)					CSESNYR	tr|A0A166AAC5|A0A166AAC5_DAUCS SET domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_009696 PE=4 SV=1	0.88636	2.202	0	6948.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6948.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166AB16	A0A166AB16_DAUCS	Uncharacterized protein	DCAR_009728	Daucus carota subsp. sativus (Carrot)					DEIAMNM	tr|A0A166AB16|A0A166AB16_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_009728 PE=4 SV=1	0.75891	1.378	0	0	6670.4	3433	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6670.4	0	0	0	0	0	0	0	0	0	0	0	0	0	3433	0	0	0	0	0	0	0	0	0	0	0
A0A166AG48	A0A166AG48_DAUCS	Coatomer subunit alpha	DCAR_009950	Daucus carota subsp. sativus (Carrot)	intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	COPI vesicle coat [GO:0030126]; Golgi membrane [GO:0000139]	COPI vesicle coat [GO:0030126]; Golgi membrane [GO:0000139]; structural molecule activity [GO:0005198]; intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	structural molecule activity [GO:0005198]	EQTSYEYR	"tr|A0A166AG48|A0A166AG48_DAUCS Coatomer subunit alpha OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_009950 PE=4 SV=1;tr|A0A103XYQ8|A0A103XYQ8_CYNCS Coatomer, alpha subunit, C-terminal OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_022455 PE=4 SV=1"	0.75758	2.622	0	0	29865	28785	10266	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13083	0	0	0	0	29865	0	0	0	0	0	0	0	28785	0	22765	0	0	0	0	0	0	0	10266	0	0	0
A0A166ANQ1	A0A166ANQ1_DAUCS	Uncharacterized protein	DCAR_010313	Daucus carota subsp. sativus (Carrot)					GFTEMAR	tr|A0A166ANQ1|A0A166ANQ1_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_010313 PE=4 SV=1	0.88575	1.378	0	67107	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	67107	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166AZZ5	A0A166AZZ5_DAUCS	Uncharacterized protein	DCAR_010925	Daucus carota subsp. sativus (Carrot)					PIKHALK	tr|A0A166AZZ5|A0A166AZZ5_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_010925 PE=4 SV=1	0.76058	1.378	0	0	4280.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4280.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166B3I8	A0A166B3I8_DAUCS	SpoU_methylase domain-containing protein	DCAR_011065	Daucus carota subsp. sativus (Carrot)	tRNA methylation [GO:0030488]		RNA methyltransferase activity [GO:0008173]; tRNA binding [GO:0000049]; tRNA methylation [GO:0030488]	RNA methyltransferase activity [GO:0008173]; tRNA binding [GO:0000049]	LKPTPKL	tr|A0A166B3I8|A0A166B3I8_DAUCS SpoU_methylase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_011065 PE=3 SV=1	0.8895	1.378	0	0	0	0	2734.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2734.6	0	0	0	0	0
A0A166B3J9	A0A166B3J9_DAUCS	Uncharacterized protein	DCAR_011068	Daucus carota subsp. sativus (Carrot)					PLLAEER	tr|A0A166B3J9|A0A166B3J9_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_011068 PE=4 SV=1	0.76114	1.378	0	5560.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5560.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166B7S3	A0A166B7S3_DAUCS	Uncharacterized protein	DCAR_011224	Daucus carota subsp. sativus (Carrot)			electron transfer activity [GO:0009055]; heme binding [GO:0020037]; metal ion binding [GO:0046872]	electron transfer activity [GO:0009055]; heme binding [GO:0020037]; metal ion binding [GO:0046872]	FYARIRK	tr|A0A166B7S3|A0A166B7S3_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_011224 PE=4 SV=1	0.89007	1.378	23440	25819	33369	23102	0	0	23440	0	0	0	0	0	18557	0	0	25819	0	0	0	0	0	0	24710	0	0	0	0	0	30678	0	0	33369	0	0	0	0	0	16660	0	23102	0	0	0	0	0	0	0	0	0	0
A0A166BU85	A0A166BU85_DAUCS	Protein kinase domain-containing protein	DCAR_011636	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; transmembrane receptor protein serine/threonine kinase activity [GO:0004675]	ATP binding [GO:0005524]; transmembrane receptor protein serine/threonine kinase activity [GO:0004675]	PGDCDPR	tr|A0A166BU85|A0A166BU85_DAUCS Protein kinase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_011636 PE=3 SV=1	0.86996	1.378	189950	0	105010	30531	0	0	189950	159250	0	0	0	29620	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	105010	0	30531	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166BUE7	A0A166BUE7_DAUCS	Uncharacterized protein	DCAR_011644	Daucus carota subsp. sativus (Carrot)			"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	HSGDHEK	tr|A0A166BUE7|A0A166BUE7_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_011644 PE=3 SV=1	0.86958	1.378	35356	0	25134	51563	0	35356	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25134	0	0	51563	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166C1W5	A0A166C1W5_DAUCS	Auxin response factor	DCAR_011930	Daucus carota subsp. sativus (Carrot)	"auxin-activated signaling pathway [GO:0009734]; regulation of transcription, DNA-templated [GO:0006355]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; auxin-activated signaling pathway [GO:0009734]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]	RAEGAEM	tr|A0A166C1W5|A0A166C1W5_DAUCS Auxin response factor OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_011930 PE=3 SV=1	0.76127	1.378	0	0	0	61859	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	61859	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166C861	A0A166C861_DAUCS	Uncharacterized protein	DCAR_012172	Daucus carota subsp. sativus (Carrot)					MMFFQFR	tr|A0A166C861|A0A166C861_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_012172 PE=4 SV=1	0.88253	1.378	4990.2	0	0	0	0	0	0	0	0	0	0	4990.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166CCV4	A0A166CCV4_DAUCS	Uncharacterized protein	DCAR_012355	Daucus carota subsp. sativus (Carrot)					YDAAIDR	tr|A0A166CCV4|A0A166CCV4_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_012355 PE=4 SV=1	0.88316	1.378	0	0	0	2548.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2548.3	0	0	0	0	0	0	0	0	0
A0A166CG23	A0A166CG23_DAUCS	N-acetyltransferase domain-containing protein	DCAR_012484	Daucus carota subsp. sativus (Carrot)			N-acetyltransferase activity [GO:0008080]	N-acetyltransferase activity [GO:0008080]	KPLPVVK	tr|A0A166CG23|A0A166CG23_DAUCS N-acetyltransferase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_012484 PE=4 SV=1;tr|A0A6S7P4H2|A0A6S7P4H2_LACSI N-acetyltransferase domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_	0.77143	2.4924	0	133110	88995	121040	144310	0	0	0	0	0	0	0	0	0	0	0	133110	0	0	0	0	0	0	0	7542.6	88995	0	0	0	0	0	0	0	0	0	0	0	0	0	0	121040	144310	0	0	0	0	0	0	0	0
A0A166CJM0	A0A166CJM0_DAUCS	Uncharacterized protein	DCAR_004841	Daucus carota subsp. sativus (Carrot)	defense response [GO:0006952]		ADP binding [GO:0043531]; defense response [GO:0006952]	ADP binding [GO:0043531]	FTIWQIK	tr|A0A166CJM0|A0A166CJM0_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_004841 PE=4 SV=1	0.76238	1.378	0	0	0	0	31079	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31079	0	0	0	0	0
A0A166CQL3	A0A166CQL3_DAUCS	Uncharacterized protein	DCAR_005038	Daucus carota subsp. sativus (Carrot)	carbohydrate metabolic process [GO:0005975]	cell wall [GO:0005618]	cell wall [GO:0005618]; polygalacturonase activity [GO:0004650]; carbohydrate metabolic process [GO:0005975]	polygalacturonase activity [GO:0004650]	RALPVVK	tr|A0A166CQL3|A0A166CQL3_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_005038 PE=3 SV=1	0.91106	1.378	51768	0	21970	29292	21531	0	10514	5853.3	0	51768	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21970	0	0	0	0	0	10917	29292	0	0	0	0	2223.5	0	0	0	0	0	0	21531	0	0
A0A166CW07	A0A166CW07_DAUCS	PBPe domain-containing protein	DCAR_005246	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ligand-gated ion channel activity [GO:0015276]	ligand-gated ion channel activity [GO:0015276]	GFDPNKR	tr|A0A166CW07|A0A166CW07_DAUCS PBPe domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_005246 PE=3 SV=1	0.76654	1.378	17427	0	0	0	0	0	0	0	13250	0	0	17427	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166CW74	A0A166CW74_DAUCS	Uncharacterized protein	DCAR_005255	Daucus carota subsp. sativus (Carrot)					TPSCEQK	tr|A0A166CW74|A0A166CW74_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_005255 PE=4 SV=1;tr|A0A166H3F8|A0A166H3F8_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_002330 PE=4 SV=1	0.90761	1.378	39104	25196	48717	56943	51848	0	0	5208.7	0	0	39104	0	0	0	0	0	16551	0	0	25196	10692	0	0	0	0	0	0	0	0	0	0	48717	0	0	0	0	0	0	0	0	56943	51848	0	0	0	0	17019	0	0	0
A0A166DFU6	A0A166DFU6_DAUCS	AB hydrolase-1 domain-containing protein	DCAR_006041	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GGMHCGR	tr|A0A166DFU6|A0A166DFU6_DAUCS AB hydrolase-1 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_006041 PE=4 SV=1	0.91368	1.378	20567	26428	0	15132	0	0	0	0	20567	0	0	19187	0	16556	0	0	0	0	26428	0	0	0	14513	0	0	0	0	0	0	0	0	0	0	0	0	15132	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166DG12	A0A166DG12_DAUCS	Thioredoxin domain-containing protein	DCAR_006049	Daucus carota subsp. sativus (Carrot)					SMAFMAM	tr|A0A166DG12|A0A166DG12_DAUCS Thioredoxin domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_006049 PE=4 SV=1	0.85333	2.0092	334460	368200	241150	283680	77235	334460	263790	255110	0	0	0	0	291990	0	164490	367820	208690	0	0	268640	0	284030	368200	98273	0	195050	0	210440	0	0	0	241150	283680	0	0	0	0	0	0	0	0	0	0	0	77235	0	0	0	0	0
A0A166DLW6	A0A166DLW6_DAUCS	Uncharacterized protein	DCAR_006247	Daucus carota subsp. sativus (Carrot)					SSSRGEM	tr|A0A166DLW6|A0A166DLW6_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_006247 PE=4 SV=1	0.76209	1.378	0	0	6161.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3033.7	0	6161.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166DM19	A0A166DM19_DAUCS	FRIGIDA-like protein	DCAR_006251	Daucus carota subsp. sativus (Carrot)	cell differentiation [GO:0030154]; flower development [GO:0009908]		cell differentiation [GO:0030154]; flower development [GO:0009908]		GSSGGHR	tr|A0A166DM19|A0A166DM19_DAUCS FRIGIDA-like protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_006251 PE=3 SV=1	0.76265	1.378	0	0	23313	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23313	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166DRI4	A0A166DRI4_DAUCS	PUM-HD domain-containing protein	DCAR_006423	Daucus carota subsp. sativus (Carrot)	regulation of translation [GO:0006417]		RNA binding [GO:0003723]; regulation of translation [GO:0006417]	RNA binding [GO:0003723]	DQNGNVM	tr|A0A166DRI4|A0A166DRI4_DAUCS PUM-HD domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_006423 PE=4 SV=1	0.7632	1.378	0	8617.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8617.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166DUS3	A0A166DUS3_DAUCS	Uncharacterized protein	DCAR_006546	Daucus carota subsp. sativus (Carrot)			"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	NICSEYR	tr|A0A166DUS3|A0A166DUS3_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_006546 PE=3 SV=1	0.76376	1.378	0	0	5259.2	4331.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5259.2	0	0	0	0	0	0	0	4331.3	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166DWP6	A0A166DWP6_DAUCS	TRUD domain-containing protein	DCAR_006618	Daucus carota subsp. sativus (Carrot)	pseudouridine synthesis [GO:0001522]; tRNA processing [GO:0008033]		pseudouridine synthase activity [GO:0009982]; RNA binding [GO:0003723]; pseudouridine synthesis [GO:0001522]; tRNA processing [GO:0008033]	pseudouridine synthase activity [GO:0009982]; RNA binding [GO:0003723]	RAISTQR	tr|A0A166DWP6|A0A166DWP6_DAUCS TRUD domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_006618 PE=3 SV=1	0.89293	1.378	0	0	0	40666	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	40666	0	0	0	0	0	0	0	0	0	0
A0A166DZ03	A0A166DZ03_DAUCS	RING-type domain-containing protein	DCAR_006694	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; metal ion binding [GO:0046872]; ubiquitin protein ligase activity [GO:0061630]	metal ion binding [GO:0046872]; ubiquitin protein ligase activity [GO:0061630]	LATYYNR	tr|A0A166DZ03|A0A166DZ03_DAUCS RING-type domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_006694 PE=4 SV=1	0.76431	1.378	0	0	9499.4	0	12418	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9499.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12418	0	0	0	0	0	0	0	0
A0A166DZI5	A0A166DZI5_DAUCS	Uncharacterized protein	DCAR_006714	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	DFVMPER	tr|A0A166DZI5|A0A166DZI5_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_006714 PE=4 SV=1	0.76487	1.378	40207	27531	32629	32317	27675	40207	4444.4	0	0	0	0	0	0	31466	0	0	0	0	27531	0	0	0	0	0	0	0	0	0	0	0	32629	0	0	30076	0	32317	0	0	0	0	0	0	0	0	0	27675	0	0	0	0
A0A166E0B2	A0A166E0B2_DAUCS	C2 NT-type domain-containing protein	DCAR_006748	Daucus carota subsp. sativus (Carrot)					RALTEEK	tr|A0A166E0B2|A0A166E0B2_DAUCS C2 NT-type domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_006748 PE=4 SV=1	0.76543	1.378	0	0	7415.2	13382	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7415.2	0	0	13382	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166E1Q3	A0A166E1Q3_DAUCS	PMEI domain-containing protein	DCAR_006807	Daucus carota subsp. sativus (Carrot)			enzyme inhibitor activity [GO:0004857]	enzyme inhibitor activity [GO:0004857]	TQDMEDR	tr|A0A166E1Q3|A0A166E1Q3_DAUCS PMEI domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_006807 PE=4 SV=1	0.8962	1.378	0	0	4040	6639.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4040	0	0	0	0	6639.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166E481	A0A166E481_DAUCS	Uncharacterized protein	DCAR_006908	Daucus carota subsp. sativus (Carrot)					VRWGPFK	tr|A0A166E481|A0A166E481_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_006908 PE=4 SV=1	0.76598	1.378	0	20386	0	0	0	0	0	0	0	0	0	0	0	0	0	20386	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166E571	A0A166E571_DAUCS	Uncharacterized protein	DCAR_006945	Daucus carota subsp. sativus (Carrot)					QDVHKMK	tr|A0A166E571|A0A166E571_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_006945 PE=4 SV=1	0.76709	1.378	0	0	0	0	19351	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19351	0	0	0	0	0
A0A166EC59	A0A166EC59_DAUCS	Probable 6-phosphogluconolactonase (EC 3.1.1.31)	DCAR_007201	Daucus carota subsp. sativus (Carrot)	carbohydrate metabolic process [GO:0005975]; pentose-phosphate shunt [GO:0006098]		6-phosphogluconolactonase activity [GO:0017057]; carbohydrate metabolic process [GO:0005975]; pentose-phosphate shunt [GO:0006098]	6-phosphogluconolactonase activity [GO:0017057]	DAGPLAM	tr|A0A166EC59|A0A166EC59_DAUCS Probable 6-phosphogluconolactonase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_007201 PE=3 SV=1	0.77464	1.378	0	0	0	18585	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18585	0	0	0	0	0	0	0	0	0
A0A166EDX4	A0A166EDX4_DAUCS	Fe2OG dioxygenase domain-containing protein	DCAR_007273	Daucus carota subsp. sativus (Carrot)			"dioxygenase activity [GO:0051213]; iron ion binding [GO:0005506]; L-ascorbic acid binding [GO:0031418]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"dioxygenase activity [GO:0051213]; iron ion binding [GO:0005506]; L-ascorbic acid binding [GO:0031418]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	STTSGHR	tr|A0A166EDX4|A0A166EDX4_DAUCS Fe2OG dioxygenase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_007273 PE=4 SV=1	0.83043	1.378	365070	552730	543670	392220	241040	0	0	365070	0	0	0	0	0	0	56543	113670	0	249310	0	552730	0	387460	0	0	62375	135830	543670	344200	520100	401050	0	88204	348230	0	0	310040	0	0	392220	64002	53307	0	0	0	0	0	238190	0	0	241040
A0A166ELC0	A0A166ELC0_DAUCS	Uncharacterized protein	DCAR_007561	Daucus carota subsp. sativus (Carrot)					DRCEDSR	tr|A0A166ELC0|A0A166ELC0_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_007561 PE=4 SV=1	0.82916	1.378	0	0	4342.6	0	5084.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4342.6	0	0	0	0	0	0	0	0	0	0	0	5084.5	0	0	0	0	0	0	0	0
A0A166ESC1	A0A166ESC1_DAUCS	Syntaxin-6_N domain-containing protein	DCAR_007753	Daucus carota subsp. sativus (Carrot)	Golgi vesicle transport [GO:0048193]; protein transport [GO:0015031]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; Golgi vesicle transport [GO:0048193]; protein transport [GO:0015031]		YQRPRIT	tr|A0A166ESC1|A0A166ESC1_DAUCS Syntaxin-6_N domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_007753 PE=4 SV=1	0.83991	1.378	0	257760	0	234920	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	257760	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	234920	0	0	0	0	0	0	0	0	0
A0A166F0X9	A0A166F0X9_DAUCS	Clathrin light chain	DCAR_008047	Daucus carota subsp. sativus (Carrot)	intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	clathrin coat of coated pit [GO:0030132]; clathrin coat of trans-Golgi network vesicle [GO:0030130]	clathrin coat of coated pit [GO:0030132]; clathrin coat of trans-Golgi network vesicle [GO:0030130]; structural molecule activity [GO:0005198]; intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	structural molecule activity [GO:0005198]	LLLLRHR	tr|A0A166F0X9|A0A166F0X9_DAUCS Clathrin light chain OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_008047 PE=3 SV=1;tr|A0A164TPY3|A0A164TPY3_DAUCS Clathrin light chain OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_024912 PE=3 SV=1	0.81102	1.378	9180.7	15450	0	8718.3	7616.6	0	0	0	0	9180.7	0	0	0	7860.8	0	0	0	11156	0	0	0	0	15450	0	0	0	0	0	0	0	0	0	0	0	0	8718.3	0	0	0	0	0	0	0	7616.6	0	0	0	0	0	0
A0A166F5F6	A0A166F5F6_DAUCS	Uncharacterized protein	DCAR_008202	Daucus carota subsp. sativus (Carrot)		cytosol [GO:0005829]	cytosol [GO:0005829]; ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; nucleic acid binding [GO:0003676]; RNA helicase activity [GO:0003724]	ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; nucleic acid binding [GO:0003676]; RNA helicase activity [GO:0003724]	SESDFAM	tr|A0A166F5F6|A0A166F5F6_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_008202 PE=3 SV=1	0.875	2.756	0	12927	0	0	23390	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12927	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23390	4338.3	0	0	0	0	0	0
A0A166F6S2	A0A166F6S2_DAUCS	Uncharacterized protein	DCAR_008245	Daucus carota subsp. sativus (Carrot)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	PERTKEK	tr|A0A166F6S2|A0A166F6S2_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_008245 PE=4 SV=1	0.94198	1.378	0	6155.8	0	12168	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6155.8	0	0	0	0	0	0	0	0	0	12168	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166F7Q3	A0A166F7Q3_DAUCS	MHD domain-containing protein	DCAR_008277	Daucus carota subsp. sativus (Carrot)	endocytosis [GO:0006897]; intracellular protein transport [GO:0006886]	clathrin adaptor complex [GO:0030131]; clathrin-coated pit [GO:0005905]	clathrin adaptor complex [GO:0030131]; clathrin-coated pit [GO:0005905]; endocytosis [GO:0006897]; intracellular protein transport [GO:0006886]		VHIMQTK	tr|A0A166F7Q3|A0A166F7Q3_DAUCS MHD domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_008277 PE=3 SV=1	0.82377	1.378	0	19698	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19698	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166F901	A0A166F901_DAUCS	AAI domain-containing protein	DCAR_008327	Daucus carota subsp. sativus (Carrot)					VGCGQIR	tr|A0A166F901|A0A166F901_DAUCS AAI domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_008327 PE=4 SV=1	0.77476	1.378	0	365670	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	365670	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166FEK9	A0A166FEK9_DAUCS	Na_H_Exchanger domain-containing protein	DCAR_008528	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; solute:proton antiporter activity [GO:0015299]	solute:proton antiporter activity [GO:0015299]	VEEKFKK	tr|A0A166FEK9|A0A166FEK9_DAUCS Na_H_Exchanger domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_008528 PE=4 SV=1	0.77943	1.378	0	13769	0	0	22804	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13769	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22804	0	0	0	0	0	0	0	0
A0A166FH98	A0A166FH98_DAUCS	CCHC-type domain-containing protein	DCAR_008617	Daucus carota subsp. sativus (Carrot)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	AHPHPYR	tr|A0A166FH98|A0A166FH98_DAUCS CCHC-type domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_008617 PE=4 SV=1	0.82728	1.378	7604.9	11485	11875	0	0	0	0	0	7604.9	0	0	0	0	0	0	0	0	0	0	0	0	11485	0	0	0	0	0	0	0	11875	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166FIC8	A0A166FIC8_DAUCS	Uncharacterized protein	DCAR_008652	Daucus carota subsp. sativus (Carrot)	transmembrane transport [GO:0055085]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transport [GO:0055085]		NVDESSM	tr|A0A166FIC8|A0A166FIC8_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_008652 PE=3 SV=1	0.77955	1.378	0	0	0	25407	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25407	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166FK23	A0A166FK23_DAUCS	Uncharacterized protein	DCAR_000538	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; plasmodesma [GO:0009506]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; plasmodesma [GO:0009506]		PGRVTER	tr|A0A166FK23|A0A166FK23_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_000538 PE=4 SV=1	0.77967	1.378	78226	0	0	0	0	0	78226	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166FQ78	A0A166FQ78_DAUCS	Nkap_C domain-containing protein	DCAR_000720	Daucus carota subsp. sativus (Carrot)			chromatin binding [GO:0003682]	chromatin binding [GO:0003682]	PAEDADD	tr|A0A166FQ78|A0A166FQ78_DAUCS Nkap_C domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_000720 PE=3 SV=1	0.86302	1.378	0	62755	17340	29024	25957	0	0	0	0	0	0	0	0	0	0	51887	62755	0	0	0	34527	0	0	0	0	16373	0	0	0	0	0	17340	0	0	0	0	29024	0	0	0	11765	0	0	0	25957	12492	0	20659	0	0
A0A166FT33	A0A166FT33_DAUCS	WRKY domain-containing protein	DCAR_000809	Daucus carota subsp. sativus (Carrot)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	SFGTDDM	tr|A0A166FT33|A0A166FT33_DAUCS WRKY domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_000809 PE=4 SV=1	0.77979	1.378	0	19929	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19929	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166FTM2	A0A166FTM2_DAUCS	Uncharacterized protein	DCAR_001225	Daucus carota subsp. sativus (Carrot)					MDYGSGG	tr|A0A166FTM2|A0A166FTM2_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_001225 PE=4 SV=1	0.86328	1.378	0	3800.2	0	0	0	0	0	0	0	0	0	0	0	0	3800.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166FVI2	A0A166FVI2_DAUCS	Uncharacterized protein	DCAR_001295	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; potassium ion transmembrane transporter activity [GO:0015079]	potassium ion transmembrane transporter activity [GO:0015079]	YDRKIVR	tr|A0A166FVI2|A0A166FVI2_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_001295 PE=3 SV=1	0.86009	1.378	0	0	0	4396.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4396.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166G6B8	A0A166G6B8_DAUCS	Uncharacterized protein	DCAR_001119	Daucus carota subsp. sativus (Carrot)					VHCSSIF	tr|A0A166G6B8|A0A166G6B8_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_001119 PE=4 SV=1	0.86979	1.378	62328	90113	16856	16654	12535	0	0	0	0	17382	0	62328	21676	13524	10821	0	0	0	90113	0	0	23806	0	0	0	0	0	0	0	16856	0	0	16654	0	0	0	0	0	0	0	0	0	0	0	0	10955	0	12535	0	0
A0A166G8P0	A0A166G8P0_DAUCS	Histone deacetylase (EC 3.5.1.98)	DCAR_001205	Daucus carota subsp. sativus (Carrot)	"melatonin metabolic process [GO:0030186]; regulation of photosynthesis, light reaction [GO:0042548]"	chloroplast stroma [GO:0009570]; cytosol [GO:0005829]; extracellular region [GO:0005576]; mitochondrion [GO:0005739]; nucleus [GO:0005634]	"chloroplast stroma [GO:0009570]; cytosol [GO:0005829]; extracellular region [GO:0005576]; mitochondrion [GO:0005739]; nucleus [GO:0005634]; alpha-tubulin binding [GO:0043014]; beta-tubulin binding [GO:0048487]; NAD-dependent histone deacetylase activity (H3-K14 specific) [GO:0032041]; protein phosphatase 2A binding [GO:0051721]; protein self-association [GO:0043621]; tubulin deacetylase activity [GO:0042903]; melatonin metabolic process [GO:0030186]; regulation of photosynthesis, light reaction [GO:0042548]"	alpha-tubulin binding [GO:0043014]; beta-tubulin binding [GO:0048487]; NAD-dependent histone deacetylase activity (H3-K14 specific) [GO:0032041]; protein phosphatase 2A binding [GO:0051721]; protein self-association [GO:0043621]; tubulin deacetylase activity [GO:0042903]	PFNQLEFIESRGKFPTK	tr|A0A166G8P0|A0A166G8P0_DAUCS Histone deacetylase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_001205 PE=3 SV=1	0.93151	1.378	0	19520	0	22032	13823	0	0	0	0	0	0	0	0	0	0	19520	0	0	0	0	13483	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22032	0	0	0	0	0	0	13823	0	0	0
A0A166GBW7	A0A166GBW7_DAUCS	Phosphatidylserine decarboxylase (EC 4.1.1.65)	DCAR_001444	Daucus carota subsp. sativus (Carrot)	phospholipid biosynthetic process [GO:0008654]		calcium ion binding [GO:0005509]; phosphatidylserine decarboxylase activity [GO:0004609]; phospholipid biosynthetic process [GO:0008654]	calcium ion binding [GO:0005509]; phosphatidylserine decarboxylase activity [GO:0004609]	DSGVVLK	tr|A0A166GBW7|A0A166GBW7_DAUCS Phosphatidylserine decarboxylase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_001444 PE=4 SV=1	0.77948	1.378	0	0	0	110000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	110000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166GDP5	A0A166GDP5_DAUCS	RING-type domain-containing protein	DCAR_001500	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	EENQHER	tr|A0A166GDP5|A0A166GDP5_DAUCS RING-type domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_001500 PE=4 SV=1	0.78003	1.378	0	0	9611.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9611.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166GDW9	A0A166GDW9_DAUCS	Uncharacterized protein	DCAR_001504 DCAR_001506	Daucus carota subsp. sativus (Carrot)			"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	DELVHAK	tr|A0A166GDW9|A0A166GDW9_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_001504 PE=3 SV=1	0.71429	2.756	10458	11807	1861200	2481100	25975	6949.8	5118.6	10458	0	0	0	0	9092.1	0	5906.2	11807	0	0	0	0	0	0	0	1861200	0	0	24046	0	0	0	0	10981	0	7567.6	23530	11649	2481100	16858	0	2440300	7305	25975	0	0	15153	0	19567	9964.1	0	0
A0A166GFR7	A0A166GFR7_DAUCS	Knot1 domain-containing protein	DCAR_001564	Daucus carota subsp. sativus (Carrot)	defense response [GO:0006952]		defense response [GO:0006952]		CFCYHAC	tr|A0A166GFR7|A0A166GFR7_DAUCS Knot1 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_001564 PE=4 SV=1	0.84697	1.378	0	0	0	25061	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25061	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166GKQ0	A0A166GKQ0_DAUCS	Uncharacterized protein	DCAR_001720	Daucus carota subsp. sativus (Carrot)	"mRNA splicing, via spliceosome [GO:0000398]"	U2AF complex [GO:0089701]	"U2AF complex [GO:0089701]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]; mRNA splicing, via spliceosome [GO:0000398]"	metal ion binding [GO:0046872]; RNA binding [GO:0003723]	HREGTDCDSSDGDTDTR	tr|A0A166GKQ0|A0A166GKQ0_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_001720 PE=4 SV=1	0.92466	1.378	0	0	11444	17280	22278	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11444	0	0	0	0	0	0	0	0	17280	0	0	0	0	0	0	0	22278	0	0	0	0	0	0	0
A0A166GPL1	A0A166GPL1_DAUCS	Uncharacterized protein	DCAR_001854	Daucus carota subsp. sativus (Carrot)	gene silencing by RNA [GO:0031047]		gene silencing by RNA [GO:0031047]		SHDSEFK	tr|A0A166GPL1|A0A166GPL1_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_001854 PE=4 SV=1	0.78058	1.378	0	63075	48770	59067	28373	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35074	63075	0	0	0	15264	0	0	48770	20193	0	0	0	0	0	27951	0	59067	20529	27162	0	0	0	28373	0	0	0	0	0	0	0
A0A166GW49	A0A166GW49_DAUCS	Uncharacterized protein	DCAR_002073	Daucus carota subsp. sativus (Carrot)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	EPDAGDM	tr|A0A166GW49|A0A166GW49_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_002073 PE=4 SV=1	0.78113	1.378	0	37141	0	0	11699	0	0	0	0	0	0	0	0	0	0	0	0	37141	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11699	0	0	0	0	0	0
A0A166GZW6	A0A166GZW6_DAUCS	Uncharacterized protein	DCAR_002206	Daucus carota subsp. sativus (Carrot)			6-phosphofructokinase activity [GO:0003872]	6-phosphofructokinase activity [GO:0003872]	RAIVKPK	tr|A0A166GZW6|A0A166GZW6_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_002206 PE=4 SV=1	0.78125	1.378	260020	230130	128060	107200	26792	0	7574.2	0	0	260020	167670	0	100850	0	7172.6	0	11199	36841	0	230130	0	0	0	32055	0	26330	44563	0	0	128060	0	0	0	56760	107200	0	25921	9951.4	0	0	6683.8	26792	0	0	1383.3	0	1837.8	5901.8	6983.5	0
A0A166H5Z9	A0A166H5Z9_DAUCS	Hydrolase_4 domain-containing protein	DCAR_002423	Daucus carota subsp. sativus (Carrot)					CVVMVRK	tr|A0A166H5Z9|A0A166H5Z9_DAUCS Hydrolase_4 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_002423 PE=4 SV=1	0.7818	1.378	0	0	0	0	3869.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3869.8	0	0	0	0
A0A166HTJ1	A0A166HTJ1_DAUCS	Uncharacterized protein	DCAR_003034	Daucus carota subsp. sativus (Carrot)	SRP-dependent cotranslational protein targeting to membrane [GO:0006614]	"signal recognition particle, endoplasmic reticulum targeting [GO:0005786]"	"signal recognition particle, endoplasmic reticulum targeting [GO:0005786]; 7S RNA binding [GO:0008312]; endoplasmic reticulum signal peptide binding [GO:0030942]; SRP-dependent cotranslational protein targeting to membrane [GO:0006614]"	7S RNA binding [GO:0008312]; endoplasmic reticulum signal peptide binding [GO:0030942]	QGGGSKK	tr|A0A166HTJ1|A0A166HTJ1_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_003034 PE=3 SV=1;tr|A0A251VMM4|A0A251VMM4_HELAN Putative DNA-binding bromodomain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr01g000959	0.93278	1.378	50240	27118	14820	23971	0	0	0	32193	43539	50240	0	0	0	0	0	0	0	0	0	0	0	0	27118	0	0	0	0	0	0	0	14820	0	23971	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166HVG3	A0A166HVG3_DAUCS	Peroxidase (EC 1.11.1.7)	DCAR_003097	Daucus carota subsp. sativus (Carrot)	response to oxidative stress [GO:0006979]	cytoplasm [GO:0005737]; microtubule [GO:0005874]	cytoplasm [GO:0005737]; microtubule [GO:0005874]; heme binding [GO:0020037]; metal ion binding [GO:0046872]; microtubule binding [GO:0008017]; peroxidase activity [GO:0004601]; response to oxidative stress [GO:0006979]	heme binding [GO:0020037]; metal ion binding [GO:0046872]; microtubule binding [GO:0008017]; peroxidase activity [GO:0004601]	HDNIQTK	tr|A0A166HVG3|A0A166HVG3_DAUCS Peroxidase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_003097 PE=3 SV=1	0.78247	1.378	0	14442	11839	12813	15812	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13932	14442	0	0	0	0	9938.2	0	0	11839	0	0	0	0	0	12064	0	0	12813	11403	0	0	15812	15078	0	10469	0	7838.7	0	0	0
A0A166I0B0	A0A166I0B0_DAUCS	Uncharacterized protein	DCAR_003268	Daucus carota subsp. sativus (Carrot)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]	DNA binding [GO:0003677]	NGDGCSN	tr|A0A166I0B0|A0A166I0B0_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_003268 PE=4 SV=1	0.94499	1.378	0	7224.9	10592	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7224.9	0	0	0	0	0	4144.9	0	0	0	0	0	10592	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166I0B1	A0A166I0B1_DAUCS	Aldedh domain-containing protein	DCAR_003270	Daucus carota subsp. sativus (Carrot)			"oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor [GO:0016620]"	"oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor [GO:0016620]"	MAAESNGK	tr|A0A166I0B1|A0A166I0B1_DAUCS Aldedh domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_003270 PE=3 SV=1	0.86047	2.2387	11990	0	0	0	0	0	0	0	0	6444.6	0	11990	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166I2R8	A0A166I2R8_DAUCS	Uncharacterized protein	DCAR_003338	Daucus carota subsp. sativus (Carrot)			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	RPPPKVK	tr|A0A166I2R8|A0A166I2R8_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_003338 PE=4 SV=1;tr|A0A5N6M198|A0A5N6M198_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_35371 PE=4 SV=1;tr|A0A251TC65|A0A251TC65	0.7037	2.756	0	22881	0	20889	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22881	0	0	0	0	0	0	0	0	0	0	0	0	0	20889	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166I6G4	A0A166I6G4_DAUCS	ZF-HD dimerization-type domain-containing protein	DCAR_003455	Daucus carota subsp. sativus (Carrot)		nucleus [GO:0005634]	nucleus [GO:0005634]		CVAEDDR	tr|A0A166I6G4|A0A166I6G4_DAUCS ZF-HD dimerization-type domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_003455 PE=4 SV=1	0.78301	1.378	0	0	0	47946	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	47946	0	0	0	0	0	0	0	0	0
A0A166I8T3	A0A166I8T3_DAUCS	Uncharacterized protein	DCAR_003528	Daucus carota subsp. sativus (Carrot)	phosphate ion transport [GO:0006817]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; dipeptide transmembrane transporter activity [GO:0071916]; tripeptide transmembrane transporter activity [GO:0042937]; phosphate ion transport [GO:0006817]	dipeptide transmembrane transporter activity [GO:0071916]; tripeptide transmembrane transporter activity [GO:0042937]	VSSENGR	tr|A0A166I8T3|A0A166I8T3_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_003528 PE=3 SV=1	0.94559	1.378	0	0	16305	103480	40326	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16305	0	0	0	0	0	0	0	103480	0	0	0	0	54618	0	0	0	0	0	0	16397	0	0	40326	0	26182
A0A166IA82	A0A166IA82_DAUCS	Cyclin N-terminal domain-containing protein	DCAR_003570	Daucus carota subsp. sativus (Carrot)	cell cycle [GO:0007049]; cell division [GO:0051301]		cell cycle [GO:0007049]; cell division [GO:0051301]		SFSSTEM	tr|A0A166IA82|A0A166IA82_DAUCS Cyclin N-terminal domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_003570 PE=3 SV=1	0.78356	1.378	0	0	0	169800	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	169800	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166IAR2	A0A166IAR2_DAUCS	Protein kinase domain-containing protein	DCAR_003590	Daucus carota subsp. sativus (Carrot)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	CCLPDGK	tr|A0A166IAR2|A0A166IAR2_DAUCS Protein kinase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_003590 PE=4 SV=1	0.93673	1.378	0	14001	32975	0	16433	0	0	0	0	0	0	0	0	0	0	0	14001	0	0	0	0	0	0	0	0	0	0	32975	0	0	0	0	0	0	0	0	0	0	0	0	0	16433	13736	0	0	0	0	0	0	0
A0A166ICE3	A0A166ICE3_DAUCS	Uncharacterized protein	DCAR_003640	Daucus carota subsp. sativus (Carrot)			syntaxin binding [GO:0019905]	syntaxin binding [GO:0019905]	KEFENVK	tr|A0A166ICE3|A0A166ICE3_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_003640 PE=3 SV=1	0.77931	1.378	7964.1	6682.4	0	5809.2	0	7964.1	0	0	0	0	0	0	7477	0	0	0	6682.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5809.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166ICU5	A0A166ICU5_DAUCS	Uncharacterized protein	DCAR_003655	Daucus carota subsp. sativus (Carrot)	gene silencing by RNA-directed DNA methylation [GO:0080188]		ATP binding [GO:0005524]; nucleosome-dependent ATPase activity [GO:0070615]; gene silencing by RNA-directed DNA methylation [GO:0080188]	ATP binding [GO:0005524]; nucleosome-dependent ATPase activity [GO:0070615]	PLIILPK	tr|A0A166ICU5|A0A166ICU5_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_003655 PE=4 SV=1	0.94265	1.378	69484	61670	48526	78562	76689	53375	48865	50998	27691	17305	0	29566	69484	12368	29997	0	21512	21238	61670	0	0	2473.2	0	0	0	0	0	0	0	48526	34542	44904	38544	78562	0	42278	33511	0	0	0	15138	1884.8	0	76689	0	58378	0	34544	38377	27045
A0A166IFJ7	A0A166IFJ7_DAUCS	Uncharacterized protein	DCAR_003735	Daucus carota subsp. sativus (Carrot)	base-excision repair [GO:0006284]		DNA-3-methyladenine glycosylase activity [GO:0008725]; base-excision repair [GO:0006284]	DNA-3-methyladenine glycosylase activity [GO:0008725]	ARIPVKK	tr|A0A166IFJ7|A0A166IFJ7_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_003735 PE=4 SV=1	0.9411	1.378	0	0	0	0	67254	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	67254	0	0	0	0	0	0
A0A166IIW8	A0A166IIW8_DAUCS	Uncharacterized protein	DCAR_003837	Daucus carota subsp. sativus (Carrot)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]	DNA binding [GO:0003677]	GGDVHSK	tr|A0A166IIW8|A0A166IIW8_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_003837 PE=4 SV=1	0.77876	1.378	0	0	0	4777.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4777.3	0	0	0	0	0	0	0	0	0
A0A166IT83	A0A166IT83_DAUCS	Uncharacterized protein	DCAR_004116	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		TPGLHSR	tr|A0A166IT83|A0A166IT83_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_004116 PE=4 SV=1	0.93449	1.378	0	0	18908	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18908	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166IWB4	A0A166IWB4_DAUCS	Uncharacterized protein	DCAR_004217	Daucus carota subsp. sativus (Carrot)			ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; protein kinase activity [GO:0004672]	DSFCGGM	tr|A0A166IWB4|A0A166IWB4_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_004217 PE=4 SV=1	0.77821	1.378	0	0	10279	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10279	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166IZ55	A0A166IZ55_DAUCS	F-box domain-containing protein	DCAR_004304	Daucus carota subsp. sativus (Carrot)					GDHCDAK	tr|A0A166IZ55|A0A166IZ55_DAUCS F-box domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_004304 PE=4 SV=1	0.77692	1.378	0	0	0	0	9318.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9318.8	0	0	0	0	0	0	0	0
A0A166IZW1	A0A166IZW1_DAUCS	Uncharacterized protein	DCAR_004325	Daucus carota subsp. sativus (Carrot)					CLQIDGR	tr|A0A166IZW1|A0A166IZW1_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_004325 PE=4 SV=1	0.83784	2.0394	0	0	16029	14047	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16029	0	0	0	0	0	0	0	0	0	0	14047	0	0	0	0	0	0	0	0	0
A0A166J8R2	A0A166J8R2_DAUCS	Uncharacterized protein	DCAR_004566	Daucus carota subsp. sativus (Carrot)					SAPRYEM	tr|A0A166J8R2|A0A166J8R2_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_004566 PE=4 SV=1	0.77489	1.378	0	0	11507	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11507	0	0	0	0	0	9942.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166JA53	A0A166JA53_DAUCS	"Mannan endo-1,4-beta-mannosidase (EC 3.2.1.78)"	DCAR_004607	Daucus carota subsp. sativus (Carrot)	organic substance metabolic process [GO:0071704]	extracellular region [GO:0005576]	"extracellular region [GO:0005576]; mannan endo-1,4-beta-mannosidase activity [GO:0016985]; organic substance metabolic process [GO:0071704]"	"mannan endo-1,4-beta-mannosidase activity [GO:0016985]"	LLLQPNK	"tr|A0A166JA53|A0A166JA53_DAUCS Mannan endo-1,4-beta-mannosidase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_004607 PE=3 SV=1"	0.77544	1.378	7093.2	10421	0	8191.9	0	0	0	0	5787.1	7093.2	0	0	0	0	0	0	0	10421	0	0	0	7143.3	6625.7	0	0	0	0	0	0	0	0	0	5864.3	4675.1	0	8191.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166JA59	A0A166JA59_DAUCS	LEA_2 domain-containing protein	DCAR_004608	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		PEEFDAM	tr|A0A166JA59|A0A166JA59_DAUCS LEA_2 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_004608 PE=4 SV=1	0.776	1.378	0	0	12361	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12361	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A166JAJ5	A0A166JAJ5_DAUCS	ARID domain-containing protein	DCAR_004621	Daucus carota subsp. sativus (Carrot)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]	DNA binding [GO:0003677]	KPILLAR	tr|A0A166JAJ5|A0A166JAJ5_DAUCS ARID domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_004621 PE=4 SV=1	0.875	1.4547	5400700	4141100	3287100	3301100	2670400	1957400	4559000	3975800	5400700	3076400	534200	3275700	2205700	2619400	1099300	1205600	1317200	1133800	3953300	4141100	3159300	2528600	3442700	578290	878760	957630	2393000	1630200	1373100	3287100	326650	2046300	1166300	561310	1499600	3301100	2203800	1797000	0	0	146930	2670400	1887100	79693	115960	114740	760660	472810	405560	174680
A0A166JBH4	A0A166JBH4_DAUCS	Uncharacterized protein	DCAR_004648	Daucus carota subsp. sativus (Carrot)			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	CAHGGCK	tr|A0A166JBH4|A0A166JBH4_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_004648 PE=4 SV=1	0.94333	1.378	7632	90795	117430	93979	14720	0	7632	0	0	0	0	0	0	0	0	90795	0	0	0	0	40611	0	0	0	0	0	0	0	0	0	0	117430	0	0	0	0	93979	0	0	0	0	0	0	0	14720	0	0	12194	0	0
A0A169W840	A0A169W840_DAUCS	Uncharacterized protein	DCAR_010556	Daucus carota subsp. sativus (Carrot)	cellular oxidant detoxification [GO:0098869]		cellular oxidant detoxification [GO:0098869]		NLMMAEM	tr|A0A169W840|A0A169W840_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_010556 PE=4 SV=1	0.77612	1.378	0	13016	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9721.2	13016	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A169WC89	A0A169WC89_DAUCS	Uncharacterized protein	DCAR_010668	Daucus carota subsp. sativus (Carrot)	methylation [GO:0032259]; rRNA processing [GO:0006364]		methyltransferase activity [GO:0008168]; RNA binding [GO:0003723]; methylation [GO:0032259]; rRNA processing [GO:0006364]	methyltransferase activity [GO:0008168]; RNA binding [GO:0003723]	GFGGAGR	tr|A0A169WC89|A0A169WC89_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_010668 PE=3 SV=1	0.77667	1.378	0	17714	13523	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17714	0	0	0	0	13523	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A169WMB0	A0A169WMB0_DAUCS	Uncharacterized protein	DCAR_005686	Daucus carota subsp. sativus (Carrot)					SSTSESM	tr|A0A169WMB0|A0A169WMB0_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_005686 PE=4 SV=1	0.94702	1.378	149610	141180	78695	161420	128350	57116	0	39586	35063	0	70460	48117	149610	0	8831.6	59682	39295	0	0	141180	39808	0	0	28404	68974	78695	0	0	25640	23058	37371	14019	21931	17368	0	27225	34993	0	161420	0	0	0	0	81122	6745.1	0	22629	128350	92848	0
A0A169WS30	A0A169WS30_DAUCS	Cyclic nucleotide-binding domain-containing protein	DCAR_002478	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ion channel activity [GO:0005216]	ion channel activity [GO:0005216]	VFVYDSK	tr|A0A169WS30|A0A169WS30_DAUCS Cyclic nucleotide-binding domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_002478 PE=4 SV=1	0.92833	1.378	0	0	0	8298.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8298.7	0	0	0	6184.9	0	0	0	0	0	0	0	0	0
A0A169WUF6	A0A169WUF6_DAUCS	Pectinesterase (EC 3.1.1.11)	DCAR_002550	Daucus carota subsp. sativus (Carrot)	cell wall modification [GO:0042545]; pectin catabolic process [GO:0045490]		aspartyl esterase activity [GO:0045330]; enzyme inhibitor activity [GO:0004857]; pectinesterase activity [GO:0030599]; cell wall modification [GO:0042545]; pectin catabolic process [GO:0045490]	aspartyl esterase activity [GO:0045330]; enzyme inhibitor activity [GO:0004857]; pectinesterase activity [GO:0030599]	MPGPSQK	tr|A0A169WUF6|A0A169WUF6_DAUCS Pectinesterase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_002550 PE=3 SV=1	0.93927	1.378	0	10669	0	7418	1178.2	0	0	0	0	0	0	0	0	0	0	0	10669	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7418	0	0	0	0	0	0	0	1178.2	0	0
A0A169WV09	A0A169WV09_DAUCS	Uncharacterized protein	DCAR_002563	Daucus carota subsp. sativus (Carrot)					LILKHGK	tr|A0A169WV09|A0A169WV09_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_002563 PE=4 SV=1	0.7768	1.378	0	0	0	28518	25304	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28518	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25304
A0A175Y8Y9	A0A175Y8Y9_DAUCS	Uncharacterized protein	DCAR_000439	Daucus carota subsp. sativus (Carrot)					LLFLLLR	tr|A0A175Y8Y9|A0A175Y8Y9_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_000439 PE=4 SV=1	0.91489	1.5858	121730	276220	308060	226740	320500	0	0	0	0	0	121730	0	0	0	0	0	110260	0	0	160550	276220	0	97007	66739	0	53982	268130	308060	171760	0	0	0	0	0	226740	23402	83866	85414	172820	16501	171310	96789	184930	0	320500	13463	112320	0	0	0
A0A175Y9U7	A0A175Y9U7_DAUCS	Rep_fac-A_C domain-containing protein	DCAR_031757	Daucus carota subsp. sativus (Carrot)					RPLKIIK	tr|A0A175Y9U7|A0A175Y9U7_DAUCS Rep_fac-A_C domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_031757 PE=4 SV=1	0.92801	1.378	0	7194.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7194.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175Y9V6	A0A175Y9V6_DAUCS	Uncharacterized protein	DCAR_031727	Daucus carota subsp. sativus (Carrot)					NLGSQSK	tr|A0A175Y9V6|A0A175Y9V6_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_031727 PE=4 SV=1	0.77766	1.378	17688	25679	42217	17758	13487	0	17688	0	0	0	0	0	0	0	25679	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42217	0	0	17758	0	0	0	0	0	0	13912	0	0	10865	0	0	0	12372	13487	0
A0A175YAD5	A0A175YAD5_DAUCS	Uncharacterized protein	DCAR_032163	Daucus carota subsp. sativus (Carrot)					KPQEGPR	tr|A0A175YAD5|A0A175YAD5_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_032163 PE=4 SV=1;tr|A0A175YDJ5|A0A175YDJ5_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_029312 PE=4 SV=1;tr|A0A175YAD0|	0.77704	1.378	0	13341	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13341	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YBN4	A0A175YBN4_DAUCS	Protein kinase domain-containing protein	DCAR_031401	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	NQGQPRR	tr|A0A175YBN4|A0A175YBN4_DAUCS Protein kinase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_031401 PE=4 SV=1	0.94352	1.378	45524	55952	58738	40205	3036900	0	45524	0	0	0	0	0	0	0	39378	37742	39719	0	0	55952	33338	0	0	0	0	58738	0	0	54187	0	0	0	0	0	0	0	40205	21575	38848	33500	36702	51347	52905	0	39502	0	27402	0	3036900	2330000
A0A175YBS8	A0A175YBS8_DAUCS	Uncharacterized protein	DCAR_031481	Daucus carota subsp. sativus (Carrot)					LVRVPNK	tr|A0A175YBS8|A0A175YBS8_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_031481 PE=4 SV=1	0.77631	1.378	0	13653	0	15395	16130	0	0	0	0	0	0	0	0	0	0	13653	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15395	0	16130	0	0	0	0	0	0	0	0
A0A175YBT5	A0A175YBT5_DAUCS	H15 domain-containing protein	DCAR_031739	Daucus carota subsp. sativus (Carrot)	nucleosome assembly [GO:0006334]	nucleosome [GO:0000786]; nucleus [GO:0005634]	nucleosome [GO:0000786]; nucleus [GO:0005634]; DNA binding [GO:0003677]; nucleosome assembly [GO:0006334]	DNA binding [GO:0003677]	RPGRPPK	tr|A0A175YBT5|A0A175YBT5_DAUCS H15 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_031739 PE=4 SV=1;tr|A0A165X7R8|A0A165X7R8_DAUCS H15 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_014730 PE=4 SV=1;tr	0.87028	1.378	0	6871.7	8469	9366.7	6914.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6871.7	0	0	0	0	0	0	0	8469	0	0	0	0	0	0	0	0	0	5458.4	9366.7	0	0	6914.5	0	0	0	0	0	0	0
A0A175YC65	A0A175YC65_DAUCS	Rep_fac-A_C domain-containing protein	DCAR_031560	Daucus carota subsp. sativus (Carrot)					EACRLLK	tr|A0A175YC65|A0A175YC65_DAUCS Rep_fac-A_C domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_031560 PE=4 SV=1	0.88946	1.378	7039.3	0	0	0	0	1877.3	0	0	1854.1	0	0	0	2624	7039.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YC69	A0A175YC69_DAUCS	Uncharacterized protein	DCAR_031339	Daucus carota subsp. sativus (Carrot)					NNVTPPK	tr|A0A175YC69|A0A175YC69_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_031339 PE=4 SV=1;tr|A0A175YCE4|A0A175YCE4_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_031341 PE=4 SV=1	0.81324	1.378	0	0	19394	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19394	0	0	0	0	0	17908	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YD60	A0A175YD60_DAUCS	Uncharacterized protein	DCAR_031256	Daucus carota subsp. sativus (Carrot)					RAIRASK	tr|A0A175YD60|A0A175YD60_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_031256 PE=4 SV=1	0.88136	1.378	454180	34103	493800	31281	38747	0	0	0	35058	11660	452730	0	0	454180	0	0	0	0	34103	0	0	0	0	0	0	0	0	493800	0	0	0	0	0	31281	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38747
A0A175YDG2	A0A175YDG2_DAUCS	Uncharacterized protein	DCAR_029106	Daucus carota subsp. sativus (Carrot)					YNDGSGM	tr|A0A175YDG2|A0A175YDG2_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_029106 PE=4 SV=1	0.776	1.378	0	0	5313.1	2943.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5313.1	0	0	0	0	0	0	0	0	0	2943.9	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YE38	A0A175YE38_DAUCS	Uncharacterized protein	DCAR_029051	Daucus carota subsp. sativus (Carrot)					LKPLNVK	tr|A0A175YE38|A0A175YE38_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_029051 PE=4 SV=1;tr|A0A5N6L912|A0A5N6L912_9ASTR ULP_PROTEASE domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_45470 PE=3 SV=1;tr|A0A5N6	0.77655	1.378	0	0	0	8553.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8553.8	0	0	0	0	0	0	0	0	0	0	0
A0A175YEI7	A0A175YEI7_DAUCS	Hydrophob_seed domain-containing protein	DCAR_029672	Daucus carota subsp. sativus (Carrot)					NFLDAHM	tr|A0A175YEI7|A0A175YEI7_DAUCS Hydrophob_seed domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_029672 PE=4 SV=1	0.77711	1.378	4727.3	5926.7	0	0	0	4727.3	0	0	0	0	0	0	0	0	5926.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YF14	A0A175YF14_DAUCS	Uncharacterized protein	DCAR_029862	Daucus carota subsp. sativus (Carrot)			ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	MMPAALR	tr|A0A175YF14|A0A175YF14_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_029862 PE=4 SV=1	0.8024	1.378	413950	0	0	0	0	0	0	0	0	0	0	0	413950	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YFJ1	A0A175YFJ1_DAUCS	Uncharacterized protein	DCAR_029793	Daucus carota subsp. sativus (Carrot)					DNMYSYK	tr|A0A175YFJ1|A0A175YFJ1_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_029793 PE=4 SV=1	0.81304	1.378	0	260910	128830	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	260910	0	0	0	0	0	0	128830	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YG20	A0A175YG20_DAUCS	Uncharacterized protein	DCAR_029815	Daucus carota subsp. sativus (Carrot)					KTKQTAK	tr|A0A175YG20|A0A175YG20_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_029815 PE=4 SV=1	0.81358	1.378	0	0	10085	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10085	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YGL3	A0A175YGL3_DAUCS	Uncharacterized protein	DCAR_030066	Daucus carota subsp. sativus (Carrot)					ARLLQCR	tr|A0A175YGL3|A0A175YGL3_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_030066 PE=4 SV=1	0.84352	1.378	0	0	649540	699660	756420	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	649540	0	0	699660	0	0	0	0	0	0	0	0	0	0	0	0	0	0	756420	0
A0A175YIH1	A0A175YIH1_DAUCS	DUF1336 domain-containing protein	DCAR_031073	Daucus carota subsp. sativus (Carrot)					PSTCGGM	tr|A0A175YIH1|A0A175YIH1_DAUCS DUF1336 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_031073 PE=4 SV=1;tr|A0A251SED0|A0A251SED0_HELAN Putative CDPK-related protein kinase OS=Helianthus annuus OX=4232 GN=CRK PE=4 SV=1;tr|A0A2U1QB	0.84316	1.378	0	36021	19632	0	0	0	0	0	0	0	0	0	0	0	0	0	36021	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19632	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YIJ5	A0A175YIJ5_DAUCS	Uncharacterized protein	DCAR_030928	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VLNAPRR	tr|A0A175YIJ5|A0A175YIJ5_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_030928 PE=4 SV=1	0.84368	1.378	0	18568	16324	28487	28282	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18568	16234	0	0	0	0	16324	0	0	0	0	0	0	0	0	0	0	0	28487	0	19334	0	0	28282	0	13443	0	0	0	0	0
A0A175YIJ9	A0A175YIJ9_DAUCS	Beta-galactosidase (EC 3.2.1.23)	DCAR_030816	Daucus carota subsp. sativus (Carrot)	carbohydrate metabolic process [GO:0005975]		beta-galactosidase activity [GO:0004565]; carbohydrate binding [GO:0030246]; carbohydrate metabolic process [GO:0005975]	beta-galactosidase activity [GO:0004565]; carbohydrate binding [GO:0030246]	PGCNTTK	tr|A0A175YIJ9|A0A175YIJ9_DAUCS Beta-galactosidase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_030816 PE=3 SV=1	0.84421	1.378	3080	0	0	3991.2	0	0	0	0	0	3080	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3991.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YIP6	A0A175YIP6_DAUCS	Uncharacterized protein	DCAR_031153	Daucus carota subsp. sativus (Carrot)					DDRNHSR	tr|A0A175YIP6|A0A175YIP6_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_031153 PE=4 SV=1	0.92708	1.5349	0	11616	8119	0	0	0	0	0	0	0	0	0	0	0	0	0	11616	0	0	0	0	0	0	0	8119	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YIR7	A0A175YIR7_DAUCS	Uncharacterized protein	DCAR_030998	Daucus carota subsp. sativus (Carrot)	phosphate ion transport [GO:0006817]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; phosphate ion transport [GO:0006817]		GNENFVK	tr|A0A175YIR7|A0A175YIR7_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_030998 PE=3 SV=1	0.84474	1.378	16128	0	0	0	0	0	0	0	0	15702	0	13545	0	16128	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YIT2	A0A175YIT2_DAUCS	Uncharacterized protein	DCAR_031004	Daucus carota subsp. sativus (Carrot)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	YSSSSYR	tr|A0A175YIT2|A0A175YIT2_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_031004 PE=4 SV=1	0.9398	1.378	0	24813	45184	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24813	0	0	0	0	0	0	45184	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YIU9	A0A175YIU9_DAUCS	Uncharacterized protein	DCAR_030650	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; N-acetyltransferase activity [GO:0008080]	N-acetyltransferase activity [GO:0008080]	VPNYVLR	tr|A0A175YIU9|A0A175YIU9_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_030650 PE=4 SV=1	0.84482	1.378	0	2191.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2191.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YIZ5	A0A175YIZ5_DAUCS	Protein kinase domain-containing protein	DCAR_028884	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	GTIGMAK	tr|A0A175YIZ5|A0A175YIZ5_DAUCS Protein kinase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_028884 PE=4 SV=1	0.84534	1.378	7370	0	21961	6257.4	14693	0	7370	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9978.5	0	0	0	0	0	21961	0	0	0	0	0	0	0	0	0	6257.4	0	0	14693	0	0	5928.4	0	0	0
A0A175YJ19	A0A175YJ19_DAUCS	Uncharacterized protein	DCAR_030809	Daucus carota subsp. sativus (Carrot)	phosphate ion transport [GO:0006817]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857]; phosphate ion transport [GO:0006817]	transmembrane transporter activity [GO:0022857]	DVNDGAM	tr|A0A175YJ19|A0A175YJ19_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_030809 PE=3 SV=1	0.84543	1.378	0	0	0	12950	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12950	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YJG9	A0A175YJG9_DAUCS	Uncharacterized protein	DCAR_028714	Daucus carota subsp. sativus (Carrot)	protein transport [GO:0015031]		protein transport [GO:0015031]		PPTNHYK	tr|A0A175YJG9|A0A175YJG9_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_028714 PE=3 SV=1	0.84595	1.378	0	0	0	5764.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5764.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YJH9	A0A175YJH9_DAUCS	TIR domain-containing protein	DCAR_031076	Daucus carota subsp. sativus (Carrot)	signal transduction [GO:0007165]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ADP binding [GO:0043531]; hydrolase activity [GO:0016787]; signal transduction [GO:0007165]	ADP binding [GO:0043531]; hydrolase activity [GO:0016787]	LCHALDK	tr|A0A175YJH9|A0A175YJH9_DAUCS TIR domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_031076 PE=4 SV=1	0.84648	1.378	0	0	16970	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12876	16970	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YK83	A0A175YK83_DAUCS	CAF1C_H4-bd domain-containing protein	DCAR_028589	Daucus carota subsp. sativus (Carrot)					VRDHGAK	tr|A0A175YK83|A0A175YK83_DAUCS CAF1C_H4-bd domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_028589 PE=3 SV=1	0.84753	1.378	32942	21811	0	18615	4887.8	0	0	0	32942	15063	0	0	0	8816.3	0	0	0	21811	12501	0	0	14442	16916	0	0	0	0	0	0	0	0	0	0	18615	0	0	0	0	0	0	0	0	0	0	0	4887.8	0	0	0	0
A0A175YK89	A0A175YK89_DAUCS	Uncharacterized protein	DCAR_031107	Daucus carota subsp. sativus (Carrot)					SEPDAQM	tr|A0A175YK89|A0A175YK89_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_031107 PE=4 SV=1	0.84805	1.378	0	0	120810	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	120810	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YKG9	A0A175YKG9_DAUCS	Uncharacterized protein	DCAR_028838	Daucus carota subsp. sativus (Carrot)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; polysaccharide binding [GO:0030247]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; polysaccharide binding [GO:0030247]; protein serine/threonine kinase activity [GO:0004674]	VDDPLVK	tr|A0A175YKG9|A0A175YKG9_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_028838 PE=4 SV=1	0.84858	1.378	19922	0	0	0	0	0	0	0	0	0	0	0	0	19922	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YKW6	A0A175YKW6_DAUCS	Protein kinase domain-containing protein	DCAR_028797	Daucus carota subsp. sativus (Carrot)		plasma membrane [GO:0005886]	plasma membrane [GO:0005886]; ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	FSRCGGM	tr|A0A175YKW6|A0A175YKW6_DAUCS Protein kinase domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_028797 PE=3 SV=1	0.84866	1.378	13376	0	0	0	0	0	0	13376	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YLF2	A0A175YLF2_DAUCS	Uncharacterized protein	DCAR_028607	Daucus carota subsp. sativus (Carrot)					ARLLECR	tr|A0A175YLF2|A0A175YLF2_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_028607 PE=4 SV=1;tr|A0A166AQL3|A0A166AQL3_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_010394 PE=4 SV=1	0.75947	1.378	10465	48723	29125	466740	14745	0	0	0	0	0	0	0	0	10465	0	0	48723	0	0	0	0	0	0	29125	0	0	0	0	0	0	20025	0	0	16207	0	15571	466740	43181	0	0	0	0	0	7373.7	0	0	0	14745	0	0
A0A175YLK6	A0A175YLK6_DAUCS	Uncharacterized protein	DCAR_028353	Daucus carota subsp. sativus (Carrot)					HDSREKK	tr|A0A175YLK6|A0A175YLK6_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_028353 PE=4 SV=1	0.84971	1.378	0	0	0	9344.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9344.6	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YMT7	A0A175YMT7_DAUCS	UBX domain-containing protein	DCAR_027534	Daucus carota subsp. sativus (Carrot)					VVPLHKK	tr|A0A175YMT7|A0A175YMT7_DAUCS UBX domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_027534 PE=4 SV=1	0.85024	1.378	0	0	0	25183	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25183	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YNX6	A0A175YNX6_DAUCS	PCI domain-containing protein	DCAR_027511	Daucus carota subsp. sativus (Carrot)		cytosol [GO:0005829]; plasma membrane [GO:0005886]; proteasome complex [GO:0000502]	cytosol [GO:0005829]; plasma membrane [GO:0005886]; proteasome complex [GO:0000502]		QGDEGDM	tr|A0A175YNX6|A0A175YNX6_DAUCS PCI domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_027511 PE=4 SV=1	0.84299	1.378	9281.9	0	0	8369.4	0	0	0	0	0	0	0	0	9281.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6760	0	0	0	8369.4	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YPD4	A0A175YPD4_DAUCS	Uncharacterized protein	DCAR_027468	Daucus carota subsp. sativus (Carrot)					PMNSDVR	tr|A0A175YPD4|A0A175YPD4_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_027468 PE=4 SV=1	0.84291	1.378	0	0	16844	22012	7766.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16844	0	0	0	0	0	0	0	0	0	0	0	22012	0	0	0	0	0	7766.1	0	0	0
A0A175YQ05	A0A175YQ05_DAUCS	HPt domain-containing protein	DCAR_027676	Daucus carota subsp. sativus (Carrot)	cytokinin-activated signaling pathway [GO:0009736]; phosphorelay signal transduction system [GO:0000160]	cytosol [GO:0005829]	cytosol [GO:0005829]; cytokinin-activated signaling pathway [GO:0009736]; phosphorelay signal transduction system [GO:0000160]		GKVMVFK	tr|A0A175YQ05|A0A175YQ05_DAUCS HPt domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_027676 PE=4 SV=1	0.84146	1.378	7114.5	0	0	6919.6	0	0	0	0	0	0	0	0	0	7114.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6919.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YQ65	A0A175YQ65_DAUCS	RING-type domain-containing protein	DCAR_027320	Daucus carota subsp. sativus (Carrot)			transferase activity [GO:0016740]	transferase activity [GO:0016740]	DSQQQGM	tr|A0A175YQ65|A0A175YQ65_DAUCS RING-type domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_027320 PE=4 SV=1	0.84199	1.378	0	0	0	0	8925.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8925.9	0	0	0	0
A0A175YQC8	A0A175YQC8_DAUCS	Aminotran_1_2 domain-containing protein	DCAR_026915	Daucus carota subsp. sativus (Carrot)	histidine biosynthetic process [GO:0000105]		histidinol-phosphate transaminase activity [GO:0004400]; pyridoxal phosphate binding [GO:0030170]; histidine biosynthetic process [GO:0000105]	histidinol-phosphate transaminase activity [GO:0004400]; pyridoxal phosphate binding [GO:0030170]	VLGALAR	tr|A0A175YQC8|A0A175YQC8_DAUCS Aminotran_1_2 domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_026915 PE=3 SV=1	0.84252	1.378	0	7997.2	6009.9	0	0	0	0	0	0	0	0	0	0	0	0	7376.5	0	0	0	0	7997.2	0	0	6009.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YQP5	A0A175YQP5_DAUCS	Uncharacterized protein	DCAR_026534	Daucus carota subsp. sativus (Carrot)	carbohydrate metabolic process [GO:0005975]	cell wall [GO:0005618]	cell wall [GO:0005618]; polygalacturonase activity [GO:0004650]; carbohydrate metabolic process [GO:0005975]	polygalacturonase activity [GO:0004650]	SFNSSSM	tr|A0A175YQP5|A0A175YQP5_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_026534 PE=3 SV=1	0.84305	1.378	14722	0	12627	0	11834	14722	11585	12226	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12627	11035	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11834	0
A0A175YQW4	A0A175YQW4_DAUCS	Uncharacterized protein	DCAR_026958	Daucus carota subsp. sativus (Carrot)		vacuole [GO:0005773]	vacuole [GO:0005773]; ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; nucleic acid binding [GO:0003676]; RNA helicase activity [GO:0003724]	ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; nucleic acid binding [GO:0003676]; RNA helicase activity [GO:0003724]	GGDFGGR	tr|A0A175YQW4|A0A175YQW4_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_026958 PE=4 SV=1	0.84358	1.378	0	0	0	9856.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9856.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A175YRB3	A0A175YRB3_DAUCS	Uncharacterized protein	DCAR_026798	Daucus carota subsp. sativus (Carrot)			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	NILDRFR	tr|A0A175YRB3|A0A175YRB3_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_026798 PE=4 SV=1	0.84411	1.378	267200	284550	207260	178260	91846	0	0	0	0	0	0	267200	0	0	196660	0	0	35192	0	0	0	0	284550	0	0	0	0	0	0	0	207260	0	0	0	0	0	0	178260	0	0	145160	0	91846	0	0	0	0	0	0	0
A0A175YS11	A0A175YS11_DAUCS	Dof-type domain-containing protein	DCAR_026660	Daucus carota subsp. sativus (Carrot)	"regulation of transcription, DNA-templated [GO:0006355]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]	DNMDSSM	tr|A0A175YS11|A0A175YS11_DAUCS Dof-type domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_026660 PE=4 SV=1	0.8442	1.378	5277.4	4809.7	0	0	0	0	0	0	0	0	0	0	5277.4	0	4809.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
Q2VEX5	Q2VEX5_DAUCS	Putative lycopene epsilon cyclase	LCYE	Daucus carota subsp. sativus (Carrot)	carotenoid biosynthetic process [GO:0016117]		"oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]; carotenoid biosynthetic process [GO:0016117]"	"oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	IPKLHAK	tr|Q2VEX5|Q2VEX5_DAUCS Putative lycopene epsilon cyclase OS=Daucus carota subsp. sativus OX=79200 GN=LCYE PE=2 SV=1;tr|A0A175YLE0|A0A175YLE0_DAUCS Lycopene epsilon-cyclase OS=Daucus carota subsp. sativus OX=79200 GN=LCYE PE=3 SV=1	0.84919	1.378	0	0	27391	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27391	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A126WW20	A0A126WW20_9ASTE	Putative LOV domain-containing protein		Escallonia sp. BC-2016	protein-chromophore linkage [GO:0018298]; response to stimulus [GO:0050896]		ATP binding [GO:0005524]; photoreceptor activity [GO:0009881]; protein kinase activity [GO:0004672]; protein-chromophore linkage [GO:0018298]; response to stimulus [GO:0050896]	ATP binding [GO:0005524]; photoreceptor activity [GO:0009881]; protein kinase activity [GO:0004672]	ESTYGTM	tr|A0A126WW20|A0A126WW20_9ASTE Putative LOV domain-containing protein OS=Escallonia sp. BC-2016 OX=1799578 PE=2 SV=1;tr|A0A126WX46|A0A126WX46_HELAA Putative LOV domain-containing protein OS=Helenium autumnale OX=138408 PE=2 SV=1;tr|A0A126WXK3|A0A126WXK3_9D	0.79421	1.378	333910	158060	232590	228250	0	0	170490	183260	333910	0	0	0	0	0	158060	0	0	0	0	0	0	0	0	0	0	0	0	0	0	232590	0	0	0	161480	228250	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A0K1ZXK6	A0A0K1ZXK6_9ASTR	DNA-directed RNA polymerase subunit (EC 2.7.7.6) (Fragment)	rpoC1	Goodenia decursiva	"transcription, DNA-templated [GO:0006351]"	chloroplast [GO:0009507]	"chloroplast [GO:0009507]; DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; transcription, DNA-templated [GO:0006351]"	DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]	RKAFLVR	tr|A0A0K1ZXK6|A0A0K1ZXK6_9ASTR DNA-directed RNA polymerase subunit (Fragment) OS=Goodenia decursiva OX=1161802 GN=rpoC1 PE=3 SV=1;tr|A0A0K1ZWH1|A0A0K1ZWH1_9ASTR DNA-directed RNA polymerase subunit (Fragment) OS=Goodenia discophora OX=1690107 GN=rpoC1 PE=3 	0.9341	1.378	0	0	4870.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4870.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A126WXD1	A0A126WXD1_HEDHE	Putative LOV domain-containing protein		Hedera helix (English ivy)	protein-chromophore linkage [GO:0018298]; response to stimulus [GO:0050896]		ATP binding [GO:0005524]; photoreceptor activity [GO:0009881]; protein kinase activity [GO:0004672]; protein-chromophore linkage [GO:0018298]; response to stimulus [GO:0050896]	ATP binding [GO:0005524]; photoreceptor activity [GO:0009881]; protein kinase activity [GO:0004672]	ESSYGTM	tr|A0A126WXD1|A0A126WXD1_HEDHE Putative LOV domain-containing protein OS=Hedera helix OX=4052 PE=2 SV=1;tr|A0A126X0K9|A0A126X0K9_9APIA Putative LOV domain-containing protein OS=Hydrocotyle umbellata OX=1475409 PE=2 SV=1	0.79476	1.378	0	0	37537	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37537	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A0N7F298	A0A0N7F298_HELAN	Glutathione transferase (EC 2.5.1.18)	GSTz1	Helianthus annuus (Common sunflower)	aromatic amino acid family metabolic process [GO:0009072]; glutathione metabolic process [GO:0006749]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; glutathione transferase activity [GO:0004364]; aromatic amino acid family metabolic process [GO:0009072]; glutathione metabolic process [GO:0006749]	glutathione transferase activity [GO:0004364]	GFDYEYK	tr|A0A0N7F298|A0A0N7F298_HELAN Glutathione transferase OS=Helianthus annuus OX=4232 GN=GSTz1 PE=2 SV=1;tr|A0A251T6C7|A0A251T6C7_HELAN Glutathione transferase OS=Helianthus annuus OX=4232 GN=GSTZ1 PE=3 SV=1	0.92839	1.378	0	63286	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	63286	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A0U1ZFB3	A0A0U1ZFB3_HELAN	Holo-ACP synthase (EC 2.7.8.7) (Putative 4'-phosphopantetheinyl transferase superfamily)	HAS HannXRQ_Chr08g0212801	Helianthus annuus (Common sunflower)	lysine biosynthetic process via aminoadipic acid [GO:0019878]	cytosol [GO:0005829]	cytosol [GO:0005829]; holo-[acyl-carrier-protein] synthase activity [GO:0008897]; magnesium ion binding [GO:0000287]; lysine biosynthetic process via aminoadipic acid [GO:0019878]	holo-[acyl-carrier-protein] synthase activity [GO:0008897]; magnesium ion binding [GO:0000287]	MQNFCHK	tr|A0A0U1ZFB3|A0A0U1ZFB3_HELAN Holo-ACP synthase OS=Helianthus annuus OX=4232 GN=HAS PE=2 SV=1	0.80904	1.378	0	0	119930	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	119930	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A159B8H9	A0A159B8H9_HELAN	Seed storage albumin 13	SESA13	Helianthus annuus (Common sunflower)					CCQQLGK	tr|A0A159B8H9|A0A159B8H9_HELAN Seed storage albumin 13 OS=Helianthus annuus OX=4232 GN=SESA13 PE=3 SV=1;tr|A0A6S7NYT0|A0A6S7NYT0_LACSI AAI domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS34162 PE=3 SV=1;tr|A0A2J6KQ46|A0A2J6KQ46_LACSA AAI	0.88818	1.378	0	0	21262	0	12352	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21262	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12352	0	0	0	0	0
A0A1Y3BXF0	A0A1Y3BXF0_HELAN	Uncharacterized protein	HannXRQ_Chr00c0378g0574291 HannXRQ_Chr16g0531821	Helianthus annuus (Common sunflower)					HAPQESK	tr|A0A1Y3BXF0|A0A1Y3BXF0_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr00c0378g0574291 PE=4 SV=1	0.84205	1.378	8714.8	0	0	0	0	0	0	0	0	0	8714.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251RL74	A0A251RL74_HELAN	Putative xanthine/uracil/vitamin C permease	HannXRQ_Chr17g0535471	Helianthus annuus (Common sunflower)		integral component of membrane [GO:0016021]; plasmodesma [GO:0009506]	integral component of membrane [GO:0016021]; plasmodesma [GO:0009506]; transmembrane transporter activity [GO:0022857]	transmembrane transporter activity [GO:0022857]	SGGGGAM	tr|A0A251RL74|A0A251RL74_HELAN Putative xanthine/uracil/vitamin C permease OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0535471 PE=4 SV=1	0.84169	1.378	28836	20569	4521.5	25218	0	0	28836	15200	0	0	0	12853	0	0	15024	0	0	0	0	0	20569	0	0	0	4521.5	0	0	0	0	0	0	0	0	0	0	7138.1	0	0	0	25218	0	0	0	0	0	0	0	0	0	0
A0A251RLR1	A0A251RLR1_HELAN	Phosphatidylinositol 3-kinase (EC 2.7.1.137)	HannXRQ_Chr17g0539451	Helianthus annuus (Common sunflower)	autophagosome assembly [GO:0000045]; autophagy of peroxisome [GO:0030242]; endocytosis [GO:0006897]; phosphatidylinositol-3-phosphate biosynthetic process [GO:0036092]; phosphatidylinositol-mediated signaling [GO:0048015]; phosphatidylinositol phosphate biosynthetic process [GO:0046854]	"cytoplasm [GO:0005737]; endosome [GO:0005768]; membrane [GO:0016020]; peroxisome [GO:0005777]; phagophore assembly site [GO:0000407]; phosphatidylinositol 3-kinase complex, class III, type I [GO:0034271]; phosphatidylinositol 3-kinase complex, class III, type II [GO:0034272]"	"cytoplasm [GO:0005737]; endosome [GO:0005768]; membrane [GO:0016020]; peroxisome [GO:0005777]; phagophore assembly site [GO:0000407]; phosphatidylinositol 3-kinase complex, class III, type I [GO:0034271]; phosphatidylinositol 3-kinase complex, class III, type II [GO:0034272]; 1-phosphatidylinositol-3-kinase activity [GO:0016303]; ATP binding [GO:0005524]; phosphatidylinositol kinase activity [GO:0052742]; autophagosome assembly [GO:0000045]; autophagy of peroxisome [GO:0030242]; endocytosis [GO:0006897]; phosphatidylinositol phosphate biosynthetic process [GO:0046854]; phosphatidylinositol-3-phosphate biosynthetic process [GO:0036092]; phosphatidylinositol-mediated signaling [GO:0048015]"	1-phosphatidylinositol-3-kinase activity [GO:0016303]; ATP binding [GO:0005524]; phosphatidylinositol kinase activity [GO:0052742]	QVLSQWR	tr|A0A251RLR1|A0A251RLR1_HELAN Phosphatidylinositol 3-kinase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0539451 PE=3 SV=1	0.84222	1.378	0	23448	11800	19780	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23448	22639	0	0	0	0	11800	0	0	0	0	0	0	0	0	19780	0	12432	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251RLS3	A0A251RLS3_HELAN	Uncharacterized protein	HannXRQ_Chr17g0537991	Helianthus annuus (Common sunflower)					GGLLYYR	tr|A0A251RLS3|A0A251RLS3_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0537991 PE=4 SV=1	0.84274	1.378	19389	17795	14339	26976	24794	19389	16074	13113	0	0	0	0	0	12720	14520	17149	0	17795	0	0	0	0	0	14339	10046	0	0	0	0	0	0	13750	0	0	0	26976	0	0	15343	18458	0	0	0	0	0	0	24794	0	9771	0
A0A251RNQ4	A0A251RNQ4_HELAN	"Putative beta-1,4-N-acetylglucosaminyltransferase family protein"	HannXRQ_Chr17g0540001	Helianthus annuus (Common sunflower)	N-acetylglucosamine metabolic process [GO:0006044]; protein N-linked glycosylation [GO:0006487]	integral component of membrane [GO:0016021]	"integral component of membrane [GO:0016021]; beta-1,4-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity [GO:0003830]; glycosyltransferase activity [GO:0016757]; N-acetylglucosamine metabolic process [GO:0006044]; protein N-linked glycosylation [GO:0006487]"	"beta-1,4-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity [GO:0003830]; glycosyltransferase activity [GO:0016757]"	RVPFRER	"tr|A0A251RNQ4|A0A251RNQ4_HELAN Putative beta-1,4-N-acetylglucosaminyltransferase family protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0540001 PE=4 SV=1;tr|A0A251T307|A0A251T307_HELAN Putative glycosyl transferase, family 17 OS=Helianthus annuus OX="	0.85076	1.378	16939	11995	9806	11553	10149	0	0	11739	12558	16939	0	0	0	0	0	0	0	11995	0	0	0	0	0	0	9806	0	0	0	0	0	0	0	0	11553	0	0	0	0	0	0	0	0	0	10149	0	0	0	0	0	0
A0A251RP26	A0A251RP26_HELAN	Putative paired amphipathic helix	HannXRQ_Chr17g0547261	Helianthus annuus (Common sunflower)	histone deacetylation [GO:0016575]; negative regulation of transcription by RNA polymerase II [GO:0000122]	chromatin [GO:0000785]; histone deacetylase complex [GO:0000118]	chromatin [GO:0000785]; histone deacetylase complex [GO:0000118]; transcription corepressor activity [GO:0003714]; histone deacetylation [GO:0016575]; negative regulation of transcription by RNA polymerase II [GO:0000122]	transcription corepressor activity [GO:0003714]	NLLLLPLK	tr|A0A251RP26|A0A251RP26_HELAN Putative paired amphipathic helix OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0547261 PE=4 SV=1;tr|A0A251RQM9|A0A251RQM9_HELAN Putative paired amphipathic helix OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0547241 PE=4 SV=	0.88119	1.4882	5631000	6335400	2084100	6579100	5101000	46251	4089500	1459300	5631000	2398000	35008	1779400	49541	0	3906400	4986800	6335400	1951200	27062	4002900	76921	0	0	473040	2084100	959400	59183	72517	1507300	42341	1232200	53993	50277	43632	797720	6579100	3582500	1927800	33811	1999800	3824600	5101000	3332100	767780	55891	77230	206210	169270	74366	171550
A0A251RPE9	A0A251RPE9_HELAN	"Putative cytochrome P450, family 706, subfamily A, polypeptide 6"	CYP706A6 HannXRQ_Chr17g0549001	Helianthus annuus (Common sunflower)		integral component of membrane [GO:0016021]	"integral component of membrane [GO:0016021]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	VGALPVR	"tr|A0A251RPE9|A0A251RPE9_HELAN Putative cytochrome P450, family 706, subfamily A, polypeptide 6 OS=Helianthus annuus OX=4232 GN=CYP706A6 PE=3 SV=1"	0.85084	1.378	29315	42856	16819	30402	20134	15060	9169.7	0	7833.2	0	0	13373	29315	10974	6466.9	10922	9523.6	9118.8	18487	0	11853	42856	0	7781.2	7322.3	12179	0	0	13238	16819	15569	0	30402	11054	0	0	14640	14013	0	9815.8	0	0	0	14394	4564.5	0	6844	6471.7	20134	0
A0A251RQ93	A0A251RQ93_HELAN	Uncharacterized protein	HannXRQ_Chr17g0550701	Helianthus annuus (Common sunflower)	hydrotropism [GO:0010274]		hydrotropism [GO:0010274]		TGMGSGR	tr|A0A251RQ93|A0A251RQ93_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0550701 PE=4 SV=1	0.86101	1.378	0	0	0	0	10549	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10549	0	0	0
A0A251RQN5	A0A251RQN5_HELAN	Ubiquitin receptor RAD23 (DNA repair protein RAD23)	HannXRQ_Chr17g0552171	Helianthus annuus (Common sunflower)	nucleotide-excision repair [GO:0006289]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]	cytosol [GO:0005829]; nucleoplasm [GO:0005654]	cytosol [GO:0005829]; nucleoplasm [GO:0005654]; damaged DNA binding [GO:0003684]; polyubiquitin modification-dependent protein binding [GO:0031593]; proteasome binding [GO:0070628]; ubiquitin binding [GO:0043130]; nucleotide-excision repair [GO:0006289]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]	damaged DNA binding [GO:0003684]; polyubiquitin modification-dependent protein binding [GO:0031593]; proteasome binding [GO:0070628]; ubiquitin binding [GO:0043130]	QNPHLVR	tr|A0A251RQN5|A0A251RQN5_HELAN Ubiquitin receptor RAD23 OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0552171 PE=3 SV=1;tr|A0A699J0Y7|A0A699J0Y7_TANCI Ubiquitin receptor RAD23 (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_570840 PE=3 SV=1;tr|A0A	0.93416	1.378	0	0	16972	12561	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16972	0	0	0	0	0	0	0	0	0	0	0	12561	0	0	0	0	0	0	0	0	0
A0A251RSD3	A0A251RSD3_HELAN	Putative mitogen activated protein kinase kinase kinase-related protein	HannXRQ_Chr17g0560541	Helianthus annuus (Common sunflower)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; protein serine/threonine kinase activity [GO:0004674]	SHSPTKK	tr|A0A251RSD3|A0A251RSD3_HELAN Putative mitogen activated protein kinase kinase kinase-related protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0560541 PE=4 SV=1	0.85587	1.378	0	0	0	46370	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	46370	0	0	0	0	0	0	0	0	0	0
A0A251RSQ6	A0A251RSQ6_HELAN	"Putative small GTPase superfamily, P-loop containing nucleoside triphosphate hydrolase"	HannXRQ_Chr17g0560561	Helianthus annuus (Common sunflower)	intracellular protein transport [GO:0006886]	endomembrane system [GO:0012505]	endomembrane system [GO:0012505]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; intracellular protein transport [GO:0006886]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	GFGCCSN	"tr|A0A251RSQ6|A0A251RSQ6_HELAN Putative small GTPase superfamily, P-loop containing nucleoside triphosphate hydrolase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0560561 PE=4 SV=1;tr|A0A251RWP2|A0A251RWP2_HELAN Putative ras-related protein Rab11E OS=Heli"	0.88913	1.378	0	29423	22800	0	22107	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29423	0	0	0	0	22800	12525	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22107
A0A251RT58	A0A251RT58_HELAN	"Putative carotenoid 9,10(9',10')-cleavage dioxygenase 1"	CCD1 HannXRQ_Chr17g0562991	Helianthus annuus (Common sunflower)	carotene catabolic process [GO:0016121]	chloroplast stroma [GO:0009570]	chloroplast stroma [GO:0009570]; carotenoid dioxygenase activity [GO:0010436]; metal ion binding [GO:0046872]; carotene catabolic process [GO:0016121]	carotenoid dioxygenase activity [GO:0010436]; metal ion binding [GO:0046872]	TDFIYIK	"tr|A0A251RT58|A0A251RT58_HELAN Putative carotenoid 9,10(9,10)-cleavage dioxygenase 1 OS=Helianthus annuus OX=4232 GN=CCD1 PE=3 SV=1"	0.8564	1.378	7899	9353.5	7546.1	11086	6855.2	0	0	0	7899	0	0	0	0	7214.4	0	0	0	9344.6	0	0	0	9353.5	8626.3	0	6303	0	0	0	0	0	7546.1	0	7539.9	7502.4	0	11086	0	0	0	0	0	0	0	0	0	0	0	6855.2	0	0
A0A251RT60	A0A251RT60_HELAN	"Putative TRAF-like, SKP1/BTB/POZ domain, BTB/Kelch-associated"	HannXRQ_Chr17g0563151	Helianthus annuus (Common sunflower)	response to red light [GO:0010114]	nucleus [GO:0005634]	nucleus [GO:0005634]; response to red light [GO:0010114]		NLLHSCR	"tr|A0A251RT60|A0A251RT60_HELAN Putative TRAF-like, SKP1/BTB/POZ domain, BTB/Kelch-associated OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0563151 PE=4 SV=1"	0.85692	1.378	26150	14806	59658	13838	8870.9	0	0	0	0	0	26150	0	0	0	0	0	0	0	0	9030.3	14806	0	0	0	0	0	19406	59658	0	0	0	0	0	0	13838	0	0	6949.5	0	0	0	0	8870.9	0	5885.5	0	0	0	0	0
A0A251RTN7	A0A251RTN7_HELAN	Beta-amylase (EC 3.2.1.2)	AMYB HannXRQ_Chr17g0563781	Helianthus annuus (Common sunflower)	polysaccharide catabolic process [GO:0000272]		amylopectin maltohydrolase activity [GO:0102229]; beta-amylase activity [GO:0016161]; polysaccharide catabolic process [GO:0000272]	amylopectin maltohydrolase activity [GO:0102229]; beta-amylase activity [GO:0016161]	RPIRIHR	tr|A0A251RTN7|A0A251RTN7_HELAN Beta-amylase OS=Helianthus annuus OX=4232 GN=AMYB PE=3 SV=1	0.86641	1.378	27091	9388.5	0	0	0	0	0	0	27091	0	0	25554	0	0	0	0	0	0	0	0	0	9388.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251RTP5	A0A251RTP5_HELAN	Uncharacterized protein	HannXRQ_Chr17g0563671	Helianthus annuus (Common sunflower)					IHKYRPR	tr|A0A251RTP5|A0A251RTP5_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0563671 PE=4 SV=1	0.87072	1.378	0	0	0	30440	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12259	0	0	30440	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251RTR2	A0A251RTR2_HELAN	Acyl-coenzyme A oxidase	HannXRQ_Chr17g0565241	Helianthus annuus (Common sunflower)	fatty acid beta-oxidation using acyl-CoA oxidase [GO:0033540]; lipid homeostasis [GO:0055088]	peroxisome [GO:0005777]	peroxisome [GO:0005777]; acyl-CoA oxidase activity [GO:0003997]; FAD binding [GO:0071949]; fatty acid binding [GO:0005504]; flavin adenine dinucleotide binding [GO:0050660]; fatty acid beta-oxidation using acyl-CoA oxidase [GO:0033540]; lipid homeostasis [GO:0055088]	acyl-CoA oxidase activity [GO:0003997]; FAD binding [GO:0071949]; fatty acid binding [GO:0005504]; flavin adenine dinucleotide binding [GO:0050660]	SMSEPRK	tr|A0A251RTR2|A0A251RTR2_HELAN Acyl-coenzyme A oxidase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0565241 PE=3 SV=1	0.85744	1.378	229100	20631	23685	27051	0	6824.6	25484	62642	0	0	229100	0	0	0	20631	0	0	0	0	0	0	10005	0	23685	0	0	0	0	0	0	0	0	0	27051	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251RUS8	A0A251RUS8_HELAN	Putative transducin/WD40 repeat-like superfamily protein	YAO HannXRQ_Chr17g0569471	Helianthus annuus (Common sunflower)	rRNA processing [GO:0006364]	small-subunit processome [GO:0032040]	small-subunit processome [GO:0032040]; snoRNA binding [GO:0030515]; U3 snoRNA binding [GO:0034511]; rRNA processing [GO:0006364]	snoRNA binding [GO:0030515]; U3 snoRNA binding [GO:0034511]	KPVHIVK	tr|A0A251RUS8|A0A251RUS8_HELAN Putative transducin/WD40 repeat-like superfamily protein OS=Helianthus annuus OX=4232 GN=YAO PE=4 SV=1;tr|A0A162B832|A0A162B832_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_003859 PE=4 SV=1	0.87311	1.378	0	0	0	59424	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	59424	0	0	0	0	0	0	0	0	0	0
A0A251RV82	A0A251RV82_HELAN	Uncharacterized protein	HannXRQ_Chr16g0499031	Helianthus annuus (Common sunflower)					CDSGNSR	tr|A0A251RV82|A0A251RV82_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr16g0499031 PE=4 SV=1	0.85796	1.378	0	4574.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4574.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251RVD1	A0A251RVD1_HELAN	Putative pentatricopeptide repeat (PPR) superfamily protein	HannXRQ_Chr16g0499311	Helianthus annuus (Common sunflower)					HVKSCQK	tr|A0A251RVD1|A0A251RVD1_HELAN Putative pentatricopeptide repeat (PPR) superfamily protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr16g0499311 PE=4 SV=1	0.85804	1.378	0	0	53805	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	53805	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251RVQ2	A0A251RVQ2_HELAN	tRNA-uridine aminocarboxypropyltransferase (EC 2.5.1.25)	HannXRQ_Chr17g0556501	Helianthus annuus (Common sunflower)	tRNA processing [GO:0008033]		tRNA-uridine aminocarboxypropyltransferase activity [GO:0016432]; tRNA processing [GO:0008033]	tRNA-uridine aminocarboxypropyltransferase activity [GO:0016432]	CWLPQEDCMCSR	tr|A0A251RVQ2|A0A251RVQ2_HELAN tRNA-uridine aminocarboxypropyltransferase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0556501 PE=4 SV=1	0.84071	1.4003	0	0	17664	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17664	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251RW15	A0A251RW15_HELAN	Putative tetratricopeptide repeat (TPR)-like superfamily protein	HannXRQ_Chr16g0501781	Helianthus annuus (Common sunflower)					CGLLILK	tr|A0A251RW15|A0A251RW15_HELAN Putative tetratricopeptide repeat (TPR)-like superfamily protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr16g0501781 PE=4 SV=1	0.85856	1.378	106200	0	0	0	11667	0	0	0	0	0	0	0	106200	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11667	0	0
A0A251RW46	A0A251RW46_HELAN	Uncharacterized protein	HannXRQ_Chr17g0558281	Helianthus annuus (Common sunflower)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SPNQPLR	tr|A0A251RW46|A0A251RW46_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0558281 PE=4 SV=1	0.85908	1.378	10897	13194	0	11517	0	0	0	0	10897	10609	0	0	0	8363.6	0	0	0	8377.3	13194	0	0	8255.9	0	0	0	0	0	0	0	0	0	0	6932.2	0	0	11517	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251RWX8	A0A251RWX8_HELAN	Putative sorting nexin	HannXRQ_Chr16g0505261	Helianthus annuus (Common sunflower)					RDLRFIR	tr|A0A251RWX8|A0A251RWX8_HELAN Putative sorting nexin OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr16g0505261 PE=4 SV=1	0.86194	1.378	0	41423	0	55167	27926	0	0	0	0	0	0	0	0	0	0	0	0	0	0	41423	0	0	0	0	0	0	0	0	0	0	0	0	0	0	55167	0	34507	0	29913	0	0	0	27926	0	0	0	0	0	0	0
A0A251RXN0	A0A251RXN0_HELAN	"Putative amino acid transporter, transmembrane domain-containing protein"	HannXRQ_Chr16g0505871	Helianthus annuus (Common sunflower)	amino acid transport [GO:0006865]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; amino acid transport [GO:0006865]		VNEAPPK	"tr|A0A251RXN0|A0A251RXN0_HELAN Putative amino acid transporter, transmembrane domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr16g0505871 PE=4 SV=1;tr|A0A251URA9|A0A251URA9_HELAN Putative amino acid transporter, transmembrane domain-con"	0.78375	1.378	49953	41688	93798	34248	42098	0	27878	41819	49953	32602	0	48008	0	42160	0	0	0	25305	0	0	0	41688	0	0	53989	0	0	0	0	0	93798	82111	0	0	0	34248	0	0	0	0	0	0	0	42098	21735	0	28172	0	0	0
A0A251RYM2	A0A251RYM2_HELAN	Putative ABC-2 type transporter family protein	HannXRQ_Chr17g0568091	Helianthus annuus (Common sunflower)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	VEEHTLK	tr|A0A251RYM2|A0A251RYM2_HELAN Putative ABC-2 type transporter family protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0568091 PE=4 SV=1	0.89474	1.378	11278	16620	12044	10070	11669	0	11278	0	0	0	0	0	0	0	0	0	0	0	16620	0	0	12826	0	7970.2	12044	0	0	0	0	0	0	0	0	10070	0	0	0	0	0	0	0	0	0	0	0	11669	0	8117.3	0	0
A0A251RYZ9	A0A251RYZ9_HELAN	Uncharacterized protein	HannXRQ_Chr17g0569541	Helianthus annuus (Common sunflower)					SLLPRMM	tr|A0A251RYZ9|A0A251RYZ9_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0569541 PE=4 SV=1	0.88256	1.378	0	0	0	0	2558.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2558.7	0	0	0	0
A0A251RZL0	A0A251RZL0_HELAN	"Putative transposase, Ptta/En/Spm, plant"	HannXRQ_Chr16g0498571	Helianthus annuus (Common sunflower)					HGLDIFR	"tr|A0A251RZL0|A0A251RZL0_HELAN Putative transposase, Ptta/En/Spm, plant OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr16g0498571 PE=4 SV=1"	0.85826	1.378	5505.1	0	0	0	5344.6	0	0	0	0	0	0	0	0	5505.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5344.6	0	0
A0A251RZX7	A0A251RZX7_HELAN	Putative terpenoid cyclases/protein prenyltransferase alpha-alpha toroid	HannXRQ_Chr16g0517061	Helianthus annuus (Common sunflower)			magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333]; transferase activity [GO:0016740]	magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333]; transferase activity [GO:0016740]	LQLVDVM	tr|A0A251RZX7|A0A251RZX7_HELAN Putative terpenoid cyclases/protein prenyltransferase alpha-alpha toroid OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr16g0517061 PE=4 SV=1	0.85885	1.378	0	26756	0	11217	0	0	0	0	0	0	0	0	0	0	0	0	0	26756	0	0	0	16560	0	0	0	0	0	0	0	0	0	0	0	11217	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251S020	A0A251S020_HELAN	Uncharacterized protein	HannXRQ_Chr16g0515071	Helianthus annuus (Common sunflower)					RLLPLRR	tr|A0A251S020|A0A251S020_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr16g0515071 PE=4 SV=1;tr|A0A2J6KPM9|A0A2J6KPM9_LACSA VWFA domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_6X106881 PE=4 SV=1;tr|A0A2U1PUS3|A0A2U1PU	0.875	1.378	5719.2	12800	13660	1838400	6787.1	4759.1	4884.4	5719.2	0	0	0	0	5432.1	0	12800	0	3196.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13660	0	0	0	7369.3	0	0	0	1838400	7442.5	0	0	0	0	0	0	0	6787.1	0
A0A251S0J5	A0A251S0J5_HELAN	Putative gamma response protein	ATGR1 HannXRQ_Chr16g0519571	Helianthus annuus (Common sunflower)	DNA double-strand break processing involved in repair via single-strand annealing [GO:0010792]; double-strand break repair via homologous recombination [GO:0000724]	nucleus [GO:0005634]; site of double-strand break [GO:0035861]	nucleus [GO:0005634]; site of double-strand break [GO:0035861]; damaged DNA binding [GO:0003684]; double-strand/single-strand DNA junction binding [GO:0000406]; double-stranded DNA binding [GO:0003690]; flap-structured DNA binding [GO:0070336]; single-stranded DNA binding [GO:0003697]; single-stranded DNA endodeoxyribonuclease activity [GO:0000014]; Y-form DNA binding [GO:0000403]; DNA double-strand break processing involved in repair via single-strand annealing [GO:0010792]; double-strand break repair via homologous recombination [GO:0000724]	damaged DNA binding [GO:0003684]; double-strand/single-strand DNA junction binding [GO:0000406]; double-stranded DNA binding [GO:0003690]; flap-structured DNA binding [GO:0070336]; single-stranded DNA binding [GO:0003697]; single-stranded DNA endodeoxyribonuclease activity [GO:0000014]; Y-form DNA binding [GO:0000403]	SRHLLLM	tr|A0A251S0J5|A0A251S0J5_HELAN Putative gamma response protein OS=Helianthus annuus OX=4232 GN=ATGR1 PE=4 SV=1	0.85938	1.378	0	30215	0	0	13954	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30215	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13954	0	0	0	0	0	0
A0A251S0W9	A0A251S0W9_HELAN	Component of oligomeric Golgi complex 4 (Conserved oligomeric Golgi complex subunit 4)	HannXRQ_Chr16g0520851	Helianthus annuus (Common sunflower)	"protein transport [GO:0015031]; regulation of ER to Golgi vesicle-mediated transport [GO:0060628]; retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum [GO:0006890]"	Dsl1/NZR complex [GO:0070939]; membrane [GO:0016020]	"Dsl1/NZR complex [GO:0070939]; membrane [GO:0016020]; protein transport [GO:0015031]; regulation of ER to Golgi vesicle-mediated transport [GO:0060628]; retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum [GO:0006890]"		VRSVSIK	tr|A0A251S0W9|A0A251S0W9_HELAN Component of oligomeric Golgi complex 4 OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr16g0520851 PE=3 SV=1	0.8599	1.378	13661	14813	10127	14791	7752.9	0	0	0	0	0	0	0	13661	0	11565	14813	0	0	0	0	0	0	0	6600.2	6513	0	0	0	10127	0	0	0	0	0	0	0	0	12814	0	0	14791	0	0	0	0	0	7752.9	0	0	0
A0A251S224	A0A251S224_HELAN	Uncharacterized protein	HannXRQ_Chr16g0525311	Helianthus annuus (Common sunflower)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VPRLHRK	tr|A0A251S224|A0A251S224_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr16g0525311 PE=4 SV=1	0.85997	1.378	0	3820.4	0	3542.1	3780	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3820.4	0	0	0	0	0	0	0	0	0	0	0	0	0	3542.1	0	0	1346.7	0	0	0	3780	0	0	3603.5	0	0	0	0	0
A0A251S2B8	A0A251S2B8_HELAN	Uncharacterized protein	HannXRQ_Chr16g0526521	Helianthus annuus (Common sunflower)					NCWGADM	tr|A0A251S2B8|A0A251S2B8_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr16g0526521 PE=4 SV=1	0.86049	1.378	0	0	19252	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19252	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251S2C1	A0A251S2C1_HELAN	Protein kinase domain-containing protein	HannXRQ_Chr16g0524741	Helianthus annuus (Common sunflower)	intracellular signal transduction [GO:0035556]; protein phosphorylation [GO:0006468]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]; intracellular signal transduction [GO:0035556]; protein phosphorylation [GO:0006468]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	RGVKMVK	tr|A0A251S2C1|A0A251S2C1_HELAN Protein kinase domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr16g0524741 PE=4 SV=1	0.85625	1.378	43376	22828	19749	21670	15756	0	0	43376	0	0	0	0	0	0	0	22828	0	0	0	0	0	0	0	0	9716.5	0	0	0	0	0	14756	19749	0	0	0	21670	0	0	0	0	0	0	0	0	0	15756	9063.4	0	0	0
A0A251S347	A0A251S347_HELAN	"Putative F-box domain, Leucine-rich repeat domain, L domain-like protein"	HannXRQ_Chr16g0528361	Helianthus annuus (Common sunflower)					SGFVFTK	"tr|A0A251S347|A0A251S347_HELAN Putative F-box domain, Leucine-rich repeat domain, L domain-like protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr16g0528361 PE=4 SV=1"	0.85617	1.378	0	0	88564	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	88564	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251S3N5	A0A251S3N5_HELAN	"Putative B3 domain-containing protein, DNA-binding pseudobarrel domain protein"	HannXRQ_Chr16g0528661	Helianthus annuus (Common sunflower)			DNA binding [GO:0003677]	DNA binding [GO:0003677]	HTDSDFK	"tr|A0A251S3N5|A0A251S3N5_HELAN Putative B3 domain-containing protein, DNA-binding pseudobarrel domain protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr16g0528661 PE=4 SV=1;tr|A0A251T7Q4|A0A251T7Q4_HELAN Putative B3 domain-containing protein, DNA-binding "	0.87179	1.9388	25303	25745	51436	33294	35993	3106.9	0	0	0	0	25303	0	0	0	0	0	19722	0	0	0	25745	0	0	0	0	0	0	0	51436	0	0	50377	0	0	0	0	0	0	33294	0	30715	35993	0	0	0	0	0	0	0	0
A0A251S509	A0A251S509_HELAN	"Putative phosphate transporter 4,2"	PHT4:2 HannXRQ_Chr15g0463971	Helianthus annuus (Common sunflower)	phosphate ion transport [GO:0006817]	integral component of membrane [GO:0016021]; plastid [GO:0009536]	integral component of membrane [GO:0016021]; plastid [GO:0009536]; inorganic phosphate transmembrane transporter activity [GO:0005315]; phosphate ion transport [GO:0006817]	inorganic phosphate transmembrane transporter activity [GO:0005315]	GPPPANK	"tr|A0A251S509|A0A251S509_HELAN Putative phosphate transporter 4,2 OS=Helianthus annuus OX=4232 GN=PHT4:2 PE=3 SV=1"	0.85092	1.378	24824	11985	12749	0	11407	0	0	0	0	0	0	24824	0	0	0	0	0	0	0	0	0	11985	0	0	0	0	0	0	0	12749	0	0	0	0	0	0	0	0	0	0	0	0	0	10694	0	0	0	11407	0	0
A0A251S5Z9	A0A251S5Z9_HELAN	Uncharacterized protein	HannXRQ_Chr15g0463901	Helianthus annuus (Common sunflower)					INILLIPK	tr|A0A251S5Z9|A0A251S5Z9_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr15g0463901 PE=4 SV=1;tr|A0A251SS70|A0A251SS70_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0390301 PE=4 SV=1	0.89655	1.7026	6412500	8688600	3818500	6556000	5900100	5660300	6412500	5956100	2719200	4883700	520080	1946900	0	3688400	4037500	4989400	4211800	1973900	8688600	371470	2656600	2525700	1278500	638630	2091100	960820	2480100	3818500	2196800	1605900	3254000	2742200	1240600	3795300	1405300	6556000	3560700	1904900	55837	5332200	4247600	4515400	5900100	791070	104200	78132	587110	927510	1470700	239740
A0A251S656	A0A251S656_HELAN	Uncharacterized protein	HannXRQ_Chr15g0470911	Helianthus annuus (Common sunflower)					GSHSVGM	tr|A0A251S656|A0A251S656_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr15g0470911 PE=4 SV=1	0.85144	1.378	17133	28353	58772	32950	22412	0	17133	0	0	0	0	0	0	0	4899.2	0	0	0	0	28353	0	0	0	0	0	0	0	0	58772	0	0	58047	0	0	0	0	32950	0	30801	0	0	0	0	0	0	6876.5	5557	22412	0	0
A0A251S6M2	A0A251S6M2_HELAN	Putative SAP domain-containing protein	HannXRQ_Chr15g0471691	Helianthus annuus (Common sunflower)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	VELPPPR	tr|A0A251S6M2|A0A251S6M2_HELAN Putative SAP domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr15g0471691 PE=4 SV=1	0.85197	1.378	0	9794.8	10645	13540	0	0	0	0	0	0	0	0	0	0	0	9794.8	5890.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10645	0	0	0	13540	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251S6V5	A0A251S6V5_HELAN	Putative senescence regulator S40	HannXRQ_Chr15g0470691	Helianthus annuus (Common sunflower)					SGHWDAM	tr|A0A251S6V5|A0A251S6V5_HELAN Putative senescence regulator S40 OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr15g0470691 PE=4 SV=1	0.85249	1.378	0	0	7462.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7462.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251S7G8	A0A251S7G8_HELAN	Uncharacterized protein	HannXRQ_Chr15g0473011	Helianthus annuus (Common sunflower)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		TYDVMCM	tr|A0A251S7G8|A0A251S7G8_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr15g0473011 PE=4 SV=1	0.85302	1.378	0	7896.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7896.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251S846	A0A251S846_HELAN	Flavin-containing monooxygenase (EC 1.-.-.-)	HannXRQ_Chr15g0476481	Helianthus annuus (Common sunflower)			"flavin adenine dinucleotide binding [GO:0050660]; N,N-dimethylaniline monooxygenase activity [GO:0004499]; NADP binding [GO:0050661]"	"flavin adenine dinucleotide binding [GO:0050660]; N,N-dimethylaniline monooxygenase activity [GO:0004499]; NADP binding [GO:0050661]"	FALPKRK	tr|A0A251S846|A0A251S846_HELAN Flavin-containing monooxygenase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr15g0476481 PE=3 SV=1;tr|A0A2U1Q1Y0|A0A2U1Q1Y0_ARTAN Flavin-containing monooxygenase OS=Artemisia annua OX=35608 GN=CTI12_AA083640 PE=3 SV=1;tr|A0A2U1L	0.85265	1.378	0	7577.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7577.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251S9G5	A0A251S9G5_HELAN	Uncharacterized protein	HannXRQ_Chr15g0483871	Helianthus annuus (Common sunflower)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		INLLNCR	tr|A0A251S9G5|A0A251S9G5_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr15g0483871 PE=4 SV=1	0.85317	1.378	0	0	0	71060	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	71060	0	23632	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251S9P2	A0A251S9P2_HELAN	Uncharacterized protein	HannXRQ_Chr15g0483491	Helianthus annuus (Common sunflower)					EEVRELR	tr|A0A251S9P2|A0A251S9P2_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr15g0483491 PE=4 SV=1	0.8537	1.378	0	8002.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8002.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251SA51	A0A251SA51_HELAN	Putative TPX2	HannXRQ_Chr15g0486131	Helianthus annuus (Common sunflower)	mitotic spindle assembly [GO:0090307]; regulation of mitotic spindle organization [GO:0060236]	mitotic spindle [GO:0072686]; nuclear microtubule [GO:0005880]	mitotic spindle [GO:0072686]; nuclear microtubule [GO:0005880]; microtubule binding [GO:0008017]; protein kinase activator activity [GO:0030295]; mitotic spindle assembly [GO:0090307]; regulation of mitotic spindle organization [GO:0060236]	microtubule binding [GO:0008017]; protein kinase activator activity [GO:0030295]	HVKGKVK	tr|A0A251SA51|A0A251SA51_HELAN Putative TPX2 OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr15g0486131 PE=4 SV=1	0.8543	1.378	0	0	0	2447.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2447.1	0	0	0	0	0	0	0	0	0	0	0
A0A251SAY8	A0A251SAY8_HELAN	Putative pre-mRNA-splicing factor 3	HannXRQ_Chr15g0482981	Helianthus annuus (Common sunflower)	"mRNA splicing, via spliceosome [GO:0000398]"	U4/U6 x U5 tri-snRNP complex [GO:0046540]	"U4/U6 x U5 tri-snRNP complex [GO:0046540]; mRNA splicing, via spliceosome [GO:0000398]"		PLKLKTDIGR	tr|A0A251SAY8|A0A251SAY8_HELAN Putative pre-mRNA-splicing factor 3 OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr15g0482981 PE=4 SV=1	0.85482	1.378	0	0	54714	22809	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	54714	0	22809	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251SCJ1	A0A251SCJ1_HELAN	Putative APR-like 5	ATAPRL5 HannXRQ_Chr15g0495761	Helianthus annuus (Common sunflower)					KFHNGAR	tr|A0A251SCJ1|A0A251SCJ1_HELAN Putative APR-like 5 OS=Helianthus annuus OX=4232 GN=ATAPRL5 PE=4 SV=1;tr|A0A103YFU1|A0A103YFU1_CYNCS Thioredoxin domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_013303 PE=4 SV=1	0.82369	1.378	513290	528520	166670	378310	145630	513290	0	0	0	0	183210	422870	0	0	0	0	528520	0	0	0	0	0	275710	0	0	0	0	0	0	0	0	166670	0	0	0	0	378310	0	0	192190	0	0	0	0	145630	96181	0	0	0	0
A0A251SCK8	A0A251SCK8_HELAN	Uncharacterized protein	HannXRQ_Chr15g0495801	Helianthus annuus (Common sunflower)	protein autophosphorylation [GO:0046777]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; plasmodesma [GO:0009506]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; plasmodesma [GO:0009506]; ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; protein serine/threonine kinase activity [GO:0004674]; protein autophosphorylation [GO:0046777]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; protein serine/threonine kinase activity [GO:0004674]	HGKEFKR	tr|A0A251SCK8|A0A251SCK8_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr15g0495801 PE=4 SV=1	0.85542	1.378	42422	0	0	0	0	0	0	0	0	0	42422	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251SCS9	A0A251SCS9_HELAN	Putative serine-threonine/tyrosine-protein kinase catalytic domain-containing protein	HannXRQ_Chr15g0480491	Helianthus annuus (Common sunflower)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	ASEHKQR	tr|A0A251SCS9|A0A251SCS9_HELAN Putative serine-threonine/tyrosine-protein kinase catalytic domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr15g0480491 PE=4 SV=1	0.85595	1.378	13076	14380	13101	11391	9051.1	0	13076	0	0	0	0	0	10910	0	12179	0	14380	0	0	0	0	0	0	10567	0	0	0	0	13101	0	0	0	0	0	0	11391	0	10141	0	0	0	0	0	0	0	9051.1	0	0	0	0
A0A251SDD0	A0A251SDD0_HELAN	Phosphatidylinositol 4-phosphate 5-kinase (EC 2.7.1.68)	PIP5K2 HannXRQ_Chr15g0483151	Helianthus annuus (Common sunflower)			1-phosphatidylinositol-4-phosphate 5-kinase activity [GO:0016308]; ATP binding [GO:0005524]	1-phosphatidylinositol-4-phosphate 5-kinase activity [GO:0016308]; ATP binding [GO:0005524]	DGFGMAR	tr|A0A251SDD0|A0A251SDD0_HELAN Phosphatidylinositol 4-phosphate 5-kinase OS=Helianthus annuus OX=4232 GN=PIP5K2 PE=4 SV=1;tr|A0A5N6NXC4|A0A5N6NXC4_9ASTR 1-phosphatidylinositol-4-phosphate 5-kinase OS=Mikania micrantha OX=192012 GN=E3N88_15618 PE=4 SV=1;tr|	0.87755	2.194	7608.5	5753.8	8142.9	0	7755.3	0	0	0	0	7608.5	0	0	0	0	0	0	0	0	0	0	0	5753.8	0	0	0	0	0	0	0	0	0	8142.9	0	0	0	0	0	0	0	0	0	0	7755.3	0	0	0	0	0	0	0
A0A251SDX9	A0A251SDX9_HELAN	Putative concanavalin A-like lectin/glucanase domain-containing protein	HannXRQ_Chr14g0430401	Helianthus annuus (Common sunflower)	carbohydrate metabolic process [GO:0005975]		"carbohydrate binding [GO:0030246]; hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]; carbohydrate metabolic process [GO:0005975]"	"carbohydrate binding [GO:0030246]; hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]"	HASTSSR	tr|A0A251SDX9|A0A251SDX9_HELAN Putative concanavalin A-like lectin/glucanase domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0430401 PE=4 SV=1	0.85647	1.378	138730	515340	0	116780	111700	0	0	138730	0	0	0	0	0	0	105550	0	0	490530	0	515340	0	0	0	0	0	0	0	0	0	0	0	0	103630	116780	0	0	0	0	0	0	0	0	0	0	0	32659	0	0	0	111700
A0A251SEI3	A0A251SEI3_HELAN	Putative PWWP domain-containing protein	HannXRQ_Chr15g0487591	Helianthus annuus (Common sunflower)					VLLGHLK	tr|A0A251SEI3|A0A251SEI3_HELAN Putative PWWP domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr15g0487591 PE=4 SV=1	0.84932	2.0627	29955	37494	0	0	35102	0	0	0	0	29955	0	0	0	0	0	0	0	0	37494	0	8444.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35102	0	0
A0A251SEW8	A0A251SEW8_HELAN	Putative mitogen-activated protein (MAP) kinase kinase kinase 10	HannXRQ_Chr14g0434141	Helianthus annuus (Common sunflower)			ATP binding [GO:0005524]; protein tyrosine kinase activity [GO:0004713]	ATP binding [GO:0005524]; protein tyrosine kinase activity [GO:0004713]	SGGDPVK	tr|A0A251SEW8|A0A251SEW8_HELAN Putative mitogen-activated protein (MAP) kinase kinase kinase 10 OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0434141 PE=4 SV=1;tr|A0A251SV43|A0A251SV43_HELAN Protein kinase domain-containing protein OS=Helianthus annuus OX=	0.85654	1.378	0	0	0	8935.6	9212.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8935.6	0	5691.4	0	0	0	0	0	0	0	8596.7	0	0	0	9212.3	0	0
A0A251SFL8	A0A251SFL8_HELAN	"Putative concanavalin A-like lectin/glucanase domain, Serine/threonine-protein kinase Unc-51"	HannXRQ_Chr14g0434581	Helianthus annuus (Common sunflower)	cell surface receptor signaling pathway [GO:0007166]; protein phosphorylation [GO:0006468]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; carbohydrate binding [GO:0030246]; protein serine/threonine kinase activity [GO:0004674]; cell surface receptor signaling pathway [GO:0007166]; protein phosphorylation [GO:0006468]	ATP binding [GO:0005524]; carbohydrate binding [GO:0030246]; protein serine/threonine kinase activity [GO:0004674]	INCGKDM	"tr|A0A251SFL8|A0A251SFL8_HELAN Putative concanavalin A-like lectin/glucanase domain, Serine/threonine-protein kinase Unc-51 OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0434581 PE=4 SV=1"	0.84093	1.378	0	0	0	7835.5	2670.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7835.5	0	0	0	0	0	0	0	0	0	0	0	2670.1	0
A0A251SG70	A0A251SG70_HELAN	"Putative MYB-CC type transcription factor, LHEQLE-containing domain-containing protein"	HannXRQ_Chr14g0438951	Helianthus annuus (Common sunflower)			DNA-binding transcription factor activity [GO:0003700]	DNA-binding transcription factor activity [GO:0003700]	PVSSNSM	"tr|A0A251SG70|A0A251SG70_HELAN Putative MYB-CC type transcription factor, LHEQLE-containing domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0438951 PE=4 SV=1"	0.8193	1.378	176850	141960	75399	148040	227900	176850	66473	0	0	0	52764	0	0	0	61451	0	113430	141960	0	0	0	0	0	30245	0	0	0	75399	0	0	0	0	0	0	0	0	0	91611	148040	0	0	122080	227900	35716	18610	27640	69774	0	49414	0
A0A251SGB0	A0A251SGB0_HELAN	Putative plasma-membrane choline transporter family protein	HannXRQ_Chr15g0494641	Helianthus annuus (Common sunflower)	transmembrane transport [GO:0055085]	integral component of membrane [GO:0016021]; membrane [GO:0016020]	integral component of membrane [GO:0016021]; membrane [GO:0016020]; transmembrane transporter activity [GO:0022857]; transmembrane transport [GO:0055085]	transmembrane transporter activity [GO:0022857]	YGNSGSM	tr|A0A251SGB0|A0A251SGB0_HELAN Putative plasma-membrane choline transporter family protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr15g0494641 PE=3 SV=1	0.81984	1.378	0	17316	0	17746	4560.8	0	0	0	0	0	0	0	0	0	17316	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17746	0	0	15939	0	0	0	0	0	4560.8	0	0	0	0
A0A251SGD0	A0A251SGD0_HELAN	"Putative C2 domain, DnaJ domain, Sec63 domain, Immunoglobulin E-set"	HannXRQ_Chr14g0433471	Helianthus annuus (Common sunflower)	posttranslational protein targeting to endoplasmic reticulum membrane [GO:0006620]; SRP-dependent cotranslational protein targeting to membrane [GO:0006614]	integral component of membrane [GO:0016021]; Sec62/Sec63 complex [GO:0031207]	integral component of membrane [GO:0016021]; Sec62/Sec63 complex [GO:0031207]; protein transmembrane transporter activity [GO:0008320]; RNA binding [GO:0003723]; posttranslational protein targeting to endoplasmic reticulum membrane [GO:0006620]; SRP-dependent cotranslational protein targeting to membrane [GO:0006614]	protein transmembrane transporter activity [GO:0008320]; RNA binding [GO:0003723]	MMLEELR	"tr|A0A251SGD0|A0A251SGD0_HELAN Putative C2 domain, DnaJ domain, Sec63 domain, Immunoglobulin E-set OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0433471 PE=4 SV=1;tr|A0A103XPY1|A0A103XPY1_CYNCS DnaJ domain-containing protein OS=Cynara cardunculus var. scol"	0.81253	1.378	0	0	0	172260	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	172260	0	0	0	0	0	0	0	0	0	0
A0A251SGN8	A0A251SGN8_HELAN	Putative carrier protein	HannXRQ_Chr14g0440781	Helianthus annuus (Common sunflower)		integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; calcium ion binding [GO:0005509]; S-adenosyl-L-methionine transmembrane transporter activity [GO:0000095]	calcium ion binding [GO:0005509]; S-adenosyl-L-methionine transmembrane transporter activity [GO:0000095]	FGEAETR	tr|A0A251SGN8|A0A251SGN8_HELAN Putative carrier protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0440781 PE=3 SV=1;tr|A0A6L2MIJ4|A0A6L2MIJ4_TANCI Mitochondrial substrate carrier family protein C (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci	0.89362	2.1966	0	0	11736	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11736	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251SGU7	A0A251SGU7_HELAN	Putative phosphatidylinositol 3-and 4-kinase family protein with FAT domain-containing protein	HannXRQ_Chr14g0441401	Helianthus annuus (Common sunflower)	"DNA repair [GO:0006281]; regulation of transcription, DNA-templated [GO:0006355]"	NuA4 histone acetyltransferase complex [GO:0035267]; nucleus [GO:0005634]; SAGA complex [GO:0000124]	"NuA4 histone acetyltransferase complex [GO:0035267]; nucleus [GO:0005634]; SAGA complex [GO:0000124]; ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; transcription coregulator activity [GO:0003712]; DNA repair [GO:0006281]; regulation of transcription, DNA-templated [GO:0006355]"	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; transcription coregulator activity [GO:0003712]	FGWNHLK	tr|A0A251SGU7|A0A251SGU7_HELAN Putative phosphatidylinositol 3-and 4-kinase family protein with FAT domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0441401 PE=4 SV=1	0.78378	2.4305	113220	109360	44154	63930	40974	0	0	38842	110990	113220	0	86891	0	0	0	0	0	0	109360	0	0	25394	0	44154	6489.3	0	19448	0	0	0	0	0	63930	19895	0	0	0	0	0	0	0	0	0	0	0	0	0	40442	40974	0
A0A251SGY4	A0A251SGY4_HELAN	Protein kinase domain-containing protein	HannXRQ_Chr14g0441681	Helianthus annuus (Common sunflower)	protein autophosphorylation [GO:0046777]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; plasmodesma [GO:0009506]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; plasmodesma [GO:0009506]; ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; protein serine/threonine kinase activity [GO:0004674]; protein autophosphorylation [GO:0046777]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; protein serine/threonine kinase activity [GO:0004674]	PDAMQSM	tr|A0A251SGY4|A0A251SGY4_HELAN Protein kinase domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0441681 PE=3 SV=1	0.82091	1.378	0	0	0	0	10528	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10528	0
A0A251SJ60	A0A251SJ60_HELAN	"Putative F-box domain, Leucine-rich repeat domain, L domain-like protein"	HannXRQ_Chr14g0450571	Helianthus annuus (Common sunflower)					VRKLLTK	"tr|A0A251SJ60|A0A251SJ60_HELAN Putative F-box domain, Leucine-rich repeat domain, L domain-like protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0450571 PE=4 SV=1"	0.82101	1.378	7362.4	7060.8	0	0	2133	0	7362.4	0	0	0	0	0	0	0	0	0	7060.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2133	0	0	0
A0A251SK60	A0A251SK60_HELAN	Glycerophosphodiester phosphodiesterase (EC 3.1.4.46)	SRG3 HannXRQ_Chr14g0451271	Helianthus annuus (Common sunflower)	glycerol metabolic process [GO:0006071]; glycerophospholipid catabolic process [GO:0046475]		glycerophosphodiester phosphodiesterase activity [GO:0008889]; glycerol metabolic process [GO:0006071]; glycerophospholipid catabolic process [GO:0046475]	glycerophosphodiester phosphodiesterase activity [GO:0008889]	VVLKTGK	tr|A0A251SK60|A0A251SK60_HELAN Glycerophosphodiester phosphodiesterase OS=Helianthus annuus OX=4232 GN=SRG3 PE=4 SV=1	0.82154	1.378	0	13311	0	18191	0	0	0	0	0	0	0	0	0	0	7439.5	10212	0	0	0	0	13311	0	0	0	0	0	0	0	0	0	0	0	0	0	18191	0	0	12676	0	0	0	0	0	0	0	0	0	0	0	0
A0A251SKB7	A0A251SKB7_HELAN	Uncharacterized protein	HannXRQ_Chr14g0439961	Helianthus annuus (Common sunflower)					DSSKKYK	tr|A0A251SKB7|A0A251SKB7_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0439961 PE=4 SV=1	0.82208	1.378	3811200	3243700	0	1072000	3385700	0	0	3164400	3811200	0	0	0	0	0	2004900	0	3243700	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1072000	0	3385700	0	0	0	0	0	0	0	0
A0A251SKF3	A0A251SKF3_HELAN	Putative JUMONJI 14	JMJ14 HannXRQ_Chr14g0455281	Helianthus annuus (Common sunflower)	chromatin remodeling [GO:0006338]	nucleus [GO:0005634]	nucleus [GO:0005634]; histone demethylase activity [GO:0032452]; histone demethylase activity (H3-trimethyl-K4 specific) [GO:0034647]; chromatin remodeling [GO:0006338]	histone demethylase activity [GO:0032452]; histone demethylase activity (H3-trimethyl-K4 specific) [GO:0034647]	VQCNSCEECR	tr|A0A251SKF3|A0A251SKF3_HELAN Putative JUMONJI 14 OS=Helianthus annuus OX=4232 GN=JMJ14 PE=4 SV=1	0.88889	1.378	0	0	5663.1	16378	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5663.1	0	0	0	0	16378	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251SL06	A0A251SL06_HELAN	Putative DYW domain-containing protein	HannXRQ_Chr14g0442571	Helianthus annuus (Common sunflower)			zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	IIANHCR	tr|A0A251SL06|A0A251SL06_HELAN Putative DYW domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0442571 PE=3 SV=1;tr|A0A251SGG7|A0A251SGG7_HELAN Putative DYW domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g044017	0.82038	1.378	0	0	11022	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11022	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251SL10	A0A251SL10_HELAN	Putative SEC7-like guanine nucleotide exchange family protein	HannXRQ_Chr14g0455161	Helianthus annuus (Common sunflower)	protein transport [GO:0015031]; regulation of ARF protein signal transduction [GO:0032012]	cytosol [GO:0005829]; membrane [GO:0016020]; trans-Golgi network [GO:0005802]	cytosol [GO:0005829]; membrane [GO:0016020]; trans-Golgi network [GO:0005802]; guanyl-nucleotide exchange factor activity [GO:0005085]; protein transport [GO:0015031]; regulation of ARF protein signal transduction [GO:0032012]	guanyl-nucleotide exchange factor activity [GO:0005085]	CCVSDIR	tr|A0A251SL10|A0A251SL10_HELAN Putative SEC7-like guanine nucleotide exchange family protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0455161 PE=4 SV=1	0.82262	1.378	0	0	0	0	34658	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34658
A0A251SLM7	A0A251SLM7_HELAN	Putative nucleotide-binding alpha-beta plait domain-containing protein	HannXRQ_Chr14g0460181	Helianthus annuus (Common sunflower)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	HAVKIKK	tr|A0A251SLM7|A0A251SLM7_HELAN Putative nucleotide-binding alpha-beta plait domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0460181 PE=4 SV=1	0.82183	1.378	8181.5	8653.1	0	6031.5	3794.8	0	0	0	0	8181.5	0	0	0	0	0	0	0	6638.7	8653.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6031.5	0	5738.6	0	0	0	0	0	0	0	0	0	0	0	3794.8	0	0
A0A251SM47	A0A251SM47_HELAN	DUF2431 domain-containing protein	HannXRQ_Chr14g0460481	Helianthus annuus (Common sunflower)	rRNA base methylation [GO:0070475]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; rRNA (uridine-N3-)-methyltransferase activity [GO:0070042]; rRNA base methylation [GO:0070475]	rRNA (uridine-N3-)-methyltransferase activity [GO:0070042]	ADNSDNR	tr|A0A251SM47|A0A251SM47_HELAN DUF2431 domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0460481 PE=4 SV=1	0.8229	1.378	0	0	35934	18926	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35934	0	0	0	0	0	0	0	0	0	0	18926	0	0	0	0	0	0	0	0	0	0	0
A0A251SM56	A0A251SM56_HELAN	"Putative heavy metal-associated domain, HMA"	HannXRQ_Chr14g0462111	Helianthus annuus (Common sunflower)			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	RAVKVLK	"tr|A0A251SM56|A0A251SM56_HELAN Putative heavy metal-associated domain, HMA OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0462111 PE=4 SV=1"	0.82343	1.378	0	0	0	0	3795.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3795.3	0	0	0	0	0	0
A0A251SM95	A0A251SM95_HELAN	Uncharacterized protein	HannXRQ_Chr14g0461001	Helianthus annuus (Common sunflower)					VTSGSTK	tr|A0A251SM95|A0A251SM95_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0461001 PE=4 SV=1	0.82397	1.378	8447.9	64360	69350	84364	37315	8447.9	0	5519.4	0	0	0	0	0	0	16190	0	36177	0	0	0	64360	0	0	17062	0	49499	40904	0	69350	0	0	60535	0	0	0	0	74639	0	0	25417	84364	0	37315	0	29355	15773	2707.7	4735.8	0	0
A0A251SMJ1	A0A251SMJ1_HELAN	"Putative SNF2-related, N-terminal domain-containing protein"	HannXRQ_Chr14g0457461 HannXRQ_Chr14g0457471	Helianthus annuus (Common sunflower)	gene silencing by RNA-directed DNA methylation [GO:0080188]		ATP binding [GO:0005524]; nucleosome-dependent ATPase activity [GO:0070615]; gene silencing by RNA-directed DNA methylation [GO:0080188]	ATP binding [GO:0005524]; nucleosome-dependent ATPase activity [GO:0070615]	GFRNMRR	"tr|A0A251SMJ1|A0A251SMJ1_HELAN Putative SNF2-related, N-terminal domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0457461 PE=4 SV=1;tr|A0A251SKW9|A0A251SKW9_HELAN Putative SNF2-related, N-terminal domain-containing protein OS=Heliant"	0.93836	1.378	0	0	4068.3	0	1093.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4068.3	0	0	0	0	0	0	0	0	0	0	1093.6	0	0	0	0	0	0	0	0
A0A251SP22	A0A251SP22_HELAN	Uncharacterized protein	HannXRQ_Chr13g0389171	Helianthus annuus (Common sunflower)					GDYGDER	tr|A0A251SP22|A0A251SP22_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0389171 PE=4 SV=1	0.82451	1.378	0	0	0	33809	26065	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33809	0	0	0	0	18365	26065	0	0	0	19985	0	0	0
A0A251SP98	A0A251SP98_HELAN	Protein-serine/threonine phosphatase (EC 3.1.3.16)	HannXRQ_Chr13g0393511	Helianthus annuus (Common sunflower)			metal ion binding [GO:0046872]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]	metal ion binding [GO:0046872]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]	HMVVIQPDHPHLRDLRR	tr|A0A251SP98|A0A251SP98_HELAN Protein-serine/threonine phosphatase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0393511 PE=3 SV=1	0.87006	1.378	0	104420	114560	255160	53510	0	0	0	0	0	0	0	0	0	60616	99792	104420	0	0	0	27994	0	0	0	107370	114560	0	0	0	0	0	0	0	0	255160	0	0	0	0	0	0	0	53510	0	0	0	0	0	0	0
A0A251SPB5	A0A251SPB5_HELAN	Uncharacterized protein	HannXRQ_Chr13g0393941	Helianthus annuus (Common sunflower)					RKCQVAK	tr|A0A251SPB5|A0A251SPB5_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0393941 PE=4 SV=1	0.82558	1.378	26829	36488	19942	35477	44988	0	0	0	0	0	26829	0	0	0	0	33036	25785	0	0	36488	20842	0	0	0	17903	19942	0	0	0	0	0	0	0	0	0	28792	35477	0	0	0	0	44988	0	0	0	0	0	0	0	0
A0A251SPJ1	A0A251SPJ1_HELAN	"Putative ARID/BRIGHT DNA-binding domain,ELM2 domain protein"	HannXRQ_Chr13g0394511	Helianthus annuus (Common sunflower)			DNA binding [GO:0003677]	DNA binding [GO:0003677]	RASSLRK	"tr|A0A251SPJ1|A0A251SPJ1_HELAN Putative ARID/BRIGHT DNA-binding domain,ELM2 domain protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0394511 PE=4 SV=1"	0.82611	1.378	0	31153	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31153	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251SPK1	A0A251SPK1_HELAN	Pyruvate kinase (EC 2.7.1.40)	HannXRQ_Chr13g0391301	Helianthus annuus (Common sunflower)	glycolytic process [GO:0006096]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; kinase activity [GO:0016301]; magnesium ion binding [GO:0000287]; potassium ion binding [GO:0030955]; pyruvate kinase activity [GO:0004743]; glycolytic process [GO:0006096]	ATP binding [GO:0005524]; kinase activity [GO:0016301]; magnesium ion binding [GO:0000287]; potassium ion binding [GO:0030955]; pyruvate kinase activity [GO:0004743]	VDPPLDR	tr|A0A251SPK1|A0A251SPK1_HELAN Pyruvate kinase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0391301 PE=3 SV=1;tr|A0A251SP82|A0A251SP82_HELAN Pyruvate kinase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0393381 PE=3 SV=1;tr|A0A251SP62|A0A251SP62_HELAN Pyr	0.82504	1.378	10054	0	9910.6	14548	13950	7338.1	8703.8	10054	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6614.4	0	0	0	0	0	0	9910.6	0	9105.3	0	14548	0	0	0	0	0	0	0	8017.6	0	0	0	13950	0	0
A0A251SPQ1	A0A251SPQ1_HELAN	Putative SAM dependent carboxyl methyltransferase	HannXRQ_Chr13g0395381	Helianthus annuus (Common sunflower)	methylation [GO:0032259]		metal ion binding [GO:0046872]; methyltransferase activity [GO:0008168]; methylation [GO:0032259]	metal ion binding [GO:0046872]; methyltransferase activity [GO:0008168]	LSSFAGM	tr|A0A251SPQ1|A0A251SPQ1_HELAN Putative SAM dependent carboxyl methyltransferase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0395381 PE=3 SV=1	0.82665	1.378	7737.9	0	17556	9380.7	0	6913.3	0	7737.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7766.1	0	0	0	0	0	0	17556	9380.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251SQ47	A0A251SQ47_HELAN	Uncharacterized protein	HannXRQ_Chr14g0458931	Helianthus annuus (Common sunflower)		chloroplast [GO:0009507]	chloroplast [GO:0009507]		RPHKLIK	tr|A0A251SQ47|A0A251SQ47_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0458931 PE=4 SV=1	0.81877	1.378	23804	16786	19004	0	7670.4	0	0	0	0	0	23804	0	0	0	0	16786	0	0	0	0	0	0	0	0	0	0	0	0	19004	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7670.4	0	0	0	0	0
A0A251SQ62	A0A251SQ62_HELAN	Fatty acyl-CoA reductase (EC 1.2.1.84)	HannXRQ_Chr13g0397111	Helianthus annuus (Common sunflower)	lipid metabolic process [GO:0006629]; long-chain fatty-acyl-CoA metabolic process [GO:0035336]; suberin biosynthetic process [GO:0010345]	intracellular membrane-bounded organelle [GO:0043231]	intracellular membrane-bounded organelle [GO:0043231]; alcohol-forming fatty acyl-CoA reductase activity [GO:0102965]; fatty-acyl-CoA reductase (alcohol-forming) activity [GO:0080019]; lipid metabolic process [GO:0006629]; long-chain fatty-acyl-CoA metabolic process [GO:0035336]; suberin biosynthetic process [GO:0010345]	alcohol-forming fatty acyl-CoA reductase activity [GO:0102965]; fatty-acyl-CoA reductase (alcohol-forming) activity [GO:0080019]	LLVKFKR	tr|A0A251SQ62|A0A251SQ62_HELAN Fatty acyl-CoA reductase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0397111 PE=3 SV=1	0.81823	1.378	0	3244.1	15919	9562.3	2541	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3244.1	0	0	0	0	0	0	0	15919	0	0	0	0	0	0	0	0	0	0	9562.3	0	0	0	0	0	0	0	2541	0	0	0
A0A251SQF3	A0A251SQF3_HELAN	Reverse transcriptase	HannXRQ_Chr13g0397991	Helianthus annuus (Common sunflower)	DNA integration [GO:0015074]		aspartic-type endopeptidase activity [GO:0004190]; endonuclease activity [GO:0004519]; nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	aspartic-type endopeptidase activity [GO:0004190]; endonuclease activity [GO:0004519]; nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	AHEAGDK	tr|A0A251SQF3|A0A251SQF3_HELAN Reverse transcriptase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0397991 PE=4 SV=1;tr|A0A251SFU3|A0A251SFU3_HELAN Reverse transcriptase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr14g0435351 PE=4 SV=1	0.82825	1.378	0	0	8569.8	12184	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8569.8	0	0	0	0	0	0	0	0	0	0	0	0	0	12184	0	0	0	0	0	0	0	0	0
A0A251SQI3	A0A251SQI3_HELAN	Uncharacterized protein	HannXRQ_Chr13g0392381	Helianthus annuus (Common sunflower)					PKIIYKK	tr|A0A251SQI3|A0A251SQI3_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0392381 PE=4 SV=1	0.81559	1.378	0	0	22341	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22341	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251SRC0	A0A251SRC0_HELAN	"Putative zinc finger, RING-type"	HannXRQ_Chr13g0401651	Helianthus annuus (Common sunflower)	positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; protein polyubiquitination [GO:0000209]; ubiquitin-dependent protein catabolic process [GO:0006511]	cytoplasm [GO:0005737]; ubiquitin ligase complex [GO:0000151]	cytoplasm [GO:0005737]; ubiquitin ligase complex [GO:0000151]; metal ion binding [GO:0046872]; nucleic acid binding [GO:0003676]; RNA-DNA hybrid ribonuclease activity [GO:0004523]; ubiquitin conjugating enzyme binding [GO:0031624]; ubiquitin protein ligase activity [GO:0061630]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; protein polyubiquitination [GO:0000209]; ubiquitin-dependent protein catabolic process [GO:0006511]	metal ion binding [GO:0046872]; nucleic acid binding [GO:0003676]; RNA-DNA hybrid ribonuclease activity [GO:0004523]; ubiquitin conjugating enzyme binding [GO:0031624]; ubiquitin protein ligase activity [GO:0061630]	QVCCYCR	"tr|A0A251SRC0|A0A251SRC0_HELAN Putative zinc finger, RING-type OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0401651 PE=3 SV=1"	0.95	1.378	7213.6	0	0	0	0	0	0	0	0	7213.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251SRF0	A0A251SRF0_HELAN	Putative SGNH hydrolase-type esterase domain-containing protein	HannXRQ_Chr13g0401951	Helianthus annuus (Common sunflower)			"hydrolase activity, acting on ester bonds [GO:0016788]"	"hydrolase activity, acting on ester bonds [GO:0016788]"	QHSECCR	tr|A0A251SRF0|A0A251SRF0_HELAN Putative SGNH hydrolase-type esterase domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0401951 PE=3 SV=1	0.8843	1.378	0	0	0	0	15396	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15396
A0A251SS23	A0A251SS23_HELAN	Lipoxygenase (EC 1.13.11.-)	HannXRQ_Chr13g0404321	Helianthus annuus (Common sunflower)	fatty acid biosynthetic process [GO:0006633]; lipid oxidation [GO:0034440]; oxylipin biosynthetic process [GO:0031408]		"metal ion binding [GO:0046872]; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702]; fatty acid biosynthetic process [GO:0006633]; lipid oxidation [GO:0034440]; oxylipin biosynthetic process [GO:0031408]"	"metal ion binding [GO:0046872]; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702]"	SDTFFRK	tr|A0A251SS23|A0A251SS23_HELAN Lipoxygenase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0404321 PE=3 SV=1;tr|A0A5N6N3G1|A0A5N6N3G1_9ASTR Lipoxygenase OS=Mikania micrantha OX=192012 GN=E3N88_24398 PE=3 SV=1;tr|A0A5N6LKI1|A0A5N6LKI1_9ASTR Lipoxygenase OS=M	0.81324	1.378	0	0	0	22924	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22924	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251SSJ0	A0A251SSJ0_HELAN	Uncharacterized protein	HannXRQ_Chr13g0406211	Helianthus annuus (Common sunflower)		plasma membrane [GO:0005886]	plasma membrane [GO:0005886]		HRHKWQK	tr|A0A251SSJ0|A0A251SSJ0_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0406211 PE=4 SV=1	0.81378	1.378	67753	0	53849	41612	38438	0	67753	0	0	0	0	58629	0	56174	0	0	0	0	0	0	0	0	0	53849	39677	0	0	0	0	0	0	0	0	41612	0	0	0	0	0	0	30487	0	0	0	0	0	37107	32315	38438	0
A0A251ST61	A0A251ST61_HELAN	Dihydrolipoyllysine-residue succinyltransferase (EC 2.3.1.61)	HannXRQ_Chr13g0408681	Helianthus annuus (Common sunflower)	L-lysine catabolic process to acetyl-CoA via saccharopine [GO:0033512]; tricarboxylic acid cycle [GO:0006099]	oxoglutarate dehydrogenase complex [GO:0045252]	oxoglutarate dehydrogenase complex [GO:0045252]; dihydrolipoyllysine-residue succinyltransferase activity [GO:0004149]; L-lysine catabolic process to acetyl-CoA via saccharopine [GO:0033512]; tricarboxylic acid cycle [GO:0006099]	dihydrolipoyllysine-residue succinyltransferase activity [GO:0004149]	RVFVGFM	tr|A0A251ST61|A0A251ST61_HELAN Dihydrolipoyllysine-residue succinyltransferase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0408681 PE=3 SV=1	0.81432	1.378	16448	0	0	0	0	0	0	0	0	0	0	0	16448	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251SU46	A0A251SU46_HELAN	Uncharacterized protein	HannXRQ_Chr13g0397931	Helianthus annuus (Common sunflower)					RALLLTK	tr|A0A251SU46|A0A251SU46_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0397931 PE=4 SV=1	0.81442	1.378	4778.8	0	7527.9	5399	0	4778.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7527.9	0	0	0	0	0	0	0	5399	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251SUL9	A0A251SUL9_HELAN	"Putative phosphotransferases, alcohol group as acceptor"	HannXRQ_Chr13g0414661	Helianthus annuus (Common sunflower)	"DNA repair [GO:0006281]; regulation of transcription, DNA-templated [GO:0006355]"	NuA4 histone acetyltransferase complex [GO:0035267]; nucleus [GO:0005634]; SAGA complex [GO:0000124]	"NuA4 histone acetyltransferase complex [GO:0035267]; nucleus [GO:0005634]; SAGA complex [GO:0000124]; ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; transcription coregulator activity [GO:0003712]; DNA repair [GO:0006281]; regulation of transcription, DNA-templated [GO:0006355]"	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; transcription coregulator activity [GO:0003712]	LLLFDKGR	"tr|A0A251SUL9|A0A251SUL9_HELAN Putative phosphotransferases, alcohol group as acceptor OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0414661 PE=4 SV=1"	0.81495	1.378	0	30870	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30870	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251SV70	A0A251SV70_HELAN	Putative lipopolysaccharide-modifying protein	HannXRQ_Chr13g0402241	Helianthus annuus (Common sunflower)					PDMCDFM	tr|A0A251SV70|A0A251SV70_HELAN Putative lipopolysaccharide-modifying protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0402241 PE=4 SV=1	0.81549	1.378	0	0	0	0	7932.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7932.7	0	0	0	0	0	0	0
A0A251SXQ7	A0A251SXQ7_HELAN	Protein kinase domain-containing protein	HannXRQ_Chr13g0423301	Helianthus annuus (Common sunflower)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	GFVDVGM	tr|A0A251SXQ7|A0A251SXQ7_HELAN Protein kinase domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0423301 PE=4 SV=1	0.81613	1.378	6170.9	0	5799.5	5370	0	6170.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5799.5	0	0	0	0	0	0	0	0	0	0	5370	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251SYN7	A0A251SYN7_HELAN	Putative O-acyltransferase (WSD1-like) family protein	HannXRQ_Chr12g0356971	Helianthus annuus (Common sunflower)	triglyceride biosynthetic process [GO:0019432]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; diacylglycerol O-acyltransferase activity [GO:0004144]; long-chain-alcohol O-fatty-acyltransferase activity [GO:0047196]; triglyceride biosynthetic process [GO:0019432]	diacylglycerol O-acyltransferase activity [GO:0004144]; long-chain-alcohol O-fatty-acyltransferase activity [GO:0047196]	QIVDPNK	tr|A0A251SYN7|A0A251SYN7_HELAN Putative O-acyltransferase (WSD1-like) family protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr12g0356971 PE=3 SV=1	0.81623	1.378	0	0	68079	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	68079	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251SZ93	A0A251SZ93_HELAN	"Putative EF-hand domain pair, Serine/threonine-protein kinase Unc-51"	HannXRQ_Chr13g0418391	Helianthus annuus (Common sunflower)	intracellular signal transduction [GO:0035556]; peptidyl-serine phosphorylation [GO:0018105]; protein autophosphorylation [GO:0046777]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; calcium-dependent protein serine/threonine kinase activity [GO:0009931]; calmodulin binding [GO:0005516]; calmodulin-dependent protein kinase activity [GO:0004683]; intracellular signal transduction [GO:0035556]; peptidyl-serine phosphorylation [GO:0018105]; protein autophosphorylation [GO:0046777]	ATP binding [GO:0005524]; calcium-dependent protein serine/threonine kinase activity [GO:0009931]; calcium ion binding [GO:0005509]; calmodulin binding [GO:0005516]; calmodulin-dependent protein kinase activity [GO:0004683]	ESCCCGM	"tr|A0A251SZ93|A0A251SZ93_HELAN Putative EF-hand domain pair, Serine/threonine-protein kinase Unc-51 OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr13g0418391 PE=4 SV=1"	0.92188	1.378	50197	43172	87748	48432	22139	50197	0	0	24229	0	0	0	0	18817	0	0	0	43172	34063	29811	22752	21107	20813	0	0	0	17356	87748	24797	0	0	0	0	0	0	28700	0	28633	48432	26359	18530	0	22139	0	0	0	0	14251	0	0
A0A251T0E4	A0A251T0E4_HELAN	PSI subunit V	PSAL HannXRQ_Chr12g0363961	Helianthus annuus (Common sunflower)	photosynthesis [GO:0015979]	chloroplast thylakoid membrane [GO:0009535]; integral component of membrane [GO:0016021]; photosystem I reaction center [GO:0009538]	chloroplast thylakoid membrane [GO:0009535]; integral component of membrane [GO:0016021]; photosystem I reaction center [GO:0009538]; photosynthesis [GO:0015979]		SGSSPLR	tr|A0A251T0E4|A0A251T0E4_HELAN PSI subunit V OS=Helianthus annuus OX=4232 GN=PSAL PE=3 SV=1	0.81677	1.378	7095.1	0	4624	0	0	0	0	0	0	0	0	7095.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4624	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251T0I7	A0A251T0I7_HELAN	Putative nudix hydrolase	atnudt17 HannXRQ_Chr12g0362631	Helianthus annuus (Common sunflower)		cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; hydrolase activity [GO:0016787]	hydrolase activity [GO:0016787]	TSVMCMM	tr|A0A251T0I7|A0A251T0I7_HELAN Putative nudix hydrolase OS=Helianthus annuus OX=4232 GN=atnudt17 PE=4 SV=1	0.8173	1.378	0	0	6590.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6590.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251T151	A0A251T151_HELAN	Gly-zipper_Omp domain-containing protein	HannXRQ_Chr12g0366751	Helianthus annuus (Common sunflower)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		RAFPKAK	tr|A0A251T151|A0A251T151_HELAN Gly-zipper_Omp domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr12g0366751 PE=4 SV=1	0.81696	1.378	16740	0	0	33525	15051	11788	0	16740	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33525	0	0	0	0	8377.3	0	0	0	13500	0	0	0	15051	0
A0A251T202	A0A251T202_HELAN	Phosphoinositide phospholipase C (EC 3.1.4.11)	HannXRQ_Chr12g0370451	Helianthus annuus (Common sunflower)	lipid catabolic process [GO:0016042]; phosphatidylinositol-mediated signaling [GO:0048015]	plasma membrane [GO:0005886]	plasma membrane [GO:0005886]; phosphatidylinositol phospholipase C activity [GO:0004435]; lipid catabolic process [GO:0016042]; phosphatidylinositol-mediated signaling [GO:0048015]	phosphatidylinositol phospholipase C activity [GO:0004435]	DEDNHSM	tr|A0A251T202|A0A251T202_HELAN Phosphoinositide phospholipase C OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr12g0370451 PE=4 SV=1	0.81706	1.378	0	17560	0	0	20337	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17560	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20337	0	0	0	0	0
A0A251T266	A0A251T266_HELAN	Putative PAN/Apple domain-containing protein	HannXRQ_Chr12g0370921	Helianthus annuus (Common sunflower)					NPEFGEM	tr|A0A251T266|A0A251T266_HELAN Putative PAN/Apple domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr12g0370921 PE=4 SV=1	0.8176	1.378	62332	113530	81537	0	0	0	0	0	0	0	62332	0	0	0	0	0	0	0	0	0	113530	0	0	0	81537	66509	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251T3C6	A0A251T3C6_HELAN	"Putative glycosyl transferase, family 14"	HannXRQ_Chr12g0375721	Helianthus annuus (Common sunflower)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; glycosyltransferase activity [GO:0016757]	glycosyltransferase activity [GO:0016757]	MSSEIAK	"tr|A0A251T3C6|A0A251T3C6_HELAN Putative glycosyl transferase, family 14 OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr12g0375721 PE=4 SV=1"	0.82772	1.378	0	0	0	0	5617.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5617.3	0	0
A0A251T3N2	A0A251T3N2_HELAN	Receptor-like serine/threonine-protein kinase (EC 2.7.11.1)	HannXRQ_Chr12g0369641	Helianthus annuus (Common sunflower)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; carbohydrate binding [GO:0030246]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	ATP binding [GO:0005524]; carbohydrate binding [GO:0030246]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	SSASPPR	tr|A0A251T3N2|A0A251T3N2_HELAN Receptor-like serine/threonine-protein kinase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr12g0369641 PE=3 SV=1;tr|A0A251T2N3|A0A251T2N3_HELAN Receptor-like serine/threonine-protein kinase OS=Helianthus annuus OX=4232 GN=HannXR	0.87234	2.1966	0	11162	14993	0	3794.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11162	0	0	7278.7	0	0	0	0	12314	5649.2	14993	0	0	0	0	0	0	0	0	0	0	0	3794.3	0	0	0	0	0	0
A0A251T417	A0A251T417_HELAN	Putative glycosyl transferase family 29	HannXRQ_Chr12g0364601	Helianthus annuus (Common sunflower)	protein glycosylation [GO:0006486]	Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; sialyltransferase activity [GO:0008373]; protein glycosylation [GO:0006486]	sialyltransferase activity [GO:0008373]	HIVVTPK	"tr|A0A251T417|A0A251T417_HELAN Putative glycosyl transferase family 29 OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr12g0364601 PE=3 SV=1;tr|A0A2U1QDJ8|A0A2U1QDJ8_ARTAN Glycosyl transferase, family 29 OS=Artemisia annua OX=35608 GN=CTI12_AA043240 PE=3 SV=1"	0.82879	1.378	0	0	5603.4	2444.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5603.4	0	0	0	0	0	0	2444.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251T4W8	A0A251T4W8_HELAN	Putative WEB family	HannXRQ_Chr12g0379281	Helianthus annuus (Common sunflower)	chloroplast accumulation movement [GO:0009904]; chloroplast avoidance movement [GO:0009903]	cytosol [GO:0005829]	cytosol [GO:0005829]; chloroplast accumulation movement [GO:0009904]; chloroplast avoidance movement [GO:0009903]		VVFIRKK	tr|A0A251T4W8|A0A251T4W8_HELAN Putative WEB family OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr12g0379281 PE=3 SV=1	0.83934	1.378	13820	0	0	0	0	0	0	0	0	0	0	0	0	13820	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251T6A3	A0A251T6A3_HELAN	Uncharacterized protein	HannXRQ_Chr12g0381781	Helianthus annuus (Common sunflower)					VVSFEFR	tr|A0A251T6A3|A0A251T6A3_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr12g0381781 PE=4 SV=1	0.83689	1.378	0	0	0	0	16186	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16186	0
A0A251T6Z2	A0A251T6Z2_HELAN	Uncharacterized protein	HannXRQ_Chr11g0324451	Helianthus annuus (Common sunflower)					YLQLLKK	tr|A0A251T6Z2|A0A251T6Z2_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr11g0324451 PE=4 SV=1;tr|A0A251U2C6|A0A251U2C6_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0271301 PE=4 SV=1	0.90043	1.378	9007	4107.7	1335.6	9424	19028	0	0	0	0	0	9007	0	0	0	0	0	0	0	0	4107.7	3923.7	0	0	0	0	1335.6	0	0	0	0	0	0	0	0	9424	0	0	4013.5	0	0	0	19028	5324.4	0	0	0	0	0	0	0
A0A251T707	A0A251T707_HELAN	Uncharacterized protein	HannXRQ_Chr11g0324211	Helianthus annuus (Common sunflower)					LPPKPLK	tr|A0A251T707|A0A251T707_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr11g0324211 PE=4 SV=1;tr|A0A2U1MP36|A0A2U1MP36_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA352280 PE=4 SV=1;tr|A0A2U1KXA5|A0A2U1KXA5_A	0.83697	1.378	42225000	43195000	37853	39792000	41050000	42225000	22577	29811	0	0	0	0	27181	0	33725	0	39360000	43195000	0	0	21277	29458	32639	21434	0	0	0	0	0	26268	37853	30417	0	0	37255000	29458	0	0	39792000	31849000	0	41050000	0	0	0	15765	0	19491	25501	0
A0A251T7A7	A0A251T7A7_HELAN	Uncharacterized protein	HannXRQ_Chr11g0325191	Helianthus annuus (Common sunflower)	"mRNA cis splicing, via spliceosome [GO:0045292]; regulation of gene expression [GO:0010468]"	cytoplasm [GO:0005737]; spliceosomal complex [GO:0005681]	"cytoplasm [GO:0005737]; spliceosomal complex [GO:0005681]; mRNA cis splicing, via spliceosome [GO:0045292]; regulation of gene expression [GO:0010468]"		ERSRSAM	tr|A0A251T7A7|A0A251T7A7_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr11g0325191 PE=4 SV=1	0.90476	1.378	6329.8	0	0	0	4667.1	0	0	0	0	0	6329.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4667.1	0
A0A251T8Y7	A0A251T8Y7_HELAN	"Putative zinc finger, CCHC-type"	HannXRQ_Chr11g0331791	Helianthus annuus (Common sunflower)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	QKCFCTK	"tr|A0A251T8Y7|A0A251T8Y7_HELAN Putative zinc finger, CCHC-type OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr11g0331791 PE=4 SV=1;tr|A0A251VLX8|A0A251VLX8_HELAN Putative zinc finger, CCHC-type OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr01g0004481 PE=4 SV=1;tr"	0.85714	1.378	9435.2	4959.7	0	0	0	0	0	9435.2	0	0	0	0	0	0	0	4959.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251T9H4	A0A251T9H4_HELAN	Uncharacterized protein	HannXRQ_Chr11g0331741	Helianthus annuus (Common sunflower)					VSSDKVK	tr|A0A251T9H4|A0A251T9H4_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr11g0331741 PE=4 SV=1;tr|A0A699PJU8|A0A699PJU8_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_813413 PE=4 	0.75922	1.378	0	0	0	0	15661	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15661	0	0	11505	0	0	0	0	0
A0A251TAB5	A0A251TAB5_HELAN	Putative cytochrome P450	HannXRQ_Chr11g0333441	Helianthus annuus (Common sunflower)		integral component of membrane [GO:0016021]	"integral component of membrane [GO:0016021]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	FGVLIIK	tr|A0A251TAB5|A0A251TAB5_HELAN Putative cytochrome P450 OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr11g0333441 PE=3 SV=1	0.83706	1.378	11978	0	0	6799.8	0	0	0	0	11978	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6799.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251TAS1	A0A251TAS1_HELAN	Putative tudor/PWWP/MBT superfamily protein	HannXRQ_Chr11g0339461	Helianthus annuus (Common sunflower)					TIVVPGK	tr|A0A251TAS1|A0A251TAS1_HELAN Putative tudor/PWWP/MBT superfamily protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr11g0339461 PE=4 SV=1	0.83759	1.378	2857.1	0	0	0	0	0	2857.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251TBQ3	A0A251TBQ3_HELAN	Phosphatidylserine decarboxylase proenzyme 2 (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase 2 beta chain; Phosphatidylserine decarboxylase 2 alpha chain]	PSD3 PSD2 HannXRQ_Chr11g0337651	Helianthus annuus (Common sunflower)	phosphatidylethanolamine biosynthetic process [GO:0006646]; protein autoprocessing [GO:0016540]	membrane [GO:0016020]	membrane [GO:0016020]; calcium ion binding [GO:0005509]; phosphatidylserine decarboxylase activity [GO:0004609]; phosphatidylethanolamine biosynthetic process [GO:0006646]; protein autoprocessing [GO:0016540]	calcium ion binding [GO:0005509]; phosphatidylserine decarboxylase activity [GO:0004609]	SSTGHGM	tr|A0A251TBQ3|A0A251TBQ3_HELAN Phosphatidylserine decarboxylase proenzyme 2 OS=Helianthus annuus OX=4232 GN=PSD3 PE=3 SV=1	0.83813	1.378	9858.2	48979	16887	0	0	0	0	0	0	0	0	0	9858.2	0	0	0	0	0	0	0	48979	0	0	0	0	0	0	0	13920	0	0	16887	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251TCK7	A0A251TCK7_HELAN	"Putative zinc finger, RING/FYVE/PHD-type"	HannXRQ_Chr11g0346711	Helianthus annuus (Common sunflower)		nucleus [GO:0005634]	nucleus [GO:0005634]; metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	CGNCREWC	"tr|A0A251TCK7|A0A251TCK7_HELAN Putative zinc finger, RING/FYVE/PHD-type OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr11g0346711 PE=4 SV=1"	0.78873	2.1169	0	0	0	638160	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	638160	0	0	0	0	0	0	0	0	0
A0A251TCQ7	A0A251TCQ7_HELAN	Putative SKP1/ASK-interacting protein 5	SKIP5 HannXRQ_Chr11g0341831	Helianthus annuus (Common sunflower)					IPTNGDM	tr|A0A251TCQ7|A0A251TCQ7_HELAN Putative SKP1/ASK-interacting protein 5 OS=Helianthus annuus OX=4232 GN=SKIP5 PE=4 SV=1	0.83777	1.378	0	0	0	15905	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15905	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251TCS5	A0A251TCS5_HELAN	"Putative agenet-like domain, Agenet domain, plant type"	HannXRQ_Chr11g0341191	Helianthus annuus (Common sunflower)					KIPPVVR	"tr|A0A251TCS5|A0A251TCS5_HELAN Putative agenet-like domain, Agenet domain, plant type OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr11g0341191 PE=4 SV=1"	0.8383	1.378	42533	0	0	0	0	0	0	0	42533	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251TDR5	A0A251TDR5_HELAN	Uncharacterized protein	HannXRQ_Chr11g0351211	Helianthus annuus (Common sunflower)					MAGGHCK	tr|A0A251TDR5|A0A251TDR5_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr11g0351211 PE=4 SV=1	0.83794	1.378	0	9022.8	0	0	0	0	0	0	0	0	0	0	0	0	0	9022.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251TEX4	A0A251TEX4_HELAN	Putative lipopolysaccharide-modifying protein	HannXRQ_Chr10g0279651	Helianthus annuus (Common sunflower)					NTIVKPK	tr|A0A251TEX4|A0A251TEX4_HELAN Putative lipopolysaccharide-modifying protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0279651 PE=4 SV=1;tr|A0A103XEE5|A0A103XEE5_CYNCS Lipopolysaccharide-modifying protein OS=Cynara cardunculus var. scolymus OX=59895 GN	0.80102	1.378	3977.3	0	0	0	0	0	0	0	0	0	0	3977.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251TGK9	A0A251TGK9_HELAN	Putative P-glycoprotein 21	PGP21 HannXRQ_Chr10g0285641	Helianthus annuus (Common sunflower)	transmembrane transport [GO:0055085]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]; transmembrane transport [GO:0055085]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	LLPKVPK	tr|A0A251TGK9|A0A251TGK9_HELAN Putative P-glycoprotein 21 OS=Helianthus annuus OX=4232 GN=PGP21 PE=4 SV=1;tr|A0A103XPP6|A0A103XPP6_CYNCS AAA+ ATPase domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_003380 PE=4 SV=1	0.77778	2.4305	12740	24860	24658	13406	21527	0	0	0	6012.3	0	12740	0	0	0	0	0	0	13948	11237	5215.7	18999	4906.8	24860	0	3833.6	0	20212	0	0	0	24658	5031.6	0	13406	11045	2875.2	0	0	0	0	0	0	0	0	0	21527	0	0	5171.5	0
A0A251TGY6	A0A251TGY6_HELAN	Putative transcription factor GRAS	HannXRQ_Chr10g0287091	Helianthus annuus (Common sunflower)	"regulation of transcription, DNA-templated [GO:0006355]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; regulation of transcription, DNA-templated [GO:0006355]"	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	DSQMMMM	tr|A0A251TGY6|A0A251TGY6_HELAN Putative transcription factor GRAS OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0287091 PE=3 SV=1	0.83864	1.378	0	0	32278	0	30885	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32278	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30885	0
A0A251THZ2	A0A251THZ2_HELAN	"Putative (3S,6E)-nerolidol synthase 1 protein"	NES1 HannXRQ_Chr10g0285221	Helianthus annuus (Common sunflower)			magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333]	magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333]	PLKPRSK	"tr|A0A251THZ2|A0A251THZ2_HELAN Putative (3S,6E)-nerolidol synthase 1 protein OS=Helianthus annuus OX=4232 GN=NES1 PE=4 SV=1"	0.83828	1.378	9310.5	15305	0	24650	13009	0	9310.5	0	0	0	0	0	0	0	15305	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24650	0	0	0	13009	0	0	0	0	0	0
A0A251TI54	A0A251TI54_HELAN	Uncharacterized protein	HannXRQ_Chr10g0285381	Helianthus annuus (Common sunflower)					GPELGDM	tr|A0A251TI54|A0A251TI54_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0285381 PE=4 SV=1	0.88755	1.378	0	46644	0	98208	45053	0	0	0	0	0	0	0	0	0	46644	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	98208	0	0	0	0	0	0	0	15680	11125	45053	0	0	0
A0A251TI79	A0A251TI79_HELAN	Uncharacterized protein	HannXRQ_Chr10g0292081	Helianthus annuus (Common sunflower)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SYCSDEM	tr|A0A251TI79|A0A251TI79_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0292081 PE=4 SV=1	0.83881	1.378	0	0	22505	0	15769	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22505	0	0	0	0	0	0	0	0	0	0	15769	0	0	0	0	0	0	0	0
A0A251TKD9	A0A251TKD9_HELAN	Uncharacterized protein	HannXRQ_Chr10g0298011	Helianthus annuus (Common sunflower)					VRFRVIR	tr|A0A251TKD9|A0A251TKD9_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0298011 PE=4 SV=1	0.83635	1.378	0	0	36492	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11511	0	0	0	0	0	36492	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251TKM0	A0A251TKM0_HELAN	Uncharacterized protein	HannXRQ_Chr10g0301381	Helianthus annuus (Common sunflower)					AFDSGMK	tr|A0A251TKM0|A0A251TKM0_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0301381 PE=4 SV=1;tr|A0A251RZR9|A0A251RZR9_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr16g0510181 PE=4 SV=1	0.85878	1.378	0	0	0	18997	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18997	0	0	0	0	0	0	0	0	0	0
A0A251TL97	A0A251TL97_HELAN	Uncharacterized protein	HannXRQ_Chr10g0299871	Helianthus annuus (Common sunflower)					HAVIREM	tr|A0A251TL97|A0A251TL97_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0299871 PE=4 SV=1	0.89024	1.378	100780	0	0	0	13977	0	0	0	35005	100780	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13977	0	0	0	0
A0A251TN22	A0A251TN22_HELAN	Putative SET domain-containing protein	HannXRQ_Chr10g0308211	Helianthus annuus (Common sunflower)	peptidyl-lysine monomethylation [GO:0018026]		protein-lysine N-methyltransferase activity [GO:0016279]; peptidyl-lysine monomethylation [GO:0018026]	protein-lysine N-methyltransferase activity [GO:0016279]	VGNPDFK	tr|A0A251TN22|A0A251TN22_HELAN Putative SET domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0308211 PE=4 SV=1	0.83582	1.378	0	0	7119.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7119.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251TN44	A0A251TN44_HELAN	"Putative heavy metal-associated domain, HMA"	HannXRQ_Chr10g0310421	Helianthus annuus (Common sunflower)			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	VQLKKIK	"tr|A0A251TN44|A0A251TN44_HELAN Putative heavy metal-associated domain, HMA OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0310421 PE=4 SV=1"	0.83529	1.378	0	0	5571.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5571.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251TNV1	A0A251TNV1_HELAN	DUF1336 domain-containing protein	HannXRQ_Chr10g0308091	Helianthus annuus (Common sunflower)					SSACGGM	tr|A0A251TNV1|A0A251TNV1_HELAN DUF1336 domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0308091 PE=4 SV=1	0.8295	1.378	19691	6732.8	23301	14577	29432	0	19691	4697.5	16541	0	0	15518	0	17616	0	0	0	0	6404.7	0	0	6732.8	4439.9	0	12726	0	0	0	0	23000	23301	9737.1	0	7359.1	0	14577	5304.3	0	0	0	7509.3	0	0	10854	0	7157.5	8601.4	29432	11430	0
A0A251TPB3	A0A251TPB3_HELAN	"Putative ankyrin repeat-containing domain, PGG domain, Gag-polypeptide of LTR copia-type"	HannXRQ_Chr10g0303341	Helianthus annuus (Common sunflower)		integral component of membrane [GO:0016021]; membrane [GO:0016020]	integral component of membrane [GO:0016021]; membrane [GO:0016020]		VLLKMRK	"tr|A0A251TPB3|A0A251TPB3_HELAN Putative ankyrin repeat-containing domain, PGG domain, Gag-polypeptide of LTR copia-type OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0303341 PE=4 SV=1;tr|A0A251TSP4|A0A251TSP4_HELAN Putative ankyrin repeat-containing domain"	0.83004	1.378	0	0	23423	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23423	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251TQK8	A0A251TQK8_HELAN	Uncharacterized protein	HannXRQ_Chr10g0316381	Helianthus annuus (Common sunflower)					VGEDAEM	tr|A0A251TQK8|A0A251TQK8_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0316381 PE=4 SV=1	0.83057	1.378	7023.5	0	0	0	0	0	0	0	7023.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251TRA1	A0A251TRA1_HELAN	"Putative transposase (Putative), gypsy type"	HannXRQ_Chr10g0318471	Helianthus annuus (Common sunflower)					VCARPFSGILYPQLWRR	"tr|A0A251TRA1|A0A251TRA1_HELAN Putative transposase (Putative), gypsy type OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0318471 PE=4 SV=1"	0.89062	1.378	0	0	0	339500	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	339500	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251TRE3	A0A251TRE3_HELAN	Acyl-[acyl-carrier-protein] hydrolase (EC 3.1.2.-)	HannXRQ_Chr10g0311311	Helianthus annuus (Common sunflower)		chloroplast [GO:0009507]	chloroplast [GO:0009507]; acyl carrier activity [GO:0000036]; acyl-[acyl-carrier-protein] hydrolase activity [GO:0016297]	acyl-[acyl-carrier-protein] hydrolase activity [GO:0016297]; acyl carrier activity [GO:0000036]	NNQGLMM	tr|A0A251TRE3|A0A251TRE3_HELAN Acyl-[acyl-carrier-protein] hydrolase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0311311 PE=3 SV=1	0.83111	1.378	22171	57024	46869	31718	25509	0	0	0	0	22171	0	0	0	0	0	0	0	0	57024	0	25842	0	22637	0	46869	25136	0	0	0	0	0	0	31718	28146	0	0	0	0	0	0	0	0	0	0	0	0	13635	17434	0	25509
A0A251TRG3	A0A251TRG3_HELAN	Uncharacterized protein	HannXRQ_Chr09g0241281	Helianthus annuus (Common sunflower)					AATFDTM	tr|A0A251TRG3|A0A251TRG3_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0241281 PE=4 SV=1	0.90256	1.378	0	5469.8	14337	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5469.8	0	0	0	0	0	11316	14337	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251TRL1	A0A251TRL1_HELAN	"Putative leucine-rich repeat domain, L domain-like protein"	HannXRQ_Chr09g0237821	Helianthus annuus (Common sunflower)	nucleotide-excision repair [GO:0006289]; response to UV-C [GO:0010225]; SCF-dependent proteasomal ubiquitin-dependent protein catabolic process [GO:0031146]	SCF ubiquitin ligase complex [GO:0019005]	SCF ubiquitin ligase complex [GO:0019005]; nucleotide-excision repair [GO:0006289]; response to UV-C [GO:0010225]; SCF-dependent proteasomal ubiquitin-dependent protein catabolic process [GO:0031146]		PVKKLGR	"tr|A0A251TRL1|A0A251TRL1_HELAN Putative leucine-rich repeat domain, L domain-like protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0237821 PE=4 SV=1"	0.83164	1.378	0	0	29105	44588	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13628	0	29105	0	0	0	0	0	0	24628	0	0	0	44588	0	0	0	0	0	0	0	0	0	0	0
A0A251TRM5	A0A251TRM5_HELAN	"Putative F-box domain, Leucine-rich repeat domain, L domain-like protein"	HannXRQ_Chr09g0242011	Helianthus annuus (Common sunflower)	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process [GO:0031146]	SCF ubiquitin ligase complex [GO:0019005]	SCF ubiquitin ligase complex [GO:0019005]; SCF-dependent proteasomal ubiquitin-dependent protein catabolic process [GO:0031146]		HEDDGSK	"tr|A0A251TRM5|A0A251TRM5_HELAN Putative F-box domain, Leucine-rich repeat domain, L domain-like protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0242011 PE=4 SV=1"	0.83218	1.378	5041.4	0	386.55	0	0	0	5041.4	0	4210.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	386.55	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251TRM7	A0A251TRM7_HELAN	Putative S-adenosyl-L-methionine-dependent methyltransferase	HannXRQ_Chr10g0319881	Helianthus annuus (Common sunflower)	methylation [GO:0032259]; pectin metabolic process [GO:0045488]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; methyltransferase activity [GO:0008168]; methylation [GO:0032259]; pectin metabolic process [GO:0045488]	methyltransferase activity [GO:0008168]	LPKIFQR	tr|A0A251TRM7|A0A251TRM7_HELAN Putative S-adenosyl-L-methionine-dependent methyltransferase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0319881 PE=4 SV=1	0.86813	1.378	0	0	0	0	5725.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5725.9	0	0	0	0	0	0	0	0
A0A251TRN3	A0A251TRN3_HELAN	Uncharacterized protein	HannXRQ_Chr10g0319981	Helianthus annuus (Common sunflower)					SDYVMAM	tr|A0A251TRN3|A0A251TRN3_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0319981 PE=4 SV=1	0.83271	1.378	202160	107360	46882	0	33814	0	0	0	0	0	0	0	202160	74511	0	0	0	107360	0	0	0	0	0	46882	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33814	0	0	0
A0A251TT60	A0A251TT60_HELAN	Uncharacterized protein	HannXRQ_Chr09g0248071	Helianthus annuus (Common sunflower)					HDHVCRNFR	tr|A0A251TT60|A0A251TT60_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0248071 PE=4 SV=1	0.87923	1.378	0	0	3748.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3748.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251TTM0	A0A251TTM0_HELAN	Uncharacterized protein	HannXRQ_Chr09g0250081	Helianthus annuus (Common sunflower)					ESTGTDY	tr|A0A251TTM0|A0A251TTM0_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0250081 PE=4 SV=1	0.8835	1.378	255350	176880	101320	336200	141400	0	193930	0	0	0	0	255350	0	0	0	0	0	0	0	0	0	20385	176880	101320	0	0	0	0	0	0	0	0	0	0	110680	0	0	336200	0	0	0	0	0	0	0	0	0	0	141400	0
A0A251TTY4	A0A251TTY4_HELAN	Putative DNA-binding domain-containing protein	HannXRQ_Chr09g0251211	Helianthus annuus (Common sunflower)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	GHGNESM	tr|A0A251TTY4|A0A251TTY4_HELAN Putative DNA-binding domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0251211 PE=4 SV=1	0.88679	1.378	0	9627.4	36885	16760	19354	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9627.4	0	7962.2	0	7267.4	0	36885	0	13097	0	0	0	0	13463	0	0	0	0	16760	0	19354	0	4558.2	0	6572.7	3708.9	0	0
A0A251TUF9	A0A251TUF9_HELAN	Protein kinase domain-containing protein	HannXRQ_Chr09g0239961	Helianthus annuus (Common sunflower)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	SEGDPAK	tr|A0A251TUF9|A0A251TUF9_HELAN Protein kinase domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0239961 PE=4 SV=1;tr|A0A5N6Q0S5|A0A5N6Q0S5_9ASTR Protein kinase domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_01325 PE	0.90164	1.378	78102	0	0	62328	57815	78102	3986.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	62328	0	0	0	0	0	0	0	0	0	0	5099.5	0	0	0	57815	0	0
A0A251TV00	A0A251TV00_HELAN	Putative F-box domain-containing protein	HannXRQ_Chr09g0255091	Helianthus annuus (Common sunflower)					MSCFMCR	tr|A0A251TV00|A0A251TV00_HELAN Putative F-box domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0255091 PE=4 SV=1	0.83333	1.378	2516.9	1888.3	12988	0	0	0	0	0	0	0	2516.9	0	0	0	0	0	0	0	0	0	0	0	1888.3	0	0	0	0	12988	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251TW87	A0A251TW87_HELAN	Auxin-responsive protein	HannXRQ_Chr09g0247081	Helianthus annuus (Common sunflower)	"auxin-activated signaling pathway [GO:0009734]; regulation of transcription, DNA-templated [GO:0006355]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; auxin-activated signaling pathway [GO:0009734]; regulation of transcription, DNA-templated [GO:0006355]"		HVYIFLK	tr|A0A251TW87|A0A251TW87_HELAN Auxin-responsive protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0247081 PE=3 SV=1	0.83387	1.378	5288.4	11163	0	0	4051.6	0	0	0	0	0	0	5288.4	0	5093.2	0	0	0	0	11163	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4051.6
A0A251TYD3	A0A251TYD3_HELAN	Putative SIN-like family protein	HannXRQ_Chr09g0262111	Helianthus annuus (Common sunflower)	"transcription, DNA-templated [GO:0006351]"	RNA polymerase III complex [GO:0005666]	"RNA polymerase III complex [GO:0005666]; transcription, DNA-templated [GO:0006351]"		FKLKPAVWWGQVLVAHK	tr|A0A251TYD3|A0A251TYD3_HELAN Putative SIN-like family protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0262111 PE=4 SV=1	0.89302	1.378	12942	9110.2	9503.2	8887.1	2496	0	0	0	12942	9929.3	0	0	0	0	0	0	0	0	9110.2	0	0	0	0	0	0	0	0	0	0	0	9503.2	0	8887.1	0	0	0	0	0	0	0	0	0	0	2496	0	0	0	0	0	0
A0A251TZJ7	A0A251TZJ7_HELAN	Ppx-GppA domain-containing protein	HannXRQ_Chr09g0268291	Helianthus annuus (Common sunflower)	phosphorus metabolic process [GO:0006793]		pyrophosphatase activity [GO:0016462]; phosphorus metabolic process [GO:0006793]	pyrophosphatase activity [GO:0016462]	HVLLAIK	tr|A0A251TZJ7|A0A251TZJ7_HELAN Ppx-GppA domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0268291 PE=4 SV=1	0.8344	1.378	38107	61401	135830	47693	94797	0	0	0	0	0	38107	0	0	0	47872	59900	61401	0	0	51890	0	0	0	0	0	0	0	0	135830	0	38120	0	0	0	0	0	0	0	47693	0	0	0	0	0	40660	0	0	0	94797	0
A0A251TZT6	A0A251TZT6_HELAN	Trimethylguanosine synthase	HannXRQ_Chr09g0267541	Helianthus annuus (Common sunflower)	7-methylguanosine cap hypermethylation [GO:0036261]; 7-methylguanosine RNA capping [GO:0009452]; response to cold [GO:0009409]	nucleus [GO:0005634]	nucleus [GO:0005634]; RNA trimethylguanosine synthase activity [GO:0071164]; 7-methylguanosine cap hypermethylation [GO:0036261]; 7-methylguanosine RNA capping [GO:0009452]; response to cold [GO:0009409]	RNA trimethylguanosine synthase activity [GO:0071164]	GDDCDGM	tr|A0A251TZT6|A0A251TZT6_HELAN Trimethylguanosine synthase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0267541 PE=4 SV=1	0.83449	1.378	11562	0	0	0	0	0	11562	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251U0I4	A0A251U0I4_HELAN	Putative nucleotide-binding alpha-beta plait domain-containing protein	HannXRQ_Chr09g0271991	Helianthus annuus (Common sunflower)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	TFIAIQSSKRLIFPETR	tr|A0A251U0I4|A0A251U0I4_HELAN Putative nucleotide-binding alpha-beta plait domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0271991 PE=4 SV=1	0.87981	1.378	0	0	17430	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17430	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251U0I9	A0A251U0I9_HELAN	Putative homeodomain-like superfamily protein	HannXRQ_Chr09g0276211	Helianthus annuus (Common sunflower)	response to auxin [GO:0009733]; response to ethylene [GO:0009723]; response to gibberellin [GO:0009739]	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; response to auxin [GO:0009733]; response to ethylene [GO:0009723]; response to gibberellin [GO:0009739]	DNA binding [GO:0003677]	VPGGDGK	tr|A0A251U0I9|A0A251U0I9_HELAN Putative homeodomain-like superfamily protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0276211 PE=4 SV=1	0.83458	1.378	0	3841.5	0	6089.3	5334.8	0	0	0	0	0	0	0	0	0	0	0	0	3841.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6089.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5334.8	0
A0A251U1D2	A0A251U1D2_HELAN	UDP-arabinopyranose mutase (EC 5.4.99.30)	HannXRQ_Chr09g0273391	Helianthus annuus (Common sunflower)	plant-type cell wall biogenesis [GO:0009832]; UDP-L-arabinose metabolic process [GO:0033356]	cytosol [GO:0005829]; Golgi apparatus [GO:0005794]	cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; UDP-arabinopyranose mutase activity [GO:0052691]; plant-type cell wall biogenesis [GO:0009832]; UDP-L-arabinose metabolic process [GO:0033356]	UDP-arabinopyranose mutase activity [GO:0052691]	DCTTPQK	tr|A0A251U1D2|A0A251U1D2_HELAN UDP-arabinopyranose mutase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0273391 PE=3 SV=1;tr|A0A5N6LX61|A0A5N6LX61_9ASTR UDP-arabinopyranose mutase OS=Mikania micrantha OX=192012 GN=E3N88_39475 PE=3 SV=1	0.86667	2.1994	0	23424	15918	23809	15430	0	0	0	0	0	0	0	0	0	16778	23424	0	0	0	0	0	0	0	15224	0	0	0	0	15918	0	0	0	0	0	0	0	0	23809	0	17554	0	0	0	0	15430	0	0	0	0	0
A0A251U1E8	A0A251U1E8_HELAN	Putative P-loop containing nucleoside triphosphate hydrolase	HannXRQ_Chr09g0277431	Helianthus annuus (Common sunflower)			helicase activity [GO:0004386]; hydrolase activity [GO:0016787]; RNA binding [GO:0003723]	helicase activity [GO:0004386]; hydrolase activity [GO:0016787]; RNA binding [GO:0003723]	MNEEETR	tr|A0A251U1E8|A0A251U1E8_HELAN Putative P-loop containing nucleoside triphosphate hydrolase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0277431 PE=4 SV=1;tr|A0A5N6NMV8|A0A5N6NMV8_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_21521	0.83467	1.378	86449	0	0	0	0	86449	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251U1L5	A0A251U1L5_HELAN	Putative microsomal signal peptidase 12kDa subunit	HannXRQ_Chr08g0207731	Helianthus annuus (Common sunflower)	protein targeting to ER [GO:0045047]; signal peptide processing [GO:0006465]	integral component of endoplasmic reticulum membrane [GO:0030176]; signal peptidase complex [GO:0005787]	integral component of endoplasmic reticulum membrane [GO:0030176]; signal peptidase complex [GO:0005787]; protein targeting to ER [GO:0045047]; signal peptide processing [GO:0006465]		VQGQWDMHCR	tr|A0A251U1L5|A0A251U1L5_HELAN Putative microsomal signal peptidase 12kDa subunit OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr08g0207731 PE=3 SV=1	0.8352	1.378	0	0	7994	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7994	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251U3M3	A0A251U3M3_HELAN	"Putative metalloenzyme, LuxS/M16 peptidase-like protein"	HannXRQ_Chr08g0211591	Helianthus annuus (Common sunflower)		mitochondrion [GO:0005739]	mitochondrion [GO:0005739]; metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	DYHCTGR	"tr|A0A251U3M3|A0A251U3M3_HELAN Putative metalloenzyme, LuxS/M16 peptidase-like protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr08g0211591 PE=4 SV=1"	0.7784	1.378	0	63825	0	0	0	0	0	0	0	0	0	0	0	0	0	0	63825	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251U3Q0	A0A251U3Q0_HELAN	"Putative clathrin/coatomer adaptor, adaptin-like, Armadillo-type fold protein"	HannXRQ_Chr08g0218001	Helianthus annuus (Common sunflower)	circumnutation [GO:0010031]; intracellular protein transport [GO:0006886]; unidimensional cell growth [GO:0009826]; vesicle-mediated transport [GO:0016192]	"cortical microtubule, transverse to long axis [GO:0010005]; membrane coat [GO:0030117]"	"cortical microtubule, transverse to long axis [GO:0010005]; membrane coat [GO:0030117]; microtubule binding [GO:0008017]; circumnutation [GO:0010031]; intracellular protein transport [GO:0006886]; unidimensional cell growth [GO:0009826]; vesicle-mediated transport [GO:0016192]"	microtubule binding [GO:0008017]	IIAHIVK	"tr|A0A251U3Q0|A0A251U3Q0_HELAN Putative clathrin/coatomer adaptor, adaptin-like, Armadillo-type fold protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr08g0218001 PE=4 SV=1;tr|A0A124SF63|A0A124SF63_CYNCS Armadillo-like helical OS=Cynara cardunculus var. sc"	0.89017	1.378	129310	130320	149400	121890	161450	122040	34197	0	0	0	0	128310	129310	92914	130320	0	0	75819	0	0	0	0	121290	0	0	0	0	149400	0	0	0	0	121890	0	0	0	0	46674	0	0	0	140690	161450	68918	0	40866	0	0	0	0
A0A251U614	A0A251U614_HELAN	60S ribosomal protein L13	HannXRQ_Chr08g0226761	Helianthus annuus (Common sunflower)	translation [GO:0006412]	cytosolic large ribosomal subunit [GO:0022625]	cytosolic large ribosomal subunit [GO:0022625]; RNA binding [GO:0003723]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	RNA binding [GO:0003723]; structural constituent of ribosome [GO:0003735]	RAPFVVK	tr|A0A251U614|A0A251U614_HELAN 60S ribosomal protein L13 OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr08g0226761 PE=3 SV=1;tr|A0A5N6MWN0|A0A5N6MWN0_9ASTR 60S ribosomal protein L13 OS=Mikania micrantha OX=192012 GN=E3N88_27192 PE=3 SV=1;tr|A0A251VBD3|A0A251VB	0.77494	1.378	106200	0	0	0	0	0	0	0	0	0	0	0	106200	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251U7L6	A0A251U7L6_HELAN	Histone H2A	HannXRQ_Chr08g0227671	Helianthus annuus (Common sunflower)	chromatin silencing [GO:0006342]	nucleosome [GO:0000786]; nucleus [GO:0005634]	nucleosome [GO:0000786]; nucleus [GO:0005634]; DNA binding [GO:0003677]; protein heterodimerization activity [GO:0046982]; chromatin silencing [GO:0006342]	DNA binding [GO:0003677]; protein heterodimerization activity [GO:0046982]	RAGAAKK	tr|A0A251U7L6|A0A251U7L6_HELAN Histone H2A OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr08g0227671 PE=3 SV=1;tr|A0A6L2M8B8|A0A6L2M8B8_TANCI Histone H2A OS=Tanacetum cinerariifolium OX=118510 GN=Tci_040543 PE=3 SV=1;tr|A0A164WHA7|A0A164WHA7_DAUCS Histone H2A 	0.80434	1.378	0	0	0	4966.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4966.7	0	0	0	0	0	0	0	0	0	0
A0A251U7Q6	A0A251U7Q6_HELAN	"Putative myc-type, basic helix-loop-helix (BHLH) domain-containing protein"	HannXRQ_Chr08g0227161	Helianthus annuus (Common sunflower)		nucleus [GO:0005634]	nucleus [GO:0005634]; protein dimerization activity [GO:0046983]	protein dimerization activity [GO:0046983]	GFQSIEM	"tr|A0A251U7Q6|A0A251U7Q6_HELAN Putative myc-type, basic helix-loop-helix (BHLH) domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr08g0227161 PE=4 SV=1;tr|A0A103YKN1|A0A103YKN1_CYNCS Myc-type, basic helix-loop-helix (BHLH) domain-containi"	0.78059	1.378	0	0	34259	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34259	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251U8E6	A0A251U8E6_HELAN	Uncharacterized protein	HannXRQ_Chr08g0229761	Helianthus annuus (Common sunflower)		integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]		IPKPNEG	tr|A0A251U8E6|A0A251U8E6_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr08g0229761 PE=3 SV=1;tr|A0A251VQP3|A0A251VQP3_HELAN Putative cytochrome c oxidase assembly protein COX16 OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr01g0023971	0.88601	1.378	7929.5	6250.3	0	0	20306	0	7929.5	0	0	0	0	0	0	0	0	0	6250.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20306	0	0	0	0	0	0	0
A0A251U9T3	A0A251U9T3_HELAN	"Putative myc-type, basic helix-loop-helix (BHLH) domain, Transcription factor MYC/MYB N-terminal"	HannXRQ_Chr07g0189271	Helianthus annuus (Common sunflower)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; protein dimerization activity [GO:0046983]	DNA-binding transcription factor activity [GO:0003700]; protein dimerization activity [GO:0046983]	NQVEPPK	"tr|A0A251U9T3|A0A251U9T3_HELAN Putative myc-type, basic helix-loop-helix (BHLH) domain, Transcription factor MYC/MYB N-terminal OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr07g0189271 PE=4 SV=1"	0.89175	1.378	9171.9	14836	7876.4	12379	7263.1	9171.9	6605.6	8090.5	0	0	0	0	8150	0	0	0	14836	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7876.4	0	0	0	12379	12180	0	0	0	6351.9	0	0	0	0	0	0	7263.1	0	0
A0A251U9W4	A0A251U9W4_HELAN	Pectinesterase (EC 3.1.1.11)	RHS12 HannXRQ_Chr07g0189571	Helianthus annuus (Common sunflower)	cell wall modification [GO:0042545]; pectin catabolic process [GO:0045490]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; aspartyl esterase activity [GO:0045330]; pectinesterase activity [GO:0030599]; pectinesterase inhibitor activity [GO:0046910]; cell wall modification [GO:0042545]; pectin catabolic process [GO:0045490]	aspartyl esterase activity [GO:0045330]; pectinesterase activity [GO:0030599]; pectinesterase inhibitor activity [GO:0046910]	DGSLWEPMDDRSAVSMR	tr|A0A251U9W4|A0A251U9W4_HELAN Pectinesterase OS=Helianthus annuus OX=4232 GN=RHS12 PE=3 SV=1	0.87363	1.378	0	36658	5970.8	0	0	0	0	0	0	0	0	0	0	0	36658	0	0	0	0	0	0	0	0	0	5970.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251UBT4	A0A251UBT4_HELAN	HRDC domain-containing protein	HannXRQ_Chr07g0197171	Helianthus annuus (Common sunflower)	"exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000467]; histone mRNA catabolic process [GO:0071044]; nuclear polyadenylation-dependent antisense transcript catabolic process [GO:0071040]; nuclear polyadenylation-dependent CUT catabolic process [GO:0071039]; nuclear polyadenylation-dependent rRNA catabolic process [GO:0071035]; nuclear polyadenylation-dependent snoRNA catabolic process [GO:0071036]; nuclear polyadenylation-dependent snRNA catabolic process [GO:0071037]; nuclear polyadenylation-dependent tRNA catabolic process [GO:0071038]; nuclear retention of unspliced pre-mRNA at the site of transcription [GO:0071048]; polyadenylation-dependent snoRNA 3'-end processing [GO:0071051]"	nuclear exosome (RNase complex) [GO:0000176]; nucleolus [GO:0005730]	"nuclear exosome (RNase complex) [GO:0000176]; nucleolus [GO:0005730]; 3'-5'-exoribonuclease activity [GO:0000175]; nucleotide binding [GO:0000166]; single-stranded RNA binding [GO:0003727]; exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000467]; histone mRNA catabolic process [GO:0071044]; nuclear polyadenylation-dependent antisense transcript catabolic process [GO:0071040]; nuclear polyadenylation-dependent CUT catabolic process [GO:0071039]; nuclear polyadenylation-dependent rRNA catabolic process [GO:0071035]; nuclear polyadenylation-dependent snoRNA catabolic process [GO:0071036]; nuclear polyadenylation-dependent snRNA catabolic process [GO:0071037]; nuclear polyadenylation-dependent tRNA catabolic process [GO:0071038]; nuclear retention of unspliced pre-mRNA at the site of transcription [GO:0071048]; polyadenylation-dependent snoRNA 3'-end processing [GO:0071051]"	3'-5'-exoribonuclease activity [GO:0000175]; nucleotide binding [GO:0000166]; single-stranded RNA binding [GO:0003727]	DDAGHMK	tr|A0A251UBT4|A0A251UBT4_HELAN HRDC domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr07g0197171 PE=4 SV=1	0.89231	1.378	0	0	0	14285	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14285	0	0	0	0	0	0	0	0	0	0
A0A251UCB3	A0A251UCB3_HELAN	Phospholipase (EC 3.1.4.4)	HannXRQ_Chr07g0199221	Helianthus annuus (Common sunflower)	inositol lipid-mediated signaling [GO:0048017]; phosphatidic acid biosynthetic process [GO:0006654]; phospholipid catabolic process [GO:0009395]	plasma membrane [GO:0005886]	plasma membrane [GO:0005886]; N-acylphosphatidylethanolamine-specific phospholipase D activity [GO:0070290]; phospholipase D activity [GO:0004630]; inositol lipid-mediated signaling [GO:0048017]; phosphatidic acid biosynthetic process [GO:0006654]; phospholipid catabolic process [GO:0009395]	N-acylphosphatidylethanolamine-specific phospholipase D activity [GO:0070290]; phospholipase D activity [GO:0004630]	DGGTGPR	tr|A0A251UCB3|A0A251UCB3_HELAN Phospholipase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr07g0199221 PE=3 SV=1	0.88163	1.378	317890	605940	764100	252360	493760	151690	317890	0	284180	0	0	9208	163810	142590	0	0	0	137370	605940	290630	266970	519550	0	52970	147520	0	0	0	376110	0	401260	764100	0	252360	0	204930	157150	0	0	0	0	493760	0	80652	57812	33742	261620	122970	100570	0
A0A251UDU3	A0A251UDU3_HELAN	"Putative zinc-ribbon domain, plant"	HannXRQ_Chr07g0204951	Helianthus annuus (Common sunflower)	regulation of defense response to fungus [GO:1900150]		regulation of defense response to fungus [GO:1900150]		DSMTKRR	"tr|A0A251UDU3|A0A251UDU3_HELAN Putative zinc-ribbon domain, plant OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr07g0204951 PE=4 SV=1"	0.88618	1.378	0	0	0	21172	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21172	0	0	0	0	0	0	0	0	0	0
A0A251UGK9	A0A251UGK9_HELAN	Arginyl-tRNA--protein transferase (EC 2.3.2.8)	HannXRQ_Chr06g0172261	Helianthus annuus (Common sunflower)	protein arginylation [GO:0016598]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; arginyltransferase activity [GO:0004057]; protein arginylation [GO:0016598]	arginyltransferase activity [GO:0004057]	MFQFKFR	tr|A0A251UGK9|A0A251UGK9_HELAN Arginyl-tRNA--protein transferase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr06g0172261 PE=3 SV=1	0.89958	1.378	0	0	3417.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3417.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251UH47	A0A251UH47_HELAN	Putative phototropic-responsive NPH3 family protein	ENP HannXRQ_Chr06g0174321	Helianthus annuus (Common sunflower)	auxin transport [GO:0060918]; plant organ development [GO:0099402]; protein ubiquitination [GO:0016567]		auxin transport [GO:0060918]; plant organ development [GO:0099402]; protein ubiquitination [GO:0016567]		YERVDDCERVDNCDPLR	tr|A0A251UH47|A0A251UH47_HELAN Putative phototropic-responsive NPH3 family protein OS=Helianthus annuus OX=4232 GN=ENP PE=3 SV=1	0.90179	1.378	0	0	0	6215300	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	51290	0	0	0	6215300	0	0	0	0	0	0	0	0	0	0	0
A0A251UIE4	A0A251UIE4_HELAN	Putative RNA-binding (RRM/RBD/RNP motifs) family protein	HannXRQ_Chr06g0175781	Helianthus annuus (Common sunflower)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	GGGGDGK	tr|A0A251UIE4|A0A251UIE4_HELAN Putative RNA-binding (RRM/RBD/RNP motifs) family protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr06g0175781 PE=4 SV=1;tr|A0A2U1LT98|A0A2U1LT98_ARTAN Auxin efflux carrier component OS=Artemisia annua OX=35608 GN=CTI12_AA456	0.85535	1.378	19888	15872	19909	0	7840.6	0	0	0	0	0	0	0	0	19888	0	0	0	15872	0	0	0	0	0	0	19909	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7840.6	0	0	0	0	0	0
A0A251UJ10	A0A251UJ10_HELAN	Putative tetratricopeptide repeat (TPR)-like superfamily protein	HannXRQ_Chr06g0181561	Helianthus annuus (Common sunflower)	RNA modification [GO:0009451]	intracellular membrane-bounded organelle [GO:0043231]	intracellular membrane-bounded organelle [GO:0043231]; RNA binding [GO:0003723]; zinc ion binding [GO:0008270]; RNA modification [GO:0009451]	RNA binding [GO:0003723]; zinc ion binding [GO:0008270]	GCSCYGK	tr|A0A251UJ10|A0A251UJ10_HELAN Putative tetratricopeptide repeat (TPR)-like superfamily protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr06g0181561 PE=3 SV=1	0.89286	1.378	0	0	0	0	8264.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8264.4	0	0	0	0	0
A0A251UJ74	A0A251UJ74_HELAN	Putative WRKY domain-containing protein	HannXRQ_Chr06g0181941	Helianthus annuus (Common sunflower)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	HSACQAK	tr|A0A251UJ74|A0A251UJ74_HELAN Putative WRKY domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr06g0181941 PE=4 SV=1	0.861	1.378	0	31100	0	32311	21759	0	0	0	0	0	0	0	0	0	0	0	0	0	31100	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32311	0	0	0	0	0	0	21759	0	0	0
A0A251UJN8	A0A251UJN8_HELAN	"Putative F-box domain, Leucine-rich repeat domain, L domain-like protein"	HannXRQ_Chr06g0172661	Helianthus annuus (Common sunflower)					MVTDCEM	"tr|A0A251UJN8|A0A251UJN8_HELAN Putative F-box domain, Leucine-rich repeat domain, L domain-like protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr06g0172661 PE=4 SV=1"	0.89545	1.378	0	0	0	13621	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13621	0	0	0	0	0	0	0	0	0
A0A251ULI5	A0A251ULI5_HELAN	Putative P-loop containing nucleoside triphosphate hydrolase	HannXRQ_Chr05g0134581 HannXRQ_Chr05g0134591	Helianthus annuus (Common sunflower)			GTP binding [GO:0005525]; hydrolase activity [GO:0016787]	GTP binding [GO:0005525]; hydrolase activity [GO:0016787]	CGSERAR	tr|A0A251ULI5|A0A251ULI5_HELAN Putative P-loop containing nucleoside triphosphate hydrolase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr05g0134581 PE=4 SV=1	0.90351	1.378	15013	80974	23497	49493	10108	0	0	15013	0	0	0	0	0	0	80974	0	0	0	0	0	0	0	0	0	0	0	0	0	18292	0	23497	21530	0	23837	0	49493	0	0	0	0	0	0	0	0	0	0	0	10108	0	0
A0A251UN39	A0A251UN39_HELAN	"Putative transferase, Chloramphenicol acetyltransferase-like domain protein"	HannXRQ_Chr05g0140361	Helianthus annuus (Common sunflower)			"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	EIIDFVELHRPEPVVGR	"tr|A0A251UN39|A0A251UN39_HELAN Putative transferase, Chloramphenicol acetyltransferase-like domain protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr05g0140361 PE=3 SV=1"	0.88095	1.378	0	14429	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14429	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251UPA6	A0A251UPA6_HELAN	Glucose-6-phosphate 1-epimerase (EC 5.1.3.15)	HannXRQ_Chr05g0142271	Helianthus annuus (Common sunflower)	carbohydrate metabolic process [GO:0005975]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; carbohydrate binding [GO:0030246]; glucose-6-phosphate 1-epimerase activity [GO:0047938]; carbohydrate metabolic process [GO:0005975]	carbohydrate binding [GO:0030246]; glucose-6-phosphate 1-epimerase activity [GO:0047938]	PSPDTFK	tr|A0A251UPA6|A0A251UPA6_HELAN Glucose-6-phosphate 1-epimerase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr05g0142271 PE=3 SV=1	0.88048	1.378	0	0	12507	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12507	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251UPE7	A0A251UPE7_HELAN	Uncharacterized protein	HannXRQ_Chr05g0140101	Helianthus annuus (Common sunflower)					MPVKEKK	tr|A0A251UPE7|A0A251UPE7_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr05g0140101 PE=4 SV=1	0.884	1.378	0	0	0	1731.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1731.8	0	0	0	0	0	0	0	0	0	0
A0A251UQS1	A0A251UQS1_HELAN	Putative F-box domain-containing protein	HannXRQ_Chr05g0147061	Helianthus annuus (Common sunflower)					LHMWRYDPIERISFEMK	tr|A0A251UQS1|A0A251UQS1_HELAN Putative F-box domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr05g0147061 PE=4 SV=1	0.91406	1.378	10420	99754	0	0	5168.8	0	0	0	9407.1	0	0	10420	0	0	0	0	0	0	7169.1	0	0	0	99754	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5168.8	0	0	0	0	0	0
A0A251URZ6	A0A251URZ6_HELAN	Putative histone-lysine N-methyltransferase ASHH2	ASHH2 HannXRQ_Chr05g0149781	Helianthus annuus (Common sunflower)	"regulation of transcription, DNA-templated [GO:0006355]"	chromatin [GO:0000785]; nucleus [GO:0005634]	"chromatin [GO:0000785]; nucleus [GO:0005634]; histone methyltransferase activity (H3-K36 specific) [GO:0046975]; zinc ion binding [GO:0008270]; regulation of transcription, DNA-templated [GO:0006355]"	histone methyltransferase activity (H3-K36 specific) [GO:0046975]; zinc ion binding [GO:0008270]	LLIPKTNFKR	tr|A0A251URZ6|A0A251URZ6_HELAN Putative histone-lysine N-methyltransferase ASHH2 OS=Helianthus annuus OX=4232 GN=ASHH2 PE=4 SV=1;tr|A0A5N6N7B8|A0A5N6N7B8_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_25356 PE=4 SV=1;tr|A0A5N6N600|A0	0.85897	1.9596	0	12309	3326.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12309	0	4806	0	0	0	0	3326.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251USC1	A0A251USC1_HELAN	Putative UDP-glucuronosyl/UDP-glucosyltransferase	HannXRQ_Chr05g0156921	Helianthus annuus (Common sunflower)	carbohydrate metabolic process [GO:0005975]; lipid glycosylation [GO:0030259]		hexosyltransferase activity [GO:0016758]; UDP-glycosyltransferase activity [GO:0008194]; carbohydrate metabolic process [GO:0005975]; lipid glycosylation [GO:0030259]	hexosyltransferase activity [GO:0016758]; UDP-glycosyltransferase activity [GO:0008194]	LNLKWKK	tr|A0A251USC1|A0A251USC1_HELAN Putative UDP-glucuronosyl/UDP-glucosyltransferase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr05g0156921 PE=4 SV=1;tr|A0A6S7NZK0|A0A6S7NZK0_LACSI Glyco_transf_28 domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LO	0.78638	1.378	4437.9	0	6262	3384.5	119950	0	0	0	0	0	4437.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6262	0	0	0	0	0	0	0	3384.5	0	0	0	0	0	0	0	0	0	0	0	0	0	119950	0
A0A251USR7	A0A251USR7_HELAN	O-fucosyltransferase family protein	HannXRQ_Chr05g0146801	Helianthus annuus (Common sunflower)	fucose metabolic process [GO:0006004]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; glycosyltransferase activity [GO:0016757]; fucose metabolic process [GO:0006004]	glycosyltransferase activity [GO:0016757]	RAVQLSK	tr|A0A251USR7|A0A251USR7_HELAN O-fucosyltransferase family protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr05g0146801 PE=3 SV=1	0.88839	1.378	0	107500	68203	31709	19901	0	0	0	0	0	0	0	0	0	0	0	25730	0	0	0	30608	0	107500	0	0	0	0	0	68203	0	0	34830	0	0	0	0	31709	0	0	0	0	0	0	0	0	0	19901	0	0	0
A0A251UT13	A0A251UT13_HELAN	"Putative histidine kinase-like ATPase, C-terminal domain-containing protein"	HannXRQ_Chr05g0155621	Helianthus annuus (Common sunflower)		nucleus [GO:0005634]	nucleus [GO:0005634]; endonuclease activity [GO:0004519]; kinase activity [GO:0016301]	endonuclease activity [GO:0004519]; kinase activity [GO:0016301]	VAGSDGR	"tr|A0A251UT13|A0A251UT13_HELAN Putative histidine kinase-like ATPase, C-terminal domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr05g0155621 PE=3 SV=1"	0.88789	1.378	0	0	10807	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10807	10238	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251UTZ7	A0A251UTZ7_HELAN	Putative cupredoxin	HannXRQ_Chr05g0160141	Helianthus annuus (Common sunflower)		anchored component of plasma membrane [GO:0046658]; integral component of membrane [GO:0016021]	anchored component of plasma membrane [GO:0046658]; integral component of membrane [GO:0016021]; electron transfer activity [GO:0009055]	electron transfer activity [GO:0009055]	KVKYVLR	tr|A0A251UTZ7|A0A251UTZ7_HELAN Putative cupredoxin OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr05g0160141 PE=4 SV=1;tr|A0A166APV7|A0A166APV7_DAUCS Fatty acyl-CoA reductase OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_010366 PE=3 SV=1	0.88412	1.378	12590	13091	18606	0	8514	0	0	0	0	0	12590	0	0	0	0	4117.3	0	0	0	13091	8473.6	0	0	0	0	0	14693	18606	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6444.5	0	8514	0	0	0	0	0
A0A251UUL2	A0A251UUL2_HELAN	Putative outward rectifying potassium channel protein	KCO1 HannXRQ_Chr05g0161831	Helianthus annuus (Common sunflower)	potassium ion transmembrane transport [GO:0071805]; stabilization of membrane potential [GO:0030322]	integral component of plasma membrane [GO:0005887]; plant-type vacuole membrane [GO:0009705]	integral component of plasma membrane [GO:0005887]; plant-type vacuole membrane [GO:0009705]; potassium ion leak channel activity [GO:0022841]; potassium ion transmembrane transport [GO:0071805]; stabilization of membrane potential [GO:0030322]	potassium ion leak channel activity [GO:0022841]	EGGECAM	tr|A0A251UUL2|A0A251UUL2_HELAN Putative outward rectifying potassium channel protein OS=Helianthus annuus OX=4232 GN=KCO1 PE=3 SV=1	0.9127	1.378	0	5888.9	3220.4	0	1241.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5888.9	0	0	0	0	0	0	0	0	3220.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1241.4
A0A251UVR0	A0A251UVR0_HELAN	"Putative pseudouridine synthase, catalytic domain-containing protein"	HannXRQ_Chr04g0096321	Helianthus annuus (Common sunflower)	pseudouridine synthesis [GO:0001522]		pseudouridine synthase activity [GO:0009982]; RNA binding [GO:0003723]; pseudouridine synthesis [GO:0001522]	pseudouridine synthase activity [GO:0009982]; RNA binding [GO:0003723]	DTSGVILVTKSHKAAAK	"tr|A0A251UVR0|A0A251UVR0_HELAN Putative pseudouridine synthase, catalytic domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr04g0096321 PE=4 SV=1"	0.89908	1.378	12776	6163	6810.8	3524.3	0	0	0	0	0	0	0	12776	0	0	0	0	0	0	0	0	0	0	6163	0	0	0	0	0	0	6810.8	0	0	3524.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251V0H7	A0A251V0H7_HELAN	Transcription repressor (Ovate family protein)	HannXRQ_Chr04g0116321	Helianthus annuus (Common sunflower)	"negative regulation of transcription, DNA-templated [GO:0045892]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; negative regulation of transcription, DNA-templated [GO:0045892]"		VRFLVKK	tr|A0A251V0H7|A0A251V0H7_HELAN Transcription repressor OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr04g0116321 PE=4 SV=1	0.93793	1.378	0	15535	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15535	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251V2N6	A0A251V2N6_HELAN	Putative ubiquitin fusion degradation UFD1 family protein	HannXRQ_Chr04g0126961	Helianthus annuus (Common sunflower)	ER-associated misfolded protein catabolic process [GO:0071712]; ubiquitin-dependent ERAD pathway [GO:0030433]	VCP-NPL4-UFD1 AAA ATPase complex [GO:0034098]	VCP-NPL4-UFD1 AAA ATPase complex [GO:0034098]; polyubiquitin modification-dependent protein binding [GO:0031593]; ER-associated misfolded protein catabolic process [GO:0071712]; ubiquitin-dependent ERAD pathway [GO:0030433]	polyubiquitin modification-dependent protein binding [GO:0031593]	RALEFDM	tr|A0A251V2N6|A0A251V2N6_HELAN Putative ubiquitin fusion degradation UFD1 family protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr04g0126961 PE=3 SV=1;tr|A0A2U1NVT3|A0A2U1NVT3_ARTAN TRAF-like protein OS=Artemisia annua OX=35608 GN=CTI12_AA221170 PE=3 SV=	0.78012	1.378	24267	0	0	0	0	0	0	0	0	24267	0	15038	0	5730.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251V3N0	A0A251V3N0_HELAN	Uncharacterized protein	HannXRQ_Chr03g0062011	Helianthus annuus (Common sunflower)					DNGGGAM	tr|A0A251V3N0|A0A251V3N0_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr03g0062011 PE=4 SV=1;tr|A0A2J6KB01|A0A2J6KB01_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_7X43001 PE=4 SV=1;tr|A0A164SYV6|A0A164SYV6_DAUCS	0.79536	1.378	62422	117470	107090	113150	120330	0	0	11521	0	0	62422	0	0	0	59080	0	0	0	0	117470	62566	0	70778	0	19722	107090	66214	78019	0	0	69701	0	0	0	65075	83809	74421	63306	0	113150	0	68163	120330	0	0	52310	26674	0	0	0
A0A251V578	A0A251V578_HELAN	Putative pentatricopeptide repeat protein	HannXRQ_Chr03g0064651	Helianthus annuus (Common sunflower)					CGMLLKK	tr|A0A251V578|A0A251V578_HELAN Putative pentatricopeptide repeat protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr03g0064651 PE=4 SV=1	0.85083	1.378	22502	43892	23324	0	0	6793.4	0	22502	0	0	0	0	0	0	43892	0	0	0	0	0	0	0	0	0	6329.8	0	0	0	0	23324	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251V5N6	A0A251V5N6_HELAN	Uncharacterized protein	HannXRQ_Chr03g0069851	Helianthus annuus (Common sunflower)					HGCGSDR	tr|A0A251V5N6|A0A251V5N6_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr03g0069851 PE=4 SV=1	0.91057	1.378	0	0	0	228530	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	213490	0	0	228530	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251V752	A0A251V752_HELAN	Putative P-loop containing nucleoside triphosphate hydrolase	HannXRQ_Chr03g0064671	Helianthus annuus (Common sunflower)			glycosyltransferase activity [GO:0016757]; hydrolase activity [GO:0016787]	glycosyltransferase activity [GO:0016757]; hydrolase activity [GO:0016787]	NNQRVEEIRQMCHIALK	tr|A0A251V752|A0A251V752_HELAN Putative P-loop containing nucleoside triphosphate hydrolase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr03g0064671 PE=4 SV=1	0.90909	1.378	0	0	0	15449	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15449	0	0	0	0	0	0	0	0	0
A0A251V780	A0A251V780_HELAN	Diacylglycerol kinase (DAG kinase) (EC 2.7.1.107)	ATDGK3 HannXRQ_Chr03g0065011	Helianthus annuus (Common sunflower)	defense response [GO:0006952]; protein kinase C-activating G protein-coupled receptor signaling pathway [GO:0007205]	plasma membrane [GO:0005886]	plasma membrane [GO:0005886]; ATP binding [GO:0005524]; diacylglycerol kinase activity [GO:0004143]; NAD+ kinase activity [GO:0003951]; defense response [GO:0006952]; protein kinase C-activating G protein-coupled receptor signaling pathway [GO:0007205]	ATP binding [GO:0005524]; diacylglycerol kinase activity [GO:0004143]; NAD+ kinase activity [GO:0003951]	CMSEVWR	tr|A0A251V780|A0A251V780_HELAN Diacylglycerol kinase OS=Helianthus annuus OX=4232 GN=ATDGK3 PE=3 SV=1	0.85841	1.3875	0	0	0	1020.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1020.1	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251V8T1	A0A251V8T1_HELAN	Protein kinase domain-containing protein	HannXRQ_Chr03g0081541	Helianthus annuus (Common sunflower)	protein autophosphorylation [GO:0046777]	plasma membrane [GO:0005886]; plasmodesma [GO:0009506]	plasma membrane [GO:0005886]; plasmodesma [GO:0009506]; ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; protein autophosphorylation [GO:0046777]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	SSSAYDK	tr|A0A251V8T1|A0A251V8T1_HELAN Protein kinase domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr03g0081541 PE=4 SV=1	0.93382	1.378	4985.1	0	0	24998	0	0	0	0	4985.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2293.3	0	0	24998	0	0	0	0	0	0	0	0	0	0
A0A251VAB9	A0A251VAB9_HELAN	Putative cytochrome P450	HannXRQ_Chr03g0088021	Helianthus annuus (Common sunflower)			"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	NMRKILVSQVMSNASLK	tr|A0A251VAB9|A0A251VAB9_HELAN Putative cytochrome P450 OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr03g0088021 PE=3 SV=1	0.87603	1.378	0	0	19843	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19843	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251VAC5	A0A251VAC5_HELAN	"Putative myb/SANT-like domain, Harbinger transposase-derived nuclease domain protein"	HannXRQ_Chr03g0088121	Helianthus annuus (Common sunflower)			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	ECSVHLR	"tr|A0A251VAC5|A0A251VAC5_HELAN Putative myb/SANT-like domain, Harbinger transposase-derived nuclease domain protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr03g0088121 PE=3 SV=1;tr|A0A6S7M5D0|A0A6S7M5D0_LACSI DDE Tnp4 domain-containing protein OS=Lactuca"	0.9	2.756	0	0	0	29652	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22588	0	0	0	29652	0	0	0	0	0	0	0	0	0
A0A251VAN1	A0A251VAN1_HELAN	"Putative zinc finger, CCHC-type, Gag-polypeptide of LTR copia-type"	HannXRQ_Chr03g0078371	Helianthus annuus (Common sunflower)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	VSCGGEH	"tr|A0A251VAN1|A0A251VAN1_HELAN Putative zinc finger, CCHC-type, Gag-polypeptide of LTR copia-type OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr03g0078371 PE=4 SV=1"	0.90244	1.378	40654	76082	0	24104	19744	0	37559	0	40654	0	0	0	0	0	0	0	0	23645	0	76082	0	0	0	0	0	0	0	0	0	0	0	0	24104	0	0	0	0	0	0	0	0	0	0	19744	0	0	0	0	0	0
A0A251VBI8	A0A251VBI8_HELAN	Putative gnk2-like domain-containing protein	HannXRQ_Chr03g0081921	Helianthus annuus (Common sunflower)					SVDGGGLSGG	tr|A0A251VBI8|A0A251VBI8_HELAN Putative gnk2-like domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr03g0081921 PE=4 SV=1	0.89683	1.378	712720	51261	662960	1029600	28640	25511	35442	712720	0	0	535340	78998	23415	34356	0	0	0	24585	48134	0	0	0	51261	36847	132480	0	0	0	0	111200	94228	662960	1029600	623870	0	0	0	0	0	0	0	0	0	10657	0	0	28640	0	15845	0
A0A251VD76	A0A251VD76_HELAN	Uncharacterized protein	HannXRQ_Chr02g0036071	Helianthus annuus (Common sunflower)					THGNTST	tr|A0A251VD76|A0A251VD76_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr02g0036071 PE=4 SV=1	0.87059	1.378	1908900	835620	1416700	672280	1291800	0	886740	0	881890	912310	244050	807940	1908900	0	0	0	0	9177.7	835620	0	0	0	0	0	0	0	0	1416700	0	0	632000	0	672280	0	0	0	0	0	0	0	0	0	1291800	0	0	0	151320	428020	513700	0
A0A251VF81	A0A251VF81_HELAN	"Putative late embryogenesis abundant protein, group 1 protein"	LEA18 HannXRQ_Chr02g0043531	Helianthus annuus (Common sunflower)	embryo development ending in seed dormancy [GO:0009793]		embryo development ending in seed dormancy [GO:0009793]		RAQHAIK	"tr|A0A251VF81|A0A251VF81_HELAN Putative late embryogenesis abundant protein, group 1 protein OS=Helianthus annuus OX=4232 GN=LEA18 PE=3 SV=1;tr|A0A251VAF5|A0A251VAF5_HELAN Putative late embryogenesis abundant protein, group 1 protein OS=Helianthus annuus O"	0.81139	1.378	0	3607.3	3258.7	6367	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3607.3	0	0	0	0	0	3258.7	0	0	0	0	0	0	0	0	0	0	0	0	0	6367	0	0	0	0	0	0	0	0	0	0
A0A251VGV8	A0A251VGV8_HELAN	Uncharacterized protein	HannXRQ_Chr02g0040091	Helianthus annuus (Common sunflower)					FNLDVPFSKKVLMLHQK	tr|A0A251VGV8|A0A251VGV8_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr02g0040091 PE=4 SV=1	0.88693	1.378	28064	7394.3	0	0	3977.1	0	0	0	6664.4	3690.8	0	28064	0	0	0	0	0	0	7394.3	0	0	0	7178.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3977.1
A0A251VHW1	A0A251VHW1_HELAN	Putative C2H2 and C2HC zinc fingers superfamily protein	STOP1 HannXRQ_Chr02g0044131	Helianthus annuus (Common sunflower)	response to acidic pH [GO:0010447]; response to aluminum ion [GO:0010044]		response to acidic pH [GO:0010447]; response to aluminum ion [GO:0010044]		GHGDEYK	tr|A0A251VHW1|A0A251VHW1_HELAN Putative C2H2 and C2HC zinc fingers superfamily protein OS=Helianthus annuus OX=4232 GN=STOP1 PE=4 SV=1;tr|A0A2U1PNU9|A0A2U1PNU9_ARTAN C2H2 and C2HC zinc fingers superfamily protein OS=Artemisia annua OX=35608 GN=CTI12_AA1311	0.87392	1.378	0	23813	0	0	0	0	0	0	0	0	0	0	0	0	0	23813	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251VKL2	A0A251VKL2_HELAN	"Putative zinc finger, PHD-type"	HannXRQ_Chr02g0054741	Helianthus annuus (Common sunflower)	intracellular signal transduction [GO:0035556]		metal ion binding [GO:0046872]; intracellular signal transduction [GO:0035556]	metal ion binding [GO:0046872]	KIPLLLAR	"tr|A0A251VKL2|A0A251VKL2_HELAN Putative zinc finger, PHD-type OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr02g0054741 PE=4 SV=1"	0.88983	1.378	10435000	16796000	11505000	4924900	8647800	5818900	6453900	10435000	3339100	10416000	3251800	2920100	4549300	5276700	281120	0	0	48067	16796000	9889900	8005600	3574100	10421000	1540000	45121	3423000	6804900	9728200	9823000	208340	5829600	11505000	4924900	3778100	4399500	86009	4879.9	13919	0	0	22207	0	8647800	103180	1649400	487590	2013600	1590500	3425500	600780
A0A251VLE5	A0A251VLE5_HELAN	Uncharacterized protein	HannXRQ_Chr01g0007471	Helianthus annuus (Common sunflower)					HGPNNPK	tr|A0A251VLE5|A0A251VLE5_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr01g0007471 PE=4 SV=1	0.8626	1.378	0	0	0	0	4384	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4384
A0A251VNX6	A0A251VNX6_HELAN	Putative tetratricopeptide repeat (TPR)-like superfamily protein	OTP81 HannXRQ_Chr01g0011401	Helianthus annuus (Common sunflower)			zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	ARFHRFR	tr|A0A251VNX6|A0A251VNX6_HELAN Putative tetratricopeptide repeat (TPR)-like superfamily protein OS=Helianthus annuus OX=4232 GN=OTP81 PE=3 SV=1	0.86087	1.378	23302	25863	5773.1	0	0	0	0	0	3482.7	0	0	23302	0	3573.9	0	0	0	10610	0	0	0	25863	0	0	5773.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251VSC1	A0A251VSC1_HELAN	"Putative calmodulin binding,transcription regulator"	HannXRQ_Chr01g0029901	Helianthus annuus (Common sunflower)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	nucleus [GO:0005634]; calmodulin binding [GO:0005516]; double-stranded DNA binding [GO:0003690]; transcription coregulator activity [GO:0003712]; regulation of transcription by RNA polymerase II [GO:0006357]	calmodulin binding [GO:0005516]; double-stranded DNA binding [GO:0003690]; transcription coregulator activity [GO:0003712]	DENQEDNGEEGFFHASR	"tr|A0A251VSC1|A0A251VSC1_HELAN Putative calmodulin binding,transcription regulator OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr01g0029901 PE=3 SV=1"	0.86034	1.378	7128.9	16163	65162	0	4592.8	0	7128.9	0	0	0	0	0	0	0	4863.3	0	16163	0	0	0	0	0	0	3961	8572.9	0	0	0	12649	0	0	65162	0	0	0	0	0	0	0	0	0	0	0	0	0	2301.1	0	0	4592.8	0
A0A251VSP4	A0A251VSP4_HELAN	Uncharacterized protein	HannXRQ_Chr01g0028971	Helianthus annuus (Common sunflower)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		PKLIGRR	tr|A0A251VSP4|A0A251VSP4_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr01g0028971 PE=4 SV=1;tr|A0A5N6P1D7|A0A5N6P1D7_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_14430 PE=4 SV=1;tr|A0A5N6LB75|A0A5N6LB75_9	0.79824	1.378	0	2378.1	0	0	0	0	0	0	0	0	0	0	0	0	2378.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A251VT03	A0A251VT03_HELAN	Uncharacterized protein	HannXRQ_Chr01g0023571	Helianthus annuus (Common sunflower)					VDSGNDR	tr|A0A251VT03|A0A251VT03_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr01g0023571 PE=4 SV=1	0.93662	1.378	15715	101060	0	124080	4364.4	0	15715	0	0	0	0	0	0	0	0	0	101060	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	124080	0	0	0	0	0	0	0	0	0	0	4364.4	0	0
A5JQV7	A5JQV7_HELAN	NBS-LRR resistance-like protein RGC315 (Fragment)		Helianthus annuus (Common sunflower)			ADP binding [GO:0043531]	ADP binding [GO:0043531]	SECRLTR	tr|A5JQV7|A5JQV7_HELAN NBS-LRR resistance-like protein RGC315 (Fragment) OS=Helianthus annuus OX=4232 PE=4 SV=1	0.93105	1.378	178520	129000	211280	197490	209800	16233	41717	0	18384	0	178520	0	0	0	0	0	129000	40916	0	0	0	0	0	0	0	0	0	0	0	211280	163810	31481	0	0	0	0	0	0	0	0	197490	0	0	0	0	0	209800	0	0	0
O65353	RL5_HELAN	60S ribosomal protein L5	RPL5A	Helianthus annuus (Common sunflower)	translation [GO:0006412]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; ribosome [GO:0005840]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; ribosome [GO:0005840]; 5S rRNA binding [GO:0008097]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	5S rRNA binding [GO:0008097]; structural constituent of ribosome [GO:0003735]	GFVKVVK	sp|O65353|RL5_HELAN 60S ribosomal protein L5 OS=Helianthus annuus OX=4232 GN=RPL5A PE=2 SV=1	0.80459	1.378	0	0	0	0	6143.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6143.3	0	0	0
A5JRX6	A5JRX6_9ASTR	NBS-LRR resistance-like protein RGC684 (Fragment)		Helianthus paradoxus			ADP binding [GO:0043531]	ADP binding [GO:0043531]	VHTLLLK	tr|A5JRX6|A5JRX6_9ASTR NBS-LRR resistance-like protein RGC684 (Fragment) OS=Helianthus paradoxus OX=73304 PE=4 SV=1;tr|A5JRV6|A5JRV6_9ASTR NBS-LRR resistance-like protein RGC664 (Fragment) OS=Helianthus paradoxus OX=73304 PE=4 SV=1;tr|A5JRT9|A5JRT9_9ASTR N	0.93061	1.378	0	0	0	0	2579.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2579.1	0	0	0	0	0	0
D0V1M8	D0V1M8_HIEPI	DNA (cytosine-5)-methyltransferase (EC 2.1.1.37)	MET1	Hieracium piloselloides (King devil hawkweed)	chromatin organization [GO:0006325]	nucleus [GO:0005634]	nucleus [GO:0005634]; chromatin binding [GO:0003682]; DNA (cytosine-5-)-methyltransferase activity [GO:0003886]; DNA binding [GO:0003677]; chromatin organization [GO:0006325]	chromatin binding [GO:0003682]; DNA (cytosine-5-)-methyltransferase activity [GO:0003886]; DNA binding [GO:0003677]	LINVPLK	tr|D0V1M8|D0V1M8_HIEPI DNA (cytosine-5)-methyltransferase OS=Hieracium piloselloides OX=102746 GN=MET1 PE=2 SV=1;tr|A0A2J6KMJ8|A0A2J6KMJ8_LACSA DNA (cytosine-5)-methyltransferase OS=Lactuca sativa OX=4236 GN=LSAT_7X75121 PE=3 SV=1;tr|A0A5N6NUJ4|A0A5N6NUJ4_	0.83847	1.378	0	0	7235.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7235.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7KMJ6	A0A6S7KMJ6_LACSI	Uncharacterized protein	LSAL_LOCUS876	Lactuca saligna (Willowleaf lettuce)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	LKIIVHV	tr|A0A6S7KMJ6|A0A6S7KMJ6_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS876 PE=4 SV=1	0.79549	1.378	13666	0	0	0	0	0	13666	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7KMP9	A0A6S7KMP9_LACSI	Uncharacterized protein	LSAL_LOCUS944	Lactuca saligna (Willowleaf lettuce)					RRGLPPK	tr|A0A6S7KMP9|A0A6S7KMP9_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS944 PE=4 SV=1	0.79511	1.378	2263.7	0	0	0	0	0	0	2263.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7KN12	A0A6S7KN12_LACSI	Uncharacterized protein	LSAL_LOCUS702	Lactuca saligna (Willowleaf lettuce)					EFYSEMR	tr|A0A6S7KN12|A0A6S7KN12_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS702 PE=4 SV=1	0.92563	1.378	8181.5	0	0	0	0	0	0	0	0	0	0	8181.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7KQ61	A0A6S7KQ61_LACSI	Trafficking protein particle complex subunit	LSAL_LOCUS1962 LSAL_LOCUS23147	Lactuca saligna (Willowleaf lettuce)	Golgi vesicle transport [GO:0048193]	endoplasmic reticulum [GO:0005783]; Golgi apparatus [GO:0005794]; TRAPP complex [GO:0030008]	endoplasmic reticulum [GO:0005783]; Golgi apparatus [GO:0005794]; TRAPP complex [GO:0030008]; Golgi vesicle transport [GO:0048193]		MAPAVPR	tr|A0A6S7KQ61|A0A6S7KQ61_LACSI Trafficking protein particle complex subunit OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS1962 PE=3 SV=1;tr|A0A6S7NZG4|A0A6S7NZG4_LACSI Trafficking protein particle complex subunit OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS34161 P	0.87468	1.378	19909	0	0	0	0	0	0	0	0	0	0	0	0	19909	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7KQN7	A0A6S7KQN7_LACSI	Uncharacterized protein	LSAL_LOCUS103	Lactuca saligna (Willowleaf lettuce)					SRGPCGR	tr|A0A6S7KQN7|A0A6S7KQN7_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS103 PE=4 SV=1	0.92694	1.378	0	0	0	0	385210	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	385210	0	0
A0A6S7KR54	A0A6S7KR54_LACSI	HCO3_cotransp domain-containing protein	LSAL_LOCUS1291	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; 3-dehydroquinate dehydratase activity [GO:0003855]; inorganic anion exchanger activity [GO:0005452]	3-dehydroquinate dehydratase activity [GO:0003855]; inorganic anion exchanger activity [GO:0005452]	KDPVMAM	tr|A0A6S7KR54|A0A6S7KR54_LACSI HCO3_cotransp domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS1291 PE=3 SV=1	0.92397	1.378	0	0	0	0	290880	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	290880	0	0
A0A6S7KWT8	A0A6S7KWT8_LACSI	Uncharacterized protein	LSAL_LOCUS952	Lactuca saligna (Willowleaf lettuce)	aromatic amino acid family biosynthetic process [GO:0009073]; cellular amino acid biosynthetic process [GO:0008652]		3-dehydroquinate synthase activity [GO:0003856]; oxidoreductase activity [GO:0016491]; aromatic amino acid family biosynthetic process [GO:0009073]; cellular amino acid biosynthetic process [GO:0008652]	3-dehydroquinate synthase activity [GO:0003856]; oxidoreductase activity [GO:0016491]	IAAINMQWQNHIHRHPR	tr|A0A6S7KWT8|A0A6S7KWT8_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS952 PE=4 SV=1	0.91613	1.378	0	46889	0	0	0	0	0	0	0	0	0	0	0	0	0	46889	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7KXB6	A0A6S7KXB6_LACSI	Uncharacterized protein	LSAL_LOCUS236	Lactuca saligna (Willowleaf lettuce)					SSLLLKK	tr|A0A6S7KXB6|A0A6S7KXB6_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS236 PE=4 SV=1;tr|A0A2U1N569|A0A2U1N569_ARTAN DUF659 domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA306470 PE=4 SV=1	0.8025	1.378	0	0	6018.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6018.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7KY04	A0A6S7KY04_LACSI	Uncharacterized protein	LSAL_LOCUS3992	Lactuca saligna (Willowleaf lettuce)			"heme binding [GO:0020037]; hydrolase activity, acting on ester bonds [GO:0016788]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; hydrolase activity, acting on ester bonds [GO:0016788]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	SYTAYGK	tr|A0A6S7KY04|A0A6S7KY04_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS3992 PE=3 SV=1	0.79472	1.378	0	0	208410	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	208410	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7KYJ9	A0A6S7KYJ9_LACSI	Uncharacterized protein	LSAL_LOCUS5143	Lactuca saligna (Willowleaf lettuce)					AEARTWK	tr|A0A6S7KYJ9|A0A6S7KYJ9_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS5143 PE=4 SV=1	0.79434	1.378	0	16738	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16738	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7L0N7	A0A6S7L0N7_LACSI	Uncharacterized protein	LSAL_LOCUS5888	Lactuca saligna (Willowleaf lettuce)					PGGGGGK	tr|A0A6S7L0N7|A0A6S7L0N7_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS5888 PE=4 SV=1	0.92228	1.378	42163	32576	81672	30065	15297	0	0	0	0	0	42163	0	0	0	16993	24277	5892.4	8102.9	0	0	32576	0	0	2271.6	0	24093	43298	81672	0	0	0	0	0	0	30065	0	0	18803	6017.4	0	7113.1	0	0	0	5059.3	0	0	15297	0	0
A0A6S7L0Q4	A0A6S7L0Q4_LACSI	Cullin domain-containing protein	LSAL_LOCUS4979	Lactuca saligna (Willowleaf lettuce)	ubiquitin-dependent protein catabolic process [GO:0006511]		ubiquitin protein ligase binding [GO:0031625]; ubiquitin-dependent protein catabolic process [GO:0006511]	ubiquitin protein ligase binding [GO:0031625]	FAAHIGR	tr|A0A6S7L0Q4|A0A6S7L0Q4_LACSI Cullin domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS4979 PE=3 SV=1	0.92884	1.378	0	0	0	9016.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9016.2	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7L239	A0A6S7L239_LACSI	SWIRM domain-containing protein	LSAL_LOCUS3026	Lactuca saligna (Willowleaf lettuce)	chromatin organization [GO:0006325]		oxidoreductase activity [GO:0016491]; chromatin organization [GO:0006325]	oxidoreductase activity [GO:0016491]	ASETTEM	tr|A0A6S7L239|A0A6S7L239_LACSI SWIRM domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS3026 PE=3 SV=1;tr|A0A6S7LYB8|A0A6S7LYB8_LACSI SWIRM domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS3026 PE=3 SV=1;tr|A0A103Y3G8|A0A1	0.79991	1.378	0	14009	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14009	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7L2A2	A0A6S7L2A2_LACSI	Uncharacterized protein	LSAL_LOCUS2148	Lactuca saligna (Willowleaf lettuce)					NQDFNDD	tr|A0A6S7L2A2|A0A6S7L2A2_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS2148 PE=4 SV=1	0.79358	1.378	0	0	7263.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7263.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7L441	A0A6S7L441_LACSI	zf-4CXXC_R1 domain-containing protein	LSAL_LOCUS7124	Lactuca saligna (Willowleaf lettuce)	autophagy [GO:0006914]; COPII vesicle coating [GO:0048208]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; autophagy [GO:0006914]; COPII vesicle coating [GO:0048208]		LTKKIAM	tr|A0A6S7L441|A0A6S7L441_LACSI zf-4CXXC_R1 domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS7124 PE=4 SV=1	0.7932	1.378	0	7296.2	0	0	7373.3	0	0	0	0	0	0	0	0	0	7296.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7373.3	0	0
A0A6S7L4K9	A0A6S7L4K9_LACSI	1-phosphatidylinositol-3-phosphate 5-kinase (EC 2.7.1.150)	LSAL_LOCUS7300	Lactuca saligna (Willowleaf lettuce)			1-phosphatidylinositol-3-phosphate 5-kinase activity [GO:0000285]; ATP binding [GO:0005524]	1-phosphatidylinositol-3-phosphate 5-kinase activity [GO:0000285]; ATP binding [GO:0005524]	MDIPVKK	tr|A0A6S7L4K9|A0A6S7L4K9_LACSI 1-phosphatidylinositol-3-phosphate 5-kinase OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS7300 PE=4 SV=1	0.79282	1.378	0	0	220140	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	220140	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7L518	A0A6S7L518_LACSI	Uncharacterized protein	LSAL_LOCUS4055	Lactuca saligna (Willowleaf lettuce)					LFVAYSR	tr|A0A6S7L518|A0A6S7L518_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS4055 PE=4 SV=1	0.92946	1.378	13900	9842.3	0	0	10533	0	0	0	0	10892	0	13900	0	9008.8	0	0	0	0	9742.1	0	0	9842.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10533	0	0	0	0	9987.2	9961
A0A6S7L7H7	A0A6S7L7H7_LACSI	Uncharacterized protein	LSAL_LOCUS2218	Lactuca saligna (Willowleaf lettuce)					NQNTNTNTKLNKFVCSK	tr|A0A6S7L7H7|A0A6S7L7H7_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS2218 PE=4 SV=1	0.91667	1.378	0	0	0	64874	2965.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	44812	64874	0	0	0	2965.6	0	0	0	0	0
A0A6S7L949	A0A6S7L949_LACSI	Uncharacterized protein	LSAL_LOCUS8934	Lactuca saligna (Willowleaf lettuce)					TFYPLMK	tr|A0A6S7L949|A0A6S7L949_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS8934 PE=4 SV=1	0.94327	1.378	0	38101	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38101	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7L9Q0	A0A6S7L9Q0_LACSI	FAD-binding PCMH-type domain-containing protein	LSAL_LOCUS3129	Lactuca saligna (Willowleaf lettuce)			FAD binding [GO:0071949]; oxidoreductase activity [GO:0016491]	FAD binding [GO:0071949]; oxidoreductase activity [GO:0016491]	SAFVNYR	tr|A0A6S7L9Q0|A0A6S7L9Q0_LACSI FAD-binding PCMH-type domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS3129 PE=3 SV=1	0.78792	1.378	4737.4	0	0	0	0	0	0	0	0	0	4737.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7LAP1	A0A6S7LAP1_LACSI	FIST_C domain-containing protein	LSAL_LOCUS7809	Lactuca saligna (Willowleaf lettuce)					GDKKEVYGGLVFTCCGR	tr|A0A6S7LAP1|A0A6S7LAP1_LACSI FIST_C domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS7809 PE=4 SV=1	0.91083	1.378	0	0	0	64697	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	64697	38614	0	0	0	0	0	0	0	0	0	0
A0A6S7LB43	A0A6S7LB43_LACSI	Uncharacterized protein	LSAL_LOCUS9615	Lactuca saligna (Willowleaf lettuce)					YSTLYRK	tr|A0A6S7LB43|A0A6S7LB43_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS9615 PE=4 SV=1;tr|A0A2J6L2T5|A0A2J6L2T5_LACSA Protein kinase domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_1X89581 PE=3 SV=1	0.86415	1.378	7455.5	0	0	0	0	0	0	0	7455.5	6212.1	0	0	0	4004.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7LB92	A0A6S7LB92_LACSI	Glutamate N-acetyltransferase (EC 2.3.1.35)	LSAL_LOCUS8039	Lactuca saligna (Willowleaf lettuce)	arginine biosynthetic process [GO:0006526]		glutamate N-acetyltransferase activity [GO:0004358]; arginine biosynthetic process [GO:0006526]	glutamate N-acetyltransferase activity [GO:0004358]	GVVVHVM	tr|A0A6S7LB92|A0A6S7LB92_LACSI Glutamate N-acetyltransferase OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS8039 PE=3 SV=1	0.94283	1.378	0	0	0	24376	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24376	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7LBJ9	A0A6S7LBJ9_LACSI	NB-ARC domain-containing protein	LSAL_LOCUS9799	Lactuca saligna (Willowleaf lettuce)			ADP binding [GO:0043531]	ADP binding [GO:0043531]	SPNNGGR	tr|A0A6S7LBJ9|A0A6S7LBJ9_LACSI NB-ARC domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS9799 PE=4 SV=1	0.94503	1.378	220590	0	0	0	0	0	0	0	0	0	0	0	220590	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7LCH3	A0A6S7LCH3_LACSI	Uncharacterized protein	LSAL_LOCUS10129	Lactuca saligna (Willowleaf lettuce)					DKGVVVYAYNYDDDDDD	tr|A0A6S7LCH3|A0A6S7LCH3_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS10129 PE=4 SV=1	0.90506	1.378	0	0	26322	40554	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26322	0	0	0	31898	0	0	0	40554	0	0	0	0	0	0	0	0	0	0
A0A6S7LDK3	A0A6S7LDK3_LACSI	PGG domain-containing protein	LSAL_LOCUS6134	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		LLLQLVK	tr|A0A6S7LDK3|A0A6S7LDK3_LACSI PGG domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS6134 PE=4 SV=1	0.94645	1.378	3773.3	0	3312	6652.9	0	0	0	0	0	0	0	0	0	3773.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3312	0	0	0	0	6652.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7LEF8	A0A6S7LEF8_LACSI	Uncharacterized protein	LSAL_LOCUS7055	Lactuca saligna (Willowleaf lettuce)					KPRSEGEM	tr|A0A6S7LEF8|A0A6S7LEF8_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS7055 PE=4 SV=1	0.86364	2.2154	23784	784080	500340	456540	11473	0	23784	12277	0	0	0	0	0	0	16225	0	0	29335	0	0	0	0	784080	0	500340	0	0	0	0	0	0	0	0	0	0	0	17181	0	0	0	456540	0	0	0	0	3199.1	7958.1	11473	5780.5	0
A0A6S7LEV6	A0A6S7LEV6_LACSI	Uncharacterized protein	LSAL_LOCUS7213	Lactuca saligna (Willowleaf lettuce)					VIALILG	tr|A0A6S7LEV6|A0A6S7LEV6_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS7213 PE=4 SV=1	0.79169	1.378	0	7640.5	0	1753.2	0	0	0	0	0	0	0	0	0	0	0	0	0	7640.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1753.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7LFH8	A0A6S7LFH8_LACSI	H15 domain-containing protein	LSAL_LOCUS7450	Lactuca saligna (Willowleaf lettuce)	nucleosome assembly [GO:0006334]	nucleosome [GO:0000786]; nucleus [GO:0005634]	nucleosome [GO:0000786]; nucleus [GO:0005634]; DNA binding [GO:0003677]; nucleosome assembly [GO:0006334]	DNA binding [GO:0003677]	KAPAVVK	tr|A0A6S7LFH8|A0A6S7LFH8_LACSI H15 domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS7450 PE=3 SV=1	0.94562	1.378	9017.1	6359.2	0	0	0	0	0	0	9017.1	7510.7	0	0	0	0	0	0	0	0	6359.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7LFZ3	A0A6S7LFZ3_LACSI	Uncharacterized protein	LSAL_LOCUS10348	Lactuca saligna (Willowleaf lettuce)					LLAVLIF	tr|A0A6S7LFZ3|A0A6S7LFZ3_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS10348 PE=4 SV=1	0.79131	1.378	35817	0	0	5326	9008.3	0	0	0	4041.2	0	0	35817	0	5273	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5326	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9008.3
A0A6S7LJP5	A0A6S7LJP5_LACSI	Uncharacterized protein	LSAL_LOCUS8855	Lactuca saligna (Willowleaf lettuce)					IVNGSQR	tr|A0A6S7LJP5|A0A6S7LJP5_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS8855 PE=4 SV=1	0.79093	1.378	0	0	7853.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7853.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7LKE3	A0A6S7LKE3_LACSI	Protein FAR1-RELATED SEQUENCE	LSAL_LOCUS9326	Lactuca saligna (Willowleaf lettuce)	"regulation of transcription, DNA-templated [GO:0006355]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; zinc ion binding [GO:0008270]; regulation of transcription, DNA-templated [GO:0006355]"	zinc ion binding [GO:0008270]	QNIGALR	tr|A0A6S7LKE3|A0A6S7LKE3_LACSI Protein FAR1-RELATED SEQUENCE OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS9326 PE=3 SV=1	0.79055	1.378	0	0	0	0	3828.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3828.6
A0A6S7LKR1	A0A6S7LKR1_LACSI	KH domain-containing protein	LSAL_LOCUS7996	Lactuca saligna (Willowleaf lettuce)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	GADFSDK	tr|A0A6S7LKR1|A0A6S7LKR1_LACSI KH domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS7996 PE=4 SV=1;tr|A0A6L2K987|A0A6L2K987_TANCI Activating signal cointegrator 1 complex subunit 1 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_017265 PE=4 	0.88756	1.378	2188.7	2360.8	0	0	0	0	0	0	0	2188.7	0	0	0	0	2360.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7LLA5	A0A6S7LLA5_LACSI	Cytochrome b561 domain-containing protein	LSAL_LOCUS9851	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VHQLPGM	tr|A0A6S7LLA5|A0A6S7LLA5_LACSI Cytochrome b561 domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS9851 PE=4 SV=1	0.94053	1.378	0	0	0	0	139650	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	139650	0
A0A6S7LM87	A0A6S7LM87_LACSI	Uncharacterized protein	LSAL_LOCUS11049	Lactuca saligna (Willowleaf lettuce)	chromatin silencing [GO:0006342]		chromatin silencing [GO:0006342]		IQIRAPK	tr|A0A6S7LM87|A0A6S7LM87_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS11049 PE=4 SV=1	0.93755	1.378	0	21513	0	38689	15151	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21513	0	0	0	0	0	0	0	0	0	0	10438	0	0	0	0	0	0	17070	38689	0	0	15151	0	0	0	0	0	0
A0A6S7LMP2	A0A6S7LMP2_LACSI	Uncharacterized protein	LSAL_LOCUS9250	Lactuca saligna (Willowleaf lettuce)					MSNLWDK	tr|A0A6S7LMP2|A0A6S7LMP2_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS9250 PE=4 SV=1	0.7898	1.378	410230	0	0	0	0	0	0	0	0	348690	0	0	410230	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7LP46	A0A6S7LP46_LACSI	NB-ARC domain-containing protein	LSAL_LOCUS10619	Lactuca saligna (Willowleaf lettuce)			ADP binding [GO:0043531]	ADP binding [GO:0043531]	LSHVWKCNWNEFLLLHR	tr|A0A6S7LP46|A0A6S7LP46_LACSI NB-ARC domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS10619 PE=4 SV=1;tr|A0A6S7LMB3|A0A6S7LMB3_LACSI NB-ARC domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS10619 PE=4 SV=1	0.92208	1.378	20923	0	23872	23701	17198	0	0	0	0	0	20923	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23872	0	0	0	0	0	0	0	23701	0	0	0	13041	0	0	0	0	0	17198	0	0	0	0	0
A0A6S7LW95	A0A6S7LW95_LACSI	Uncharacterized protein	LSAL_LOCUS689	Lactuca saligna (Willowleaf lettuce)					LPKLLSK	tr|A0A6S7LW95|A0A6S7LW95_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS689 PE=4 SV=1	0.78942	1.378	0	0	25057	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25057	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7LXL3	A0A6S7LXL3_LACSI	NB-ARC domain-containing protein	LSAL_LOCUS2091	Lactuca saligna (Willowleaf lettuce)			ADP binding [GO:0043531]	ADP binding [GO:0043531]	ESILEEM	tr|A0A6S7LXL3|A0A6S7LXL3_LACSI NB-ARC domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS2091 PE=4 SV=1	0.94115	1.378	142550	0	0	0	0	0	0	0	0	0	0	142550	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7LXL8	A0A6S7LXL8_LACSI	Uncharacterized protein	LSAL_LOCUS2110	Lactuca saligna (Willowleaf lettuce)			DNA binding [GO:0003677]; protein dimerization activity [GO:0046983]	DNA binding [GO:0003677]; protein dimerization activity [GO:0046983]	MAAAGGR	tr|A0A6S7LXL8|A0A6S7LXL8_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS2110 PE=4 SV=1	0.93706	1.378	0	12485	6930.8	14424	0	0	0	0	0	0	0	0	0	0	0	0	12485	0	0	0	0	0	0	6930.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14424	0	0	0	0	0	0	0	0	0	0
A0A6S7LY65	A0A6S7LY65_LACSI	Uncharacterized protein	LSAL_LOCUS2838	Lactuca saligna (Willowleaf lettuce)					ENVRPAMGGNGGHMAAK	tr|A0A6S7LY65|A0A6S7LY65_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS2838 PE=4 SV=1;tr|A0A2J6LWY0|A0A2J6LWY0_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_8X128601 PE=4 SV=1	0.93667	1.378	0	225390	0	0	0	0	0	0	0	0	0	0	0	0	225390	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7LZI7	A0A6S7LZI7_LACSI	Uncharacterized protein	LSAL_LOCUS2807	Lactuca saligna (Willowleaf lettuce)					LFLKIAF	tr|A0A6S7LZI7|A0A6S7LZI7_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS2807 PE=4 SV=1	0.7883	1.378	0	0	4330.5	3532.6	3470.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4330.5	0	0	0	0	0	0	0	0	0	3532.6	0	0	0	0	0	3470.2	0	0	0	0	0
A0A6S7LZQ5	A0A6S7LZQ5_LACSI	NAC domain-containing protein	LSAL_LOCUS4757	Lactuca saligna (Willowleaf lettuce)	"regulation of transcription, DNA-templated [GO:0006355]"		"DNA binding [GO:0003677]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]	TTGSSKK	tr|A0A6S7LZQ5|A0A6S7LZQ5_LACSI NAC domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS4757 PE=4 SV=1	0.94098	1.378	0	5166.6	0	6411.1	5183.9	0	0	0	0	0	0	0	0	0	0	0	0	5166.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6411.1	0	0	0	0	2352.8	0	0	0	0	0	5183.9	0	0	0	0	0
A0A6S7M257	A0A6S7M257_LACSI	Histone acetyltransferase (EC 2.3.1.48)	LSAL_LOCUS7665	Lactuca saligna (Willowleaf lettuce)	"regulation of transcription, DNA-templated [GO:0006355]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; histone acetyltransferase activity [GO:0004402]; zinc ion binding [GO:0008270]; regulation of transcription, DNA-templated [GO:0006355]"	histone acetyltransferase activity [GO:0004402]; zinc ion binding [GO:0008270]	LHARACK	tr|A0A6S7M257|A0A6S7M257_LACSI Histone acetyltransferase OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS7665 PE=4 SV=1	0.84026	1.378	0	18881	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18881	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7M2U8	A0A6S7M2U8_LACSI	40S ribosomal protein S26	LSAL_LOCUS7681	Lactuca saligna (Willowleaf lettuce)	translation [GO:0006412]	ribosome [GO:0005840]	ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	RRHSSEK	tr|A0A6S7M2U8|A0A6S7M2U8_LACSI 40S ribosomal protein S26 OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS7681 PE=3 SV=1	0.93714	1.378	0	0	12833	13111	7762.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12833	0	0	0	0	0	0	8090.1	0	0	7811.5	0	0	0	0	0	0	13111	0	0	0	0	4987.7	0	0	7762.1	0
A0A6S7M415	A0A6S7M415_LACSI	Uncharacterized protein	LSAL_LOCUS8885	Lactuca saligna (Willowleaf lettuce)					NQENCFR	tr|A0A6S7M415|A0A6S7M415_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS8885 PE=4 SV=1	0.85062	1.378	0	11290	0	0	45053	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11290	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	45053	0	0	0	3039.2	0	6807	0
A0A6S7M442	A0A6S7M442_LACSI	Uncharacterized protein	LSAL_LOCUS7514	Lactuca saligna (Willowleaf lettuce)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]	DNA binding [GO:0003677]	TSGKSGK	"tr|A0A6S7M442|A0A6S7M442_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS7514 PE=4 SV=1;tr|A0A251V6J4|A0A251V6J4_HELAN Alpha,alpha-trehalose-phosphate synthase (UDP-forming) OS=Helianthus annuus OX=4232 GN=ATTPS1 PE=3 SV=1"	0.85018	1.378	7322.7	0	2127.7	0	0	0	0	0	0	0	0	0	7322.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2127.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7M522	A0A6S7M522_LACSI	ATP-dependent DNA helicase (EC 3.6.4.12)	LSAL_LOCUS9957	Lactuca saligna (Willowleaf lettuce)	DNA recombination [GO:0006310]; DNA repair [GO:0006281]; pyrimidine nucleotide biosynthetic process [GO:0006221]; telomere maintenance [GO:0000723]		ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0140603]; CTP synthase activity [GO:0003883]; DNA helicase activity [GO:0003678]; DNA recombination [GO:0006310]; DNA repair [GO:0006281]; pyrimidine nucleotide biosynthetic process [GO:0006221]; telomere maintenance [GO:0000723]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0140603]; CTP synthase activity [GO:0003883]; DNA helicase activity [GO:0003678]	QVLPVVR	tr|A0A6S7M522|A0A6S7M522_LACSI ATP-dependent DNA helicase OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS9957 PE=3 SV=1;tr|A0A2J6M848|A0A2J6M848_LACSA ATP-dependent DNA helicase OS=Lactuca sativa OX=4236 GN=LSAT_5X123540 PE=3 SV=1	0.90592	1.378	8068.4	0	54461	1623.8	0	0	0	0	0	0	8068.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11159	54461	0	0	0	0	0	0	1623.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7M5T5	A0A6S7M5T5_LACSI	Uncharacterized protein	LSAL_LOCUS9589	Lactuca saligna (Willowleaf lettuce)					MGGGEDR	tr|A0A6S7M5T5|A0A6S7M5T5_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS9589 PE=4 SV=1	0.84887	1.378	0	0	41713	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	41713	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7M744	A0A6S7M744_LACSI	Uncharacterized protein	LSAL_LOCUS11755	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		PHLPIPK	tr|A0A6S7M744|A0A6S7M744_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS11755 PE=4 SV=1	0.84844	1.378	583750	582760	493800	433500	466120	0	0	11702	55065	583750	0	445420	487690	0	0	490210	0	505960	582760	0	0	0	0	303770	326400	0	382220	493800	0	93444	9917.3	4379.9	0	9019.3	0	0	0	433500	0	0	0	466120	0	16523	0	0	0	0	360570	0
A0A6S7M7T4	A0A6S7M7T4_LACSI	Uncharacterized protein	LSAL_LOCUS11942	Lactuca saligna (Willowleaf lettuce)					LAYVFDK	tr|A0A6S7M7T4|A0A6S7M7T4_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS11942 PE=4 SV=1	0.94544	1.378	0	24655	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24655	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MAV4	A0A6S7MAV4_LACSI	Cyclic nucleotide-binding domain-containing protein	LSAL_LOCUS13125	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; voltage-gated potassium channel activity [GO:0005249]	voltage-gated potassium channel activity [GO:0005249]	SSNAYSM	tr|A0A6S7MAV4|A0A6S7MAV4_LACSI Cyclic nucleotide-binding domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS13125 PE=4 SV=1;tr|A0A6S7NNJ1|A0A6S7NNJ1_LACSI Cyclic nucleotide-binding domain-containing protein OS=Lactuca saligna OX=75948 GN=LS	0.80572	1.378	14360	0	11247	13799	0	0	14360	0	0	0	0	0	11453	0	0	0	0	0	0	0	0	0	0	0	8317.1	0	0	0	0	0	11247	0	0	0	0	0	13799	11913	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MB56	A0A6S7MB56_LACSI	LRRNT_2 domain-containing protein	LSAL_LOCUS13230	Lactuca saligna (Willowleaf lettuce)					SHKCFAK	tr|A0A6S7MB56|A0A6S7MB56_LACSI LRRNT_2 domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS13230 PE=4 SV=1;tr|A0A5N6PK58|A0A5N6PK58_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_09012 PE=4 SV=1;tr|A0A5N6PHZ4|A0A5N6PHZ	0.78411	1.378	0	277850	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	277850	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MBS9	A0A6S7MBS9_LACSI	TCP domain-containing protein	LSAL_LOCUS13028	Lactuca saligna (Willowleaf lettuce)			DNA-binding transcription factor activity [GO:0003700]	DNA-binding transcription factor activity [GO:0003700]	SNNQDAM	tr|A0A6S7MBS9|A0A6S7MBS9_LACSI TCP domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS13028 PE=4 SV=1	0.94497	1.378	6871.7	0	6526.2	0	0	0	0	0	0	0	0	0	0	6871.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6526.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MC81	A0A6S7MC81_LACSI	Uncharacterized protein	LSAL_LOCUS13497	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]	"integral component of membrane [GO:0016021]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	KLPGPPK	tr|A0A6S7MC81|A0A6S7MC81_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS13497 PE=3 SV=1	0.93627	1.378	0	0	0	2670	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2670	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MCG9	A0A6S7MCG9_LACSI	DDE Tnp4 domain-containing protein	LSAL_LOCUS13668	Lactuca saligna (Willowleaf lettuce)			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	TMVMQNR	tr|A0A6S7MCG9|A0A6S7MCG9_LACSI DDE Tnp4 domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS13668 PE=3 SV=1	0.9286	1.378	0	0	0	81886	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	81886	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MCL2	A0A6S7MCL2_LACSI	Importin N-terminal domain-containing protein	LSAL_LOCUS13763	Lactuca saligna (Willowleaf lettuce)	intracellular protein transport [GO:0006886]		small GTPase binding [GO:0031267]; intracellular protein transport [GO:0006886]	small GTPase binding [GO:0031267]	NPQRYKK	tr|A0A6S7MCL2|A0A6S7MCL2_LACSI Importin N-terminal domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS13763 PE=3 SV=1	0.92842	1.378	23982	26012	29590	31828	31235	0	0	0	0	0	23982	0	0	0	0	0	0	0	0	26012	23505	0	0	0	0	20985	29590	0	0	0	0	0	0	0	30195	0	31828	23251	0	0	0	0	31235	0	0	0	0	0	0	0
A0A6S7MFD5	A0A6S7MFD5_LACSI	WAT1-related protein	LSAL_LOCUS14716	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857]	transmembrane transporter activity [GO:0022857]	DPPTAEC	tr|A0A6S7MFD5|A0A6S7MFD5_LACSI WAT1-related protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS14716 PE=3 SV=1;tr|A0A6S7MFB9|A0A6S7MFB9_LACSI WAT1-related protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS14716 PE=3 SV=1	0.8467	1.378	0	201790	195520	214990	97048	0	0	0	0	0	0	0	0	0	25637	0	0	0	0	201790	0	0	0	82125	0	195360	0	0	136820	0	195520	0	0	0	0	0	0	137300	214990	79393	74607	97048	0	71197	0	65922	84358	25231	0	0
A0A6S7MFF2	A0A6S7MFF2_LACSI	Uncharacterized protein	LSAL_LOCUS13871	Lactuca saligna (Willowleaf lettuce)					WFVGRLR	tr|A0A6S7MFF2|A0A6S7MFF2_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS13871 PE=4 SV=1;tr|A0A6S7MFN6|A0A6S7MFN6_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS13871 PE=4 SV=1;tr|A0A6S7MES9|A0A6S7MES9_LACSI U	0.84714	1.378	5388.5	6280.2	6160	0	0	0	0	0	4086.2	0	0	0	0	5388.5	0	0	0	0	6280.2	0	0	4297.2	0	0	0	0	0	0	0	6160	4817.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MGN8	A0A6S7MGN8_LACSI	AIR synthase (EC 6.3.3.1) (Phosphoribosyl-aminoimidazole synthetase)	LSAL_LOCUS15202	Lactuca saligna (Willowleaf lettuce)	'de novo' IMP biosynthetic process [GO:0006189]		ATP binding [GO:0005524]; phosphoribosylformylglycinamidine cyclo-ligase activity [GO:0004641]; 'de novo' IMP biosynthetic process [GO:0006189]	ATP binding [GO:0005524]; phosphoribosylformylglycinamidine cyclo-ligase activity [GO:0004641]	IYVMGGK	tr|A0A6S7MGN8|A0A6S7MGN8_LACSI AIR synthase OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS15202 PE=3 SV=1	0.92352	1.378	0	0	0	32167	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32167	0	0	0	0	0	0	0	0	0
A0A6S7MHM4	A0A6S7MHM4_LACSI	Uncharacterized protein	LSAL_LOCUS14628	Lactuca saligna (Willowleaf lettuce)					DISWGCR	tr|A0A6S7MHM4|A0A6S7MHM4_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS14628 PE=4 SV=1	0.84584	1.378	0	0	47951	30276	21248	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18536	38608	47951	41369	0	0	0	0	0	30276	0	0	0	0	0	0	0	0	0	21248	0	0	0	0	0
A0A6S7MII8	A0A6S7MII8_LACSI	Uncharacterized protein	LSAL_LOCUS15865	Lactuca saligna (Willowleaf lettuce)					MMNKHIR	tr|A0A6S7MII8|A0A6S7MII8_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS15865 PE=4 SV=1	0.84541	1.378	10076	10695	0	6770.3	0	0	9076	10076	0	0	0	0	0	0	0	0	10695	0	0	0	0	7562.1	0	0	0	0	0	0	0	0	0	0	0	6770.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MIT6	A0A6S7MIT6_LACSI	RING-type domain-containing protein	LSAL_LOCUS14941	Lactuca saligna (Willowleaf lettuce)					LPKIIAR	tr|A0A6S7MIT6|A0A6S7MIT6_LACSI RING-type domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS14941 PE=4 SV=1;tr|A0A2J6L395|A0A2J6L395_LACSA RING-type domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_3X22581 PE=4 SV=1	0.85849	1.4349	4312600	4214200	1908900	3063000	4782700	1918300	4278700	4172100	4312600	1761100	534200	3235400	1426300	1114200	1122400	1205600	919370	1361900	3218200	2901700	2799900	2040000	4214200	410040	554900	160000	1728200	464980	1908900	1180900	0	0	260190	1427600	327110	3063000	2203800	2158100	641690	805220	0	4782700	3034000	121600	134690	99213	632970	458080	723610	174680
A0A6S7MJ74	A0A6S7MJ74_LACSI	AB hydrolase-1 domain-containing protein	LSAL_LOCUS15939	Lactuca saligna (Willowleaf lettuce)			catalytic activity [GO:0003824]	catalytic activity [GO:0003824]	NVPVFLK	tr|A0A6S7MJ74|A0A6S7MJ74_LACSI AB hydrolase-1 domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS15939 PE=4 SV=1	0.84498	1.378	0	12536	10546	17216	0	0	0	0	0	0	0	0	0	0	0	12536	0	0	0	0	0	0	0	0	0	0	0	0	10546	0	0	0	0	0	0	0	7413.1	0	12805	17216	0	0	0	0	0	0	0	0	0	0
A0A6S7MJ80	A0A6S7MJ80_LACSI	Uncharacterized protein	LSAL_LOCUS16061	Lactuca saligna (Willowleaf lettuce)					LKRPAPK	tr|A0A6S7MJ80|A0A6S7MJ80_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS16061 PE=4 SV=1	0.93446	1.378	0	15424	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15424	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MK62	A0A6S7MK62_LACSI	Uncharacterized protein	LSAL_LOCUS14930	Lactuca saligna (Willowleaf lettuce)					SSSGDGK	tr|A0A6S7MK62|A0A6S7MK62_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS14930 PE=4 SV=1	0.93544	1.378	14713	11883	0	0	7556.4	0	0	0	7401.5	0	0	0	14713	0	0	0	0	11883	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7556.4	0	0
A0A6S7MKD7	A0A6S7MKD7_LACSI	Uncharacterized protein	LSAL_LOCUS16496	Lactuca saligna (Willowleaf lettuce)					MEPGGGR	tr|A0A6S7MKD7|A0A6S7MKD7_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS16496 PE=4 SV=1	0.84369	1.378	0	0	0	62235	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	62235	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MLH3	A0A6S7MLH3_LACSI	Uncharacterized protein	LSAL_LOCUS16960	Lactuca saligna (Willowleaf lettuce)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	AKGGGHK	tr|A0A6S7MLH3|A0A6S7MLH3_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS16960 PE=4 SV=1	0.93152	1.378	0	0	15183	13223	11634	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11137	8719	0	0	0	0	0	15183	0	11685	0	13223	0	0	0	0	0	0	11634	0	0	0	8064.8	0	0	0
A0A6S7MLS3	A0A6S7MLS3_LACSI	Uncharacterized protein	LSAL_LOCUS16973	Lactuca saligna (Willowleaf lettuce)					FGQNHRK	tr|A0A6S7MLS3|A0A6S7MLS3_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS16973 PE=4 SV=1	0.84326	1.378	0	0	0	0	24263	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24263	0	0	0
A0A6S7MMH9	A0A6S7MMH9_LACSI	Uncharacterized protein	LSAL_LOCUS16047	Lactuca saligna (Willowleaf lettuce)					HLRILVK	tr|A0A6S7MMH9|A0A6S7MMH9_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS16047 PE=4 SV=1;tr|A0A6S7MJD1|A0A6S7MJD1_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS16047 PE=4 SV=1	0.84455	1.378	7644	6399.6	16519	0	7081.9	0	0	0	4412.8	3856.3	0	0	0	7644	0	0	0	6399.6	0	0	0	0	0	0	0	0	0	0	0	16519	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4312	7081.9
A0A6S7MNB1	A0A6S7MNB1_LACSI	Uncharacterized protein	LSAL_LOCUS16262	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	WYCSSYR	tr|A0A6S7MNB1|A0A6S7MNB1_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS16262 PE=4 SV=1	0.89844	1.378	0	12629	0	0	12730	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12629	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12730	0	0	0	0	0	0	0	0
A0A6S7MNJ4	A0A6S7MNJ4_LACSI	3HCDH_N domain-containing protein	LSAL_LOCUS17632	Lactuca saligna (Willowleaf lettuce)	fatty acid metabolic process [GO:0006631]		NAD+ binding [GO:0070403]; fatty acid metabolic process [GO:0006631]	NAD+ binding [GO:0070403]	VFVFTLR	tr|A0A6S7MNJ4|A0A6S7MNJ4_LACSI 3HCDH_N domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS17632 PE=4 SV=1	0.84283	1.378	29788	0	0	0	0	0	0	0	0	0	0	0	0	29788	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MPF4	A0A6S7MPF4_LACSI	Uncharacterized protein	LSAL_LOCUS17840	Lactuca saligna (Willowleaf lettuce)					LLLSLIKGGPFVLLLLR	tr|A0A6S7MPF4|A0A6S7MPF4_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS17840 PE=4 SV=1	0.94964	1.378	0	0	31631	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31631	0	0	0	0	0	10940	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MPG2	A0A6S7MPG2_LACSI	Uncharacterized protein	LSAL_LOCUS17931	Lactuca saligna (Willowleaf lettuce)	SRP-dependent cotranslational protein targeting to membrane [GO:0006614]	membrane [GO:0016020]	membrane [GO:0016020]; GTP binding [GO:0005525]; SRP-dependent cotranslational protein targeting to membrane [GO:0006614]	GTP binding [GO:0005525]	LKSGGAKILMAAGDTFR	tr|A0A6S7MPG2|A0A6S7MPG2_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS17931 PE=4 SV=1;tr|A0A2J6KQ60|A0A2J6KQ60_LACSA SRP54 domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_3X135801 PE=4 SV=1	0.88339	1.378	9259.4	0	15404	14984	0	0	0	0	8543.6	9259.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15404	0	0	0	14984	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MPW9	A0A6S7MPW9_LACSI	Uncharacterized protein	LSAL_LOCUS18113	Lactuca saligna (Willowleaf lettuce)					PMASEER	tr|A0A6S7MPW9|A0A6S7MPW9_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS18113 PE=4 SV=1	0.8424	1.378	0	7697.7	0	0	8631	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7697.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8631	0	0	0	0	0	0	0	0
A0A6S7MQF1	A0A6S7MQF1_LACSI	Uncharacterized protein	LSAL_LOCUS16814	Lactuca saligna (Willowleaf lettuce)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]	DNA binding [GO:0003677]	WGPIICR	tr|A0A6S7MQF1|A0A6S7MQF1_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS16814 PE=4 SV=1	0.84154	1.378	0	0	0	4747.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4747.5	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MR95	A0A6S7MR95_LACSI	Uncharacterized protein	LSAL_LOCUS16692	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GGNGCSR	tr|A0A6S7MR95|A0A6S7MR95_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS16692 PE=4 SV=1	0.83333	2.0678	0	0	0	13908	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13908	0	0	0	0	0	0	0	0	0
A0A6S7MTN8	A0A6S7MTN8_LACSI	Uncharacterized protein	LSAL_LOCUS19301	Lactuca saligna (Willowleaf lettuce)					FGYVYLK	tr|A0A6S7MTN8|A0A6S7MTN8_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS19301 PE=4 SV=1	0.84112	1.378	0	0	0	15149	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15149	0	0	0	0	0	0	0	0	0	0
A0A6S7MTZ1	A0A6S7MTZ1_LACSI	Uncharacterized protein	LSAL_LOCUS19550	Lactuca saligna (Willowleaf lettuce)		nucleolus [GO:0005730]	nucleolus [GO:0005730]		VNLPLIK	tr|A0A6S7MTZ1|A0A6S7MTZ1_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS19550 PE=3 SV=1	0.85105	1.378	0	11098	0	11207	15089	0	0	0	0	0	0	0	0	0	5028.4	0	11098	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11207	0	0	6468.8	0	0	15089	0	0	0	4348.6	0	0	0
A0A6S7MVG4	A0A6S7MVG4_LACSI	1-phosphatidylinositol-3-phosphate 5-kinase (EC 2.7.1.150)	LSAL_LOCUS20130	Lactuca saligna (Willowleaf lettuce)			1-phosphatidylinositol-3-phosphate 5-kinase activity [GO:0000285]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]	1-phosphatidylinositol-3-phosphate 5-kinase activity [GO:0000285]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]	YENQEWIQHEVDEVVYR	tr|A0A6S7MVG4|A0A6S7MVG4_LACSI 1-phosphatidylinositol-3-phosphate 5-kinase OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS20130 PE=4 SV=1	0.86441	1.378	0	0	0	56260	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	56260	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MVK4	A0A6S7MVK4_LACSI	Uncharacterized protein	LSAL_LOCUS20204	Lactuca saligna (Willowleaf lettuce)			nuclease activity [GO:0004518]	nuclease activity [GO:0004518]	ANCSKKK	tr|A0A6S7MVK4|A0A6S7MVK4_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS20204 PE=4 SV=1	0.88024	1.378	0	0	6543.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6543.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MVN6	A0A6S7MVN6_LACSI	Pept_C1 domain-containing protein	LSAL_LOCUS20210	Lactuca saligna (Willowleaf lettuce)			cysteine-type peptidase activity [GO:0008234]	cysteine-type peptidase activity [GO:0008234]	KESNRCGDLAMYPYNDK	tr|A0A6S7MVN6|A0A6S7MVN6_LACSI Pept_C1 domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS20210 PE=3 SV=1;tr|A0A2J6LV20|A0A2J6LV20_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_4X78460 PE=3 SV=1	0.87455	1.378	0	32680	0	0	0	0	0	0	0	0	0	0	0	0	0	32680	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MVS1	A0A6S7MVS1_LACSI	SRP54 domain-containing protein	LSAL_LOCUS20249	Lactuca saligna (Willowleaf lettuce)	SRP-dependent cotranslational protein targeting to membrane [GO:0006614]	signal recognition particle [GO:0048500]	signal recognition particle [GO:0048500]; 7S RNA binding [GO:0008312]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; SRP-dependent cotranslational protein targeting to membrane [GO:0006614]	7S RNA binding [GO:0008312]; GTPase activity [GO:0003924]; GTP binding [GO:0005525]	PIKLVGR	tr|A0A6S7MVS1|A0A6S7MVS1_LACSI SRP54 domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS20249 PE=4 SV=1;tr|A0A2J6KDG4|A0A2J6KDG4_LACSA SRP54 domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_9X20661 PE=3 SV=1;tr|A0A2U1LIS8|A0A2U1L	0.8669	1.378	0	0	0	0	65861	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	65861	0	0	0	0	0	0	0
A0A6S7MW29	A0A6S7MW29_LACSI	Aldo_ket_red domain-containing protein	LSAL_LOCUS20184	Lactuca saligna (Willowleaf lettuce)			D-threo-aldose 1-dehydrogenase activity [GO:0047834]	D-threo-aldose 1-dehydrogenase activity [GO:0047834]	GVLVCEG	tr|A0A6S7MW29|A0A6S7MW29_LACSI Aldo_ket_red domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS20184 PE=4 SV=1	0.85149	1.378	0	31408	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31408	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MWA1	A0A6S7MWA1_LACSI	Non-specific serine/threonine protein kinase (EC 2.7.11.1)	LSAL_LOCUS20453	Lactuca saligna (Willowleaf lettuce)	signal transduction [GO:0007165]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; signal transduction [GO:0007165]	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	HGSSGGR	tr|A0A6S7MWA1|A0A6S7MWA1_LACSI Non-specific serine/threonine protein kinase OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS20453 PE=3 SV=1;tr|A0A2J6JT56|A0A2J6JT56_LACSA Non-specific serine/threonine protein kinase OS=Lactuca sativa OX=4236 GN=LSAT_4X87261 PE=3 	0.82667	2.0214	0	5482.3	0	0	0	0	0	0	0	0	0	0	0	0	0	5482.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MWG9	A0A6S7MWG9_LACSI	DUF2470 domain-containing protein	LSAL_LOCUS20556	Lactuca saligna (Willowleaf lettuce)					KIASKVQ	tr|A0A6S7MWG9|A0A6S7MWG9_LACSI DUF2470 domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS20556 PE=4 SV=1;tr|A0A6S7MX23|A0A6S7MX23_LACSI DUF2470 domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS20556 PE=4 SV=1;tr|A0A2J6LP4	0.83562	2.0643	16163	0	0	0	0	0	0	0	0	0	0	0	0	16163	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MWK2	A0A6S7MWK2_LACSI	Hcy-binding domain-containing protein	LSAL_LOCUS18440	Lactuca saligna (Willowleaf lettuce)	methionine biosynthetic process [GO:0009086]; methylation [GO:0032259]		betaine-homocysteine S-methyltransferase activity [GO:0047150]; zinc ion binding [GO:0008270]; methionine biosynthetic process [GO:0009086]; methylation [GO:0032259]	betaine-homocysteine S-methyltransferase activity [GO:0047150]; zinc ion binding [GO:0008270]	LIGGCCR	tr|A0A6S7MWK2|A0A6S7MWK2_LACSI Hcy-binding domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS18440 PE=4 SV=1;tr|A0A2U1PK41|A0A2U1PK41_ARTAN Homocysteine S-methyltransferase family protein OS=Artemisia annua OX=35608 GN=CTI12_AA143310 PE=4 	0.89671	1.378	29139	33980	26302	22181	18096	29139	0	25388	0	0	0	21104	0	25113	0	0	0	0	22090	0	0	33980	0	0	13749	0	0	0	24630	0	26302	25829	22181	0	0	0	0	0	0	0	0	0	0	0	11839	8692.3	0	18096	16706	0
A0A6S7MX37	A0A6S7MX37_LACSI	Uncharacterized protein	LSAL_LOCUS20604	Lactuca saligna (Willowleaf lettuce)					IVLLIGF	tr|A0A6S7MX37|A0A6S7MX37_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS20604 PE=4 SV=1;tr|A0A6S7MX35|A0A6S7MX35_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS20604 PE=4 SV=1	0.85193	1.378	11516	40065	15402	24660	26104	0	0	0	0	0	11516	0	0	0	0	13154	0	0	0	40065	6709.9	0	0	1518	0	6486.9	14818	15402	8177	0	0	0	0	0	0	0	8260	24660	12267	0	0	0	26104	0	4301.2	0	5697.2	0	0	0
A0A6S7MXY2	A0A6S7MXY2_LACSI	Uncharacterized protein	LSAL_LOCUS20830	Lactuca saligna (Willowleaf lettuce)					FGSSCMK	tr|A0A6S7MXY2|A0A6S7MXY2_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS20830 PE=4 SV=1	0.85766	1.378	0	0	0	106570	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	106570	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MYU0	A0A6S7MYU0_LACSI	Uncharacterized protein	LSAL_LOCUS21462	Lactuca saligna (Willowleaf lettuce)					GHPIINR	tr|A0A6S7MYU0|A0A6S7MYU0_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS21462 PE=4 SV=1	0.88272	1.378	0	16799	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16799	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7MZ10	A0A6S7MZ10_LACSI	SWIM-type domain-containing protein	LSAL_LOCUS21538	Lactuca saligna (Willowleaf lettuce)			zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	NTTCTYR	tr|A0A6S7MZ10|A0A6S7MZ10_LACSI SWIM-type domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS21538 PE=4 SV=1	0.86212	1.378	0	0	0	0	4062.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4062.9	0	0	0	0
A0A6S7MZL3	A0A6S7MZL3_LACSI	Uncharacterized protein	LSAL_LOCUS21774	Lactuca saligna (Willowleaf lettuce)					SFPSDYK	tr|A0A6S7MZL3|A0A6S7MZL3_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS21774 PE=4 SV=1;tr|A0A6S7MZM9|A0A6S7MZM9_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS21774 PE=4 SV=1	0.86167	1.378	4437.5	0	0	3949.4	0	0	0	0	4437.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3949.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7N090	A0A6S7N090_LACSI	Uncharacterized protein	LSAL_LOCUS18705	Lactuca saligna (Willowleaf lettuce)	nucleoside metabolic process [GO:0009116]; nucleotide biosynthetic process [GO:0009165]		magnesium ion binding [GO:0000287]; ribose phosphate diphosphokinase activity [GO:0004749]; nucleoside metabolic process [GO:0009116]; nucleotide biosynthetic process [GO:0009165]	magnesium ion binding [GO:0000287]; ribose phosphate diphosphokinase activity [GO:0004749]	EGDPSGR	tr|A0A6S7N090|A0A6S7N090_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS18705 PE=3 SV=1	0.86123	1.378	0	0	171850	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	171850	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7N0H1	A0A6S7N0H1_LACSI	Uncharacterized protein	LSAL_LOCUS19329	Lactuca saligna (Willowleaf lettuce)					DGEDEDT	tr|A0A6S7N0H1|A0A6S7N0H1_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS19329 PE=4 SV=1	0.86078	1.378	3411.9	4730.3	0	4667.4	0	0	0	0	0	0	0	0	0	3411.9	4670.7	0	0	0	0	4730.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4667.4	0	0	0	0	0	0	0	0	0	0	0
A0A6S7N1L4	A0A6S7N1L4_LACSI	ULP_PROTEASE domain-containing protein	LSAL_LOCUS22554	Lactuca saligna (Willowleaf lettuce)			cysteine-type peptidase activity [GO:0008234]	cysteine-type peptidase activity [GO:0008234]	SKFWHKK	tr|A0A6S7N1L4|A0A6S7N1L4_LACSI ULP_PROTEASE domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS22554 PE=3 SV=1	0.85989	1.378	709610	73475	833670	163980	0	0	0	0	0	0	0	0	0	709610	0	0	17516	0	0	73475	0	0	0	14298	0	0	833670	0	0	0	0	0	0	0	163980	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7N2F6	A0A6S7N2F6_LACSI	Uncharacterized protein	LSAL_LOCUS19489	Lactuca saligna (Willowleaf lettuce)					PPSNPPK	tr|A0A6S7N2F6|A0A6S7N2F6_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS19489 PE=4 SV=1	0.90226	1.378	7953.4	0	1681.3	0	0	0	7953.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1681.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7N4R6	A0A6S7N4R6_LACSI	AAA domain-containing protein	LSAL_LOCUS23345	Lactuca saligna (Willowleaf lettuce)			ATP binding [GO:0005524]	ATP binding [GO:0005524]	NLNNLNK	tr|A0A6S7N4R6|A0A6S7N4R6_LACSI AAA domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS23345 PE=4 SV=1;tr|A0A6S7N5H8|A0A6S7N5H8_LACSI AAA domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS23345 PE=4 SV=1;tr|A0A103XY70|A0A103	0.80711	1.378	0	0	0	0	324230	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	324230	0	0	0
A0A6S7N560	A0A6S7N560_LACSI	Uncharacterized protein	LSAL_LOCUS22840	Lactuca saligna (Willowleaf lettuce)		membrane [GO:0016020]	membrane [GO:0016020]		GDYKFVK	tr|A0A6S7N560|A0A6S7N560_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS22840 PE=4 SV=1	0.85899	1.378	7076.4	0	0	4868.8	12562	7076.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4868.8	0	0	0	0	0	12562	0	3876.7	0
A0A6S7N683	A0A6S7N683_LACSI	LRRNT_2 domain-containing protein	LSAL_LOCUS23791	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]		GFQLLRR	tr|A0A6S7N683|A0A6S7N683_LACSI LRRNT_2 domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS23791 PE=4 SV=1	0.92878	1.378	9121.1	0	0	0	0	0	0	0	0	0	0	9121.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7N6X5	A0A6S7N6X5_LACSI	GTD-binding domain-containing protein	LSAL_LOCUS21027	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; myosin binding [GO:0017022]	myosin binding [GO:0017022]	VLKPVNR	tr|A0A6S7N6X5|A0A6S7N6X5_LACSI GTD-binding domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS21027 PE=4 SV=1	0.85722	1.378	30531	0	0	0	0	0	0	0	0	0	0	0	30531	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7N787	A0A6S7N787_LACSI	Protein kinase domain-containing protein	LSAL_LOCUS24502	Lactuca saligna (Willowleaf lettuce)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	TYLPQQR	tr|A0A6S7N787|A0A6S7N787_LACSI Protein kinase domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS24502 PE=4 SV=1	0.85237	1.378	0	0	0	0	6567.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6567.9	0	0	0	0	0
A0A6S7N7J5	A0A6S7N7J5_LACSI	Uncharacterized protein	LSAL_LOCUS24720	Lactuca saligna (Willowleaf lettuce)					NIVKVGK	tr|A0A6S7N7J5|A0A6S7N7J5_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS24720 PE=4 SV=1;tr|A0A2J6JHE8|A0A2J6JHE8_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_5X73160 PE=4 SV=1	0.9402	1.378	0	0	0	0	4386.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4386.2	0	0	0	0	0	0	0	0
A0A6S7N8E5	A0A6S7N8E5_LACSI	Fe2OG dioxygenase domain-containing protein	LSAL_LOCUS24935	Lactuca saligna (Willowleaf lettuce)			metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]	metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]	DKDLLWR	tr|A0A6S7N8E5|A0A6S7N8E5_LACSI Fe2OG dioxygenase domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS24935 PE=3 SV=1	0.85677	1.378	307990	0	0	0	0	0	0	0	30913	0	0	27294	307990	17418	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7NA88	A0A6S7NA88_LACSI	Uncharacterized protein	LSAL_LOCUS24752	Lactuca saligna (Willowleaf lettuce)					ILKNCPK	tr|A0A6S7NA88|A0A6S7NA88_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS24752 PE=4 SV=1	0.85633	1.378	0	0	18600	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18600	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7NBG0	A0A6S7NBG0_LACSI	Uncharacterized protein	LSAL_LOCUS25078	Lactuca saligna (Willowleaf lettuce)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	GESSASK	tr|A0A6S7NBG0|A0A6S7NBG0_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS25078 PE=4 SV=1	0.92522	1.378	0	0	5452.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5452.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7NCK5	A0A6S7NCK5_LACSI	ATPase_AAA_core domain-containing protein	LSAL_LOCUS26079	Lactuca saligna (Willowleaf lettuce)			ATP binding [GO:0005524]	ATP binding [GO:0005524]	SSHADGK	tr|A0A6S7NCK5|A0A6S7NCK5_LACSI ATPase_AAA_core domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS26079 PE=4 SV=1	0.85545	1.378	51179	203070	99911	89509	35532	0	0	0	0	0	51179	0	0	0	0	0	70613	0	0	0	203070	0	0	53276	58492	89349	0	0	99911	0	0	55774	0	0	89509	0	0	0	0	0	0	0	0	0	19885	0	29673	35532	0	0
A0A6S7NCZ3	A0A6S7NCZ3_LACSI	Uncharacterized protein	LSAL_LOCUS26800	Lactuca saligna (Willowleaf lettuce)					DDTCYDE	tr|A0A6S7NCZ3|A0A6S7NCZ3_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS26800 PE=4 SV=1	0.85501	1.378	16352	18543	16637	35530	14777	15585	16352	13125	0	0	0	0	16166	0	0	11288	0	18543	0	0	0	0	0	16637	12723	12788	0	0	0	0	0	16420	0	0	0	0	0	0	0	35530	0	0	0	14371	0	0	0	0	14777	0
A0A6S7NDI3	A0A6S7NDI3_LACSI	Uncharacterized protein	LSAL_LOCUS25885	Lactuca saligna (Willowleaf lettuce)					SPNSEEM	tr|A0A6S7NDI3|A0A6S7NDI3_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS25885 PE=4 SV=1	0.93364	1.378	19530	32349	23852	21698	5339.2	0	0	0	0	0	19530	0	0	0	0	8050.7	28481	0	0	32349	0	0	0	0	0	0	23852	0	0	0	0	0	0	0	0	0	0	21698	0	0	0	0	0	0	0	0	5339.2	0	0	0
A0A6S7NED7	A0A6S7NED7_LACSI	Uncharacterized protein	LSAL_LOCUS27338	Lactuca saligna (Willowleaf lettuce)					NLVKPYR	tr|A0A6S7NED7|A0A6S7NED7_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS27338 PE=4 SV=1;tr|A0A103XPR2|A0A103XPR2_CYNCS Uncharacterized protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_003279 PE=4 SV=1;tr|A0A2U1LV14|A0A2U	0.81162	1.378	21062	9432.1	33856	11744	10857	0	0	0	0	0	0	21062	0	17282	0	0	0	0	9432.1	0	0	0	7503.9	0	0	0	0	0	0	33856	0	0	11744	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10857	0	0
A0A6S7NFD2	A0A6S7NFD2_LACSI	Uncharacterized protein	LSAL_LOCUS27567	Lactuca saligna (Willowleaf lettuce)		nucleus [GO:0005634]	nucleus [GO:0005634]		DMPEVMK	tr|A0A6S7NFD2|A0A6S7NFD2_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS27567 PE=4 SV=1	0.85456	1.378	0	0	25061	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25061	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7NFY0	A0A6S7NFY0_LACSI	Uncharacterized protein	LSAL_LOCUS23361	Lactuca saligna (Willowleaf lettuce)					MMMWNGR	tr|A0A6S7NFY0|A0A6S7NFY0_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS23361 PE=4 SV=1	0.85412	1.378	0	15095	22622	0	0	0	0	0	0	0	0	0	0	0	0	15095	0	0	0	0	0	0	0	0	22622	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7NGD6	A0A6S7NGD6_LACSI	Uncharacterized protein	LSAL_LOCUS27961	Lactuca saligna (Willowleaf lettuce)					PILKPEK	tr|A0A6S7NGD6|A0A6S7NGD6_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS27961 PE=4 SV=1	0.85496	1.378	0	0	0	40254	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	40254	31901	0	0	0	0	0	0	0	0	0	0	0
A0A6S7NGJ8	A0A6S7NGJ8_LACSI	Glutamine amidotransferase (EC 6.3.5.2)	LSAL_LOCUS28137	Lactuca saligna (Willowleaf lettuce)	glutamine metabolic process [GO:0006541]		ATP binding [GO:0005524]; GMP synthase (glutamine-hydrolyzing) activity [GO:0003922]; pyrophosphatase activity [GO:0016462]; glutamine metabolic process [GO:0006541]	ATP binding [GO:0005524]; GMP synthase (glutamine-hydrolyzing) activity [GO:0003922]; pyrophosphatase activity [GO:0016462]	SVAQPEM	tr|A0A6S7NGJ8|A0A6S7NGJ8_LACSI Glutamine amidotransferase OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS28137 PE=3 SV=1;tr|A0A251SPQ3|A0A251SPQ3_HELAN Glutamine amidotransferase OS=Helianthus annuus OX=4232 GN=GUAA PE=3 SV=1	0.82718	1.378	6352.7	28329	0	0	0	0	0	0	6352.7	0	0	0	0	0	0	0	0	12140	0	0	0	0	28329	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7NGS0	A0A6S7NGS0_LACSI	Protein kinase domain-containing protein	LSAL_LOCUS23743	Lactuca saligna (Willowleaf lettuce)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	NTPGAMM	tr|A0A6S7NGS0|A0A6S7NGS0_LACSI Protein kinase domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS23743 PE=4 SV=1;tr|A0A6S7NEL8|A0A6S7NEL8_LACSI Protein kinase domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS23743 PE=4 SV=	0.94726	1.378	0	38988	28943	12935	29867	0	0	0	0	0	0	0	0	0	0	12246	17173	0	38988	24382	0	0	0	8443.5	5831	15597	0	28943	0	0	0	0	0	0	0	0	0	0	12935	0	0	19322	29867	0	0	0	3837.6	0	14023	0
A0A6S7NHG9	A0A6S7NHG9_LACSI	Uncharacterized protein	LSAL_LOCUS26627	Lactuca saligna (Willowleaf lettuce)	microtubule-based movement [GO:0007018]		ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]; microtubule-based movement [GO:0007018]	ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]	SPMETER	tr|A0A6S7NHG9|A0A6S7NHG9_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS26627 PE=3 SV=1	0.85368	1.378	16787	14235	14115	20579	0	0	0	16787	0	0	0	0	13286	0	12488	0	14235	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14115	0	0	0	12432	11454	0	20579	0	0	0	0	0	0	0	0	0	0	0
A0A6S7NIW1	A0A6S7NIW1_LACSI	Uncharacterized protein	LSAL_LOCUS27636	Lactuca saligna (Willowleaf lettuce)					GCKGSNA	tr|A0A6S7NIW1|A0A6S7NIW1_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS27636 PE=4 SV=1	0.85324	1.378	5084.3	0	0	0	0	0	0	0	0	0	0	0	5084.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7NMK9	A0A6S7NMK9_LACSI	Uncharacterized protein	LSAL_LOCUS25512	Lactuca saligna (Willowleaf lettuce)					YVRVKLK	tr|A0A6S7NMK9|A0A6S7NMK9_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS25512 PE=4 SV=1	0.92269	1.378	38604	97708	51939	56168	126090	0	0	3821.7	0	0	38604	0	4006.7	0	1169.5	37246	33526	0	0	97708	77144	0	0	2172.8	0	41687	27891	30976	51939	0	0	0	0	0	46956	0	23847	52452	56168	1728.4	0	126090	74336	0	10422	0	20072	0	0	0
A0A6S7NN06	A0A6S7NN06_LACSI	Uncharacterized protein	LSAL_LOCUS29845	Lactuca saligna (Willowleaf lettuce)	SCF complex assembly [GO:0010265]		SCF complex assembly [GO:0010265]		VKKLHWK	tr|A0A6S7NN06|A0A6S7NN06_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS29845 PE=4 SV=1;tr|A0A6S7MVZ0|A0A6S7MVZ0_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS20355 PE=4 SV=1	0.93333	1.378	0	10378	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10378	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7NN68	A0A6S7NN68_LACSI	Uncharacterized protein	LSAL_LOCUS26738	Lactuca saligna (Willowleaf lettuce)		mitochondrion [GO:0005739]; ribosome [GO:0005840]	mitochondrion [GO:0005739]; ribosome [GO:0005840]		MTLMPPK	"tr|A0A6S7NN68|A0A6S7NN68_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS26738 PE=3 SV=1;tr|A0A699L2F2|A0A699L2F2_TANCI 28S ribosomal protein S33, mitochondrial (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_695117 PE=4 SV="	0.88889	2.756	0	28608	40980	0	20796	0	0	0	0	0	0	0	0	0	27193	14532	21652	0	0	28608	0	10362	0	0	0	22528	0	0	40980	0	0	0	0	0	0	0	0	0	0	0	0	19082	20796	0	0	0	0	0	0	0
A0A6S7NNZ7	A0A6S7NNZ7_LACSI	Uncharacterized protein	LSAL_LOCUS29435	Lactuca saligna (Willowleaf lettuce)			"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	KIMTDHR	tr|A0A6S7NNZ7|A0A6S7NNZ7_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS29435 PE=3 SV=1	0.92893	1.378	0	0	0	0	66229	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	66229	0	0	0	0	0	0	0
A0A6S7NPX0	A0A6S7NPX0_LACSI	RanBP2-type domain-containing protein	LSAL_LOCUS29738	Lactuca saligna (Willowleaf lettuce)			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	SGDHMDK	tr|A0A6S7NPX0|A0A6S7NPX0_LACSI RanBP2-type domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS29738 PE=4 SV=1	0.93966	1.378	28234	175520	0	0	21724	0	0	0	0	0	0	0	0	28234	0	0	0	0	175520	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21724	0	0
A0A6S7NR54	A0A6S7NR54_LACSI	Homeobox domain-containing protein	LSAL_LOCUS27923	Lactuca saligna (Willowleaf lettuce)	flower development [GO:0009908]	nucleus [GO:0005634]	nucleus [GO:0005634]; single-stranded DNA binding [GO:0003697]; flower development [GO:0009908]	single-stranded DNA binding [GO:0003697]	KPLRVHR	tr|A0A6S7NR54|A0A6S7NR54_LACSI Homeobox domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS27923 PE=4 SV=1	0.82767	1.378	0	0	0	0	4110	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4110	0	0	0	0	0	0	0
A0A6S7NSN9	A0A6S7NSN9_LACSI	Uncharacterized protein	LSAL_LOCUS26568	Lactuca saligna (Willowleaf lettuce)					EESGDFM	tr|A0A6S7NSN9|A0A6S7NSN9_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS26568 PE=4 SV=1	0.92691	1.378	0	0	1737.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1737.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7NST7	A0A6S7NST7_LACSI	Uncharacterized protein	LSAL_LOCUS31569	Lactuca saligna (Willowleaf lettuce)					EGGEENM	tr|A0A6S7NST7|A0A6S7NST7_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS31569 PE=4 SV=1	0.93019	1.378	0	12740	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12740	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7NUJ5	A0A6S7NUJ5_LACSI	Uncharacterized protein	LSAL_LOCUS29754	Lactuca saligna (Willowleaf lettuce)					ANLDPLF	tr|A0A6S7NUJ5|A0A6S7NUJ5_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS29754 PE=4 SV=1	0.82726	1.378	0	0	9785.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9785.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7NW22	A0A6S7NW22_LACSI	Uncharacterized protein	LSAL_LOCUS33032	Lactuca saligna (Willowleaf lettuce)					MSTTNQR	tr|A0A6S7NW22|A0A6S7NW22_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS33032 PE=4 SV=1	0.82643	1.378	0	0	13865	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13865	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7NWH1	A0A6S7NWH1_LACSI	Protein kinase domain-containing protein	LSAL_LOCUS33602	Lactuca saligna (Willowleaf lettuce)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	SSSCTGM	tr|A0A6S7NWH1|A0A6S7NWH1_LACSI Protein kinase domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS33602 PE=4 SV=1;tr|A0A2J6JKQ6|A0A2J6JKQ6_LACSA Protein kinase domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_7X87920 PE=4 SV=1	0.85824	1.378	8828.9	0	19492	0	15330	0	0	0	0	0	8828.9	0	0	0	0	0	0	0	0	0	0	0	0	0	14835	0	19362	19492	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15330	0
A0A6S7NWN0	A0A6S7NWN0_LACSI	Uncharacterized protein	LSAL_LOCUS32372	Lactuca saligna (Willowleaf lettuce)					FGEVFFR	tr|A0A6S7NWN0|A0A6S7NWN0_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS32372 PE=4 SV=1	0.82561	1.378	0	19854	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19854	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7NWW2	A0A6S7NWW2_LACSI	Uncharacterized protein	LSAL_LOCUS33129	Lactuca saligna (Willowleaf lettuce)					DGGDPEK	tr|A0A6S7NWW2|A0A6S7NWW2_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS33129 PE=4 SV=1;tr|A0A2J6K385|A0A2J6K385_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_7X73300 PE=4 SV=1;tr|A0A175YG06|A0A175YG06_DAUCS Unchar	0.87936	1.378	0	0	0	15111	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15111	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7NZA2	A0A6S7NZA2_LACSI	PCRF domain-containing protein	LSAL_LOCUS33157	Lactuca saligna (Willowleaf lettuce)		cytoplasm [GO:0005737]	"cytoplasm [GO:0005737]; translation release factor activity, codon specific [GO:0016149]"	"translation release factor activity, codon specific [GO:0016149]"	NTGLNCI	tr|A0A6S7NZA2|A0A6S7NZA2_LACSI PCRF domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS33157 PE=3 SV=1	0.82315	1.378	0	0	0	0	105220	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	105220	0	0
A0A6S7NZF6	A0A6S7NZF6_LACSI	Uncharacterized protein	LSAL_LOCUS34266	Lactuca saligna (Willowleaf lettuce)			catalytic activity [GO:0003824]	catalytic activity [GO:0003824]	EPSANCK	tr|A0A6S7NZF6|A0A6S7NZF6_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS34266 PE=4 SV=1;tr|A0A103YJF2|A0A103YJF2_CYNCS Molybdenum cofactor sulfurase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_011351 PE=3 SV=1;tr|A0A2J6LVJ4	0.77872	1.378	0	4990.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4990.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7NZR0	A0A6S7NZR0_LACSI	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B	LSAL_LOCUS34819	Lactuca saligna (Willowleaf lettuce)		protein phosphatase type 2A complex [GO:0000159]	protein phosphatase type 2A complex [GO:0000159]; protein phosphatase regulator activity [GO:0019888]	protein phosphatase regulator activity [GO:0019888]	KHGVLPR	tr|A0A6S7NZR0|A0A6S7NZR0_LACSI Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS34819 PE=3 SV=1	0.82274	1.378	14804	0	0	0	0	0	0	0	0	0	14804	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7P025	A0A6S7P025_LACSI	Protein kinase domain-containing protein	LSAL_LOCUS30884	Lactuca saligna (Willowleaf lettuce)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	CEPYCRR	tr|A0A6S7P025|A0A6S7P025_LACSI Protein kinase domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS30884 PE=4 SV=1	0.82192	1.378	0	0	0	5844.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5844.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7P1T8	A0A6S7P1T8_LACSI	DBD_Tnp_Mut domain-containing protein	LSAL_LOCUS34057	Lactuca saligna (Willowleaf lettuce)					CSGSRPK	tr|A0A6S7P1T8|A0A6S7P1T8_LACSI DBD_Tnp_Mut domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS34057 PE=4 SV=1	0.82152	1.378	0	0	0	0	278790	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	278790	0
A0A6S7P3B3	A0A6S7P3B3_LACSI	Uncharacterized protein	LSAL_LOCUS31585	Lactuca saligna (Willowleaf lettuce)	ion transport [GO:0006811]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ion transport [GO:0006811]		KNVMNDPK	tr|A0A6S7P3B3|A0A6S7P3B3_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS31585 PE=3 SV=1;tr|A0A118K792|A0A118K792_CYNCS Elf4 domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_009683 PE=3 SV=1	0.82456	2.1579	0	0	2548.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2548.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7P3V7	A0A6S7P3V7_LACSI	Uncharacterized protein	LSAL_LOCUS34846	Lactuca saligna (Willowleaf lettuce)					SSQGCNS	tr|A0A6S7P3V7|A0A6S7P3V7_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS34846 PE=4 SV=1	0.8207	1.378	0	0	4207.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4207.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7P4K9	A0A6S7P4K9_LACSI	Uncharacterized protein	LSAL_LOCUS36248	Lactuca saligna (Willowleaf lettuce)					HFALCKR	tr|A0A6S7P4K9|A0A6S7P4K9_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS36248 PE=4 SV=1	0.92975	1.378	0	0	0	9565.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9565.5	0	0	0	0	0	0	0	0	0	0
A0A6S7P4P6	A0A6S7P4P6_LACSI	ATP-dependent 6-phosphofructokinase (ATP-PFK) (Phosphofructokinase) (EC 2.7.1.11) (Phosphohexokinase)	PFK LSAL_LOCUS36294	Lactuca saligna (Willowleaf lettuce)	fructose 6-phosphate metabolic process [GO:0006002]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; 6-phosphofructokinase activity [GO:0003872]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]; fructose 6-phosphate metabolic process [GO:0006002]	6-phosphofructokinase activity [GO:0003872]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]	NNNDSSK	tr|A0A6S7P4P6|A0A6S7P4P6_LACSI ATP-dependent 6-phosphofructokinase OS=Lactuca saligna OX=75948 GN=PFK PE=3 SV=1;tr|A0A103YNA0|A0A103YNA0_CYNCS ATP-dependent 6-phosphofructokinase OS=Cynara cardunculus var. scolymus OX=59895 GN=PFK PE=3 SV=1	0.78267	1.378	4818.5	0	0	25421	0	0	0	0	4818.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25421	0	0	0	0	0	0	0	0	0	0
A0A6S7P4W3	A0A6S7P4W3_LACSI	Uncharacterized protein	LSAL_LOCUS29696	Lactuca saligna (Willowleaf lettuce)					LEGLILR	tr|A0A6S7P4W3|A0A6S7P4W3_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS29696 PE=4 SV=1	0.81989	1.378	0	0	3194.7	0	2070.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3194.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2070.1	0	0	0	0	0	0	0	0
A0A6S7P5B3	A0A6S7P5B3_LACSI	Uncharacterized protein	LSAL_LOCUS30344	Lactuca saligna (Willowleaf lettuce)					CHPDQHK	tr|A0A6S7P5B3|A0A6S7P5B3_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS30344 PE=4 SV=1	0.81949	1.378	0	0	0	0	49210	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	49210
A0A6S7P5B5	A0A6S7P5B5_LACSI	Exocyst complex component SEC5	LSAL_LOCUS36913	Lactuca saligna (Willowleaf lettuce)	exocytosis [GO:0006887]; Golgi to plasma membrane transport [GO:0006893]; protein transport [GO:0015031]	exocyst [GO:0000145]	exocyst [GO:0000145]; exocytosis [GO:0006887]; Golgi to plasma membrane transport [GO:0006893]; protein transport [GO:0015031]		DDDDRER	tr|A0A6S7P5B5|A0A6S7P5B5_LACSI Exocyst complex component SEC5 OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS36913 PE=3 SV=1	0.93454	1.378	0	18330	0	11106	0	0	0	0	0	0	0	0	0	0	0	11351	0	0	0	18330	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11106	0	0	0	0	0	0	0	0	0	0	0
A0A6S7P7J6	A0A6S7P7J6_LACSI	Uncharacterized protein	LSAL_LOCUS34118	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		MADDKRK	tr|A0A6S7P7J6|A0A6S7P7J6_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS34118 PE=4 SV=1;tr|A0A2J6MI92|A0A2J6MI92_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_7X105881 PE=4 SV=1	0.86364	1.378	0	6630.7	0	6800.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6630.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6800.6	4941.1	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7P7L9	A0A6S7P7L9_LACSI	PBPe domain-containing protein	LSAL_LOCUS37297	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ligand-gated ion channel activity [GO:0015276]	ligand-gated ion channel activity [GO:0015276]	VVRGKGK	tr|A0A6S7P7L9|A0A6S7P7L9_LACSI PBPe domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS37297 PE=3 SV=1	0.94286	1.378	0	0	0	11915	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11915	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7P7T4	A0A6S7P7T4_LACSI	J domain-containing protein	LSAL_LOCUS30955	Lactuca saligna (Willowleaf lettuce)	protein folding [GO:0006457]		unfolded protein binding [GO:0051082]; protein folding [GO:0006457]	unfolded protein binding [GO:0051082]	MDDDYYK	tr|A0A6S7P7T4|A0A6S7P7T4_LACSI J domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS30955 PE=4 SV=1;tr|A0A2J6LL72|A0A2J6LL72_LACSA J domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_6X111101 PE=4 SV=1	0.94788	1.378	0	4540	0	0	0	0	0	0	0	0	0	0	0	0	4540	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7P8K6	A0A6S7P8K6_LACSI	Uncharacterized protein	LSAL_LOCUS30620	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SYSKLQK	tr|A0A6S7P8K6|A0A6S7P8K6_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS30620 PE=4 SV=1	0.83899	1.378	19083	0	0	0	0	0	0	0	0	19083	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7P9A3	A0A6S7P9A3_LACSI	Phosphoinositide phospholipase C (EC 3.1.4.11)	LSAL_LOCUS36809	Lactuca saligna (Willowleaf lettuce)	intracellular signal transduction [GO:0035556]; lipid catabolic process [GO:0016042]	plasma membrane [GO:0005886]	plasma membrane [GO:0005886]; phosphatidylinositol phospholipase C activity [GO:0004435]; intracellular signal transduction [GO:0035556]; lipid catabolic process [GO:0016042]	phosphatidylinositol phospholipase C activity [GO:0004435]	KAKLPPK	tr|A0A6S7P9A3|A0A6S7P9A3_LACSI Phosphoinositide phospholipase C OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS36809 PE=4 SV=1;tr|A0A6S7P6P8|A0A6S7P6P8_LACSI Phosphoinositide phospholipase C OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS36809 PE=4 SV=1	0.82891	1.378	156020	144170	142190	136530	114800	101570	88160	156020	118000	136760	83967	110120	129890	87285	0	106530	0	131270	137770	144170	101650	110240	14248	129030	77304	0	0	123630	0	111970	0	142190	53341	105340	94370	136530	0	96549	110220	0	0	114800	0	0	55595	60737	0	79750	88883	74762
A0A6S7PAH6	A0A6S7PAH6_LACSI	Uncharacterized protein	LSAL_LOCUS38799	Lactuca saligna (Willowleaf lettuce)					QVIKAKK	tr|A0A6S7PAH6|A0A6S7PAH6_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS38799 PE=4 SV=1	0.83856	1.378	3254.3	0	0	2229.9	0	3254.3	1476	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2229.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7PAN3	A0A6S7PAN3_LACSI	Isoleucyl-tRNA synthetase (EC 6.1.1.5)	LSAL_LOCUS33343	Lactuca saligna (Willowleaf lettuce)	isoleucyl-tRNA aminoacylation [GO:0006428]	chromosome [GO:0005694]	chromosome [GO:0005694]; aminoacyl-tRNA editing activity [GO:0002161]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; isoleucine-tRNA ligase activity [GO:0004822]; isoleucyl-tRNA aminoacylation [GO:0006428]	aminoacyl-tRNA editing activity [GO:0002161]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; isoleucine-tRNA ligase activity [GO:0004822]	TTTVPHR	tr|A0A6S7PAN3|A0A6S7PAN3_LACSI Isoleucyl-tRNA synthetase OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS33343 PE=4 SV=1	0.83814	1.378	10319	8889.1	10402	9366.7	8289	7644.8	4913.4	10319	0	0	0	0	9517.9	0	5791.5	0	8889.1	0	0	0	0	0	0	6098.6	6559.3	0	0	0	0	0	9781.4	10402	0	8171.9	0	0	0	0	0	0	9366.7	0	0	0	0	7527.9	0	8289	6607.8	0
A0A6S7PBY0	A0A6S7PBY0_LACSI	Uncharacterized protein	LSAL_LOCUS31448	Lactuca saligna (Willowleaf lettuce)					GGGGHGK	tr|A0A6S7PBY0|A0A6S7PBY0_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS31448 PE=4 SV=1;tr|A0A2J6LS17|A0A2J6LS17_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_7X11660 PE=4 SV=1	0.94276	1.378	138840	469680	461040	398050	256190	0	0	0	138840	0	116540	0	0	0	0	469680	365660	158760	0	459770	40034	44785	0	13723	14444	286620	294470	0	450810	0	0	461040	0	35734	209390	398050	324780	163620	184230	264200	275590	203340	256190	13073	6138	17380	94451	0	131450	0
A0A6S7PCJ4	A0A6S7PCJ4_LACSI	WRKY domain-containing protein	LSAL_LOCUS38987	Lactuca saligna (Willowleaf lettuce)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	VGADDER	tr|A0A6S7PCJ4|A0A6S7PCJ4_LACSI WRKY domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS38987 PE=4 SV=1	0.83771	1.378	1328700	1312700	620480	0	196520	0	0	0	0	0	0	27382	1328700	30434	0	0	0	25829	0	1312700	0	0	0	0	15998	0	0	0	0	0	0	620480	0	0	0	0	0	0	0	0	0	0	0	21341	196520	20080	0	0	18192	0
A0A6S7PCY1	A0A6S7PCY1_LACSI	Uncharacterized protein	LSAL_LOCUS39660	Lactuca saligna (Willowleaf lettuce)					FHYIPSM	tr|A0A6S7PCY1|A0A6S7PCY1_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS39660 PE=4 SV=1	0.94079	1.378	93785	0	0	0	0	0	0	66780	0	0	93785	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7PD76	A0A6S7PD76_LACSI	Uncharacterized protein	LSAL_LOCUS38340	Lactuca saligna (Willowleaf lettuce)					YHGGGGR	tr|A0A6S7PD76|A0A6S7PD76_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS38340 PE=4 SV=1	0.83602	1.378	181220	0	0	0	0	99522	0	0	181220	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7PE08	A0A6S7PE08_LACSI	Phorbol-ester/DAG-type domain-containing protein	LSAL_LOCUS39994	Lactuca saligna (Willowleaf lettuce)	intracellular signal transduction [GO:0035556]		intracellular signal transduction [GO:0035556]		CCSNCYK	tr|A0A6S7PE08|A0A6S7PE08_LACSI Phorbol-ester/DAG-type domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS39994 PE=4 SV=1;tr|A0A6S7PZ90|A0A6S7PZ90_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS39992 PE=4 SV=1	0.94262	1.378	437850	37660	0	0	18518	0	0	0	0	0	0	0	437850	11576	0	0	0	0	0	0	0	37660	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18518
A0A6S7PEG9	A0A6S7PEG9_LACSI	Uncharacterized protein	LSAL_LOCUS38682	Lactuca saligna (Willowleaf lettuce)					SSSKKLL	tr|A0A6S7PEG9|A0A6S7PEG9_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS38682 PE=4 SV=1	0.83518	1.378	0	0	6934.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6934.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7PFA2	A0A6S7PFA2_LACSI	Uncharacterized protein	LSAL_LOCUS40047	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		PLKGLQR	tr|A0A6S7PFA2|A0A6S7PFA2_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS40047 PE=4 SV=1	0.94016	1.378	0	11976	0	3688.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11976	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3688.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7PHG5	A0A6S7PHG5_LACSI	Uncharacterized protein	LSAL_LOCUS41231	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VQIRNCK	tr|A0A6S7PHG5|A0A6S7PHG5_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS41231 PE=4 SV=1	0.83434	1.378	0	32767	0	30319	0	0	0	0	0	0	0	0	0	0	18415	0	0	0	0	0	32767	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29006	0	30319	0	0	0	0	0	0	0	0	0	0	0
A0A6S7PI74	A0A6S7PI74_LACSI	Uncharacterized protein	LSAL_LOCUS41460	Lactuca saligna (Willowleaf lettuce)					SFPNDWK	tr|A0A6S7PI74|A0A6S7PI74_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS41460 PE=4 SV=1	0.82974	1.378	0	12965	24932	25829	26257	0	0	0	0	0	0	0	0	0	12965	0	12201	0	0	0	0	0	0	0	0	24932	0	0	0	0	0	10792	0	0	0	0	0	0	25829	0	0	0	0	0	0	0	0	0	26257	0
A0A6S7PIU8	A0A6S7PIU8_LACSI	Protein FAR1-RELATED SEQUENCE	LSAL_LOCUS41179	Lactuca saligna (Willowleaf lettuce)	"regulation of transcription, DNA-templated [GO:0006355]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; zinc ion binding [GO:0008270]; regulation of transcription, DNA-templated [GO:0006355]"	zinc ion binding [GO:0008270]	IAREKSN	tr|A0A6S7PIU8|A0A6S7PIU8_LACSI Protein FAR1-RELATED SEQUENCE OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS41179 PE=3 SV=1	0.83392	1.378	0	0	0	15823	14072	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15823	0	0	0	0	0	0	0	0	0	14072	0	0	13103	0
A0A6S7PJ24	A0A6S7PJ24_LACSI	Uncharacterized protein	LSAL_LOCUS40294	Lactuca saligna (Willowleaf lettuce)					SSTCSHG	tr|A0A6S7PJ24|A0A6S7PJ24_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS40294 PE=4 SV=1	0.8335	1.378	0	12989	53395	35965	10295	0	0	0	0	0	0	0	0	0	0	0	12989	0	0	0	0	0	0	12307	0	35575	53395	0	6339.7	0	0	0	0	4342.6	30964	0	35965	0	0	25407	0	0	0	0	10295	8160.3	0	0	0	0
A0A6S7PJ92	A0A6S7PJ92_LACSI	Carboxypeptidase (EC 3.4.16.-)	LSAL_LOCUS35399	Lactuca saligna (Willowleaf lettuce)		extracellular region [GO:0005576]	extracellular region [GO:0005576]; serine-type carboxypeptidase activity [GO:0004185]	serine-type carboxypeptidase activity [GO:0004185]	KPHWKGK	tr|A0A6S7PJ92|A0A6S7PJ92_LACSI Carboxypeptidase OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS35399 PE=3 SV=1;tr|A0A2J6K8N2|A0A2J6K8N2_LACSA Carboxypeptidase OS=Lactuca sativa OX=4236 GN=LSAT_8X33100 PE=3 SV=1	0.93836	1.378	4617.3	4047.1	0	0	0	0	0	0	0	3326.6	4617.3	0	0	0	0	0	0	0	0	0	0	0	4047.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7PJA7	A0A6S7PJA7_LACSI	Myb_DNA-bind_3 domain-containing protein	LSAL_LOCUS41358	Lactuca saligna (Willowleaf lettuce)					DMMGACD	tr|A0A6S7PJA7|A0A6S7PJA7_LACSI Myb_DNA-bind_3 domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS41358 PE=4 SV=1	0.83308	1.378	111780	221790	267040	202880	157580	0	0	0	0	0	111780	0	8035.3	9123.9	0	76071	134320	0	0	221790	120670	0	101490	22771	0	180220	75630	267040	111560	0	0	19845	0	0	59391	202880	19700	0	132030	91088	119770	77447	157580	0	68926	3300.6	148750	0	0	0
A0A6S7PJC5	A0A6S7PJC5_LACSI	Uncharacterized protein	LSAL_LOCUS34055	Lactuca saligna (Willowleaf lettuce)		extracellular region [GO:0005576]	extracellular region [GO:0005576]		RLHSGSR	tr|A0A6S7PJC5|A0A6S7PJC5_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS34055 PE=3 SV=1;tr|A0A2J6M883|A0A2J6M883_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_7X104080 PE=3 SV=1	0.89123	1.378	13737	18702	15085	15881	0	0	0	0	0	0	0	0	0	13737	0	0	0	0	0	0	0	18702	15092	0	13675	0	0	0	0	15085	12437	0	15881	9037	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7PJN8	A0A6S7PJN8_LACSI	Uncharacterized protein	LSAL_LOCUS41502	Lactuca saligna (Willowleaf lettuce)					HHQKRHK	tr|A0A6S7PJN8|A0A6S7PJN8_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS41502 PE=4 SV=1	0.94686	1.378	0	0	0	0	115090	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	115090	0
A0A6S7PK97	A0A6S7PK97_LACSI	Uncharacterized protein	LSAL_LOCUS42231	Lactuca saligna (Willowleaf lettuce)					LLTTTVK	tr|A0A6S7PK97|A0A6S7PK97_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS42231 PE=4 SV=1	0.94551	1.378	0	0	7202.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7202.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7PL89	A0A6S7PL89_LACSI	Uncharacterized protein	LSAL_LOCUS42120	Lactuca saligna (Willowleaf lettuce)					KPIVKPK	tr|A0A6S7PL89|A0A6S7PL89_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS42120 PE=4 SV=1;tr|A0A6S7PUT5|A0A6S7PUT5_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS38598 PE=4 SV=1	0.84685	1.4072	0	117900	36665	35071	106990	0	0	0	0	0	0	0	0	0	0	0	66563	0	0	117900	0	0	0	0	0	27594	0	0	36665	0	0	0	0	0	0	0	27678	32334	35071	17146	0	106990	0	0	0	0	0	0	0	0
A0A6S7PLF0	A0A6S7PLF0_LACSI	TCP domain-containing protein	LSAL_LOCUS42178	Lactuca saligna (Willowleaf lettuce)			DNA-binding transcription factor activity [GO:0003700]	DNA-binding transcription factor activity [GO:0003700]	VHLQIKK	tr|A0A6S7PLF0|A0A6S7PLF0_LACSI TCP domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS42178 PE=4 SV=1	0.94591	1.378	0	14193	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14193	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7PLV7	A0A6S7PLV7_LACSI	F-box domain-containing protein	LSAL_LOCUS42352	Lactuca saligna (Willowleaf lettuce)					VKKSWNK	tr|A0A6S7PLV7|A0A6S7PLV7_LACSI F-box domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS42352 PE=4 SV=1	0.83141	1.378	0	4850.7	9373.7	6963	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4850.7	0	0	0	0	0	0	9373.7	0	0	0	0	0	6963	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7PMW6	A0A6S7PMW6_LACSI	Protein kinase domain-containing protein	LSAL_LOCUS42688	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; signaling receptor binding [GO:0005102]; transmembrane receptor protein serine/threonine kinase activity [GO:0004675]	ATP binding [GO:0005524]; signaling receptor binding [GO:0005102]; transmembrane receptor protein serine/threonine kinase activity [GO:0004675]	EQRRWGR	tr|A0A6S7PMW6|A0A6S7PMW6_LACSI Protein kinase domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS42688 PE=3 SV=1	0.94456	1.378	9581.9	13888	17743	15606	0	0	8232.8	9581.9	0	0	0	0	0	0	13888	0	13379	0	0	0	0	0	0	9404.6	0	0	0	0	12087	0	0	17743	0	0	0	0	12161	0	0	0	15606	0	0	0	0	0	0	0	0	0
A0A6S7PQL3	A0A6S7PQL3_LACSI	Uncharacterized protein	LSAL_LOCUS37186	Lactuca saligna (Willowleaf lettuce)			DNA binding [GO:0003677]; metal ion binding [GO:0046872]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]	CDGLPCK	tr|A0A6S7PQL3|A0A6S7PQL3_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS37186 PE=4 SV=1;tr|A0A6S7P5Y2|A0A6S7P5Y2_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS37188 PE=4 SV=1	0.93487	1.378	8005.8	17750	27378	23694	15713	0	0	0	0	0	0	0	8005.8	0	10037	0	0	0	0	17750	0	0	0	0	0	14010	27378	0	17737	0	0	0	0	0	23694	0	0	11012	10714	0	0	0	15713	0	0	2910.8	0	0	0	0
A0A6S7PTP3	A0A6S7PTP3_LACSI	Uncharacterized protein	LSAL_LOCUS35707	Lactuca saligna (Willowleaf lettuce)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transmembrane transporter activity [GO:0022857]	transmembrane transporter activity [GO:0022857]	VGALTSK	tr|A0A6S7PTP3|A0A6S7PTP3_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS35707 PE=4 SV=1;tr|A0A076V6U2|A0A076V6U2_9APIA 3-hydroxy-3-methylglutaryl coenzyme A synthase OS=Panax notoginseng OX=44586 PE=2 SV=1	0.80366	1.378	10349	0	7781.7	0	4326.2	0	0	0	0	0	10349	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7781.7	0	0	0	0	0	0	0	0	0	0	0	0	0	4326.2	0	0	0	0	0	0	0	0
A0A6S7PU95	A0A6S7PU95_LACSI	Uncharacterized protein	LSAL_LOCUS38399	Lactuca saligna (Willowleaf lettuce)					GLMTYVK	tr|A0A6S7PU95|A0A6S7PU95_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS38399 PE=4 SV=1	0.83016	1.378	0	0	7564.9	9423.1	8101.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6427.6	0	0	0	0	0	7564.9	0	8639.8	7307.2	0	9423.1	0	0	0	0	0	0	0	0	0	0	0	8101.6	0	0
A0A6S7PXJ0	A0A6S7PXJ0_LACSI	ULP_PROTEASE domain-containing protein	LSAL_LOCUS39447	Lactuca saligna (Willowleaf lettuce)			cysteine-type peptidase activity [GO:0008234]	cysteine-type peptidase activity [GO:0008234]	TSGVSTK	tr|A0A6S7PXJ0|A0A6S7PXJ0_LACSI ULP_PROTEASE domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS39447 PE=3 SV=1;tr|A0A6S7NMY7|A0A6S7NMY7_LACSI ULP_PROTEASE domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS30136 PE=3 SV=1	0.94604	1.378	44975	0	0	53308	0	0	44975	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	53308	0	0	0	0	0	0	0	0	0	0	0
A0A6S7PXX2	A0A6S7PXX2_LACSI	MBD domain-containing protein	LSAL_LOCUS37172	Lactuca saligna (Willowleaf lettuce)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]	DNA binding [GO:0003677]	APGGPHK	tr|A0A6S7PXX2|A0A6S7PXX2_LACSI MBD domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS37172 PE=4 SV=1;tr|A0A251TS61|A0A251TS61_HELAN Putative DNA-binding domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0241661 PE=4 S	0.8328	1.378	0	0	0	0	23736	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23736	0	0	0	0	0	0	0	0
A0A6S7PZQ8	A0A6S7PZQ8_LACSI	Uncharacterized protein	LSAL_LOCUS40155	Lactuca saligna (Willowleaf lettuce)					DHDNMQK	tr|A0A6S7PZQ8|A0A6S7PZQ8_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS40155 PE=4 SV=1	0.81827	1.378	0	7923.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7923.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7Q0Q0	A0A6S7Q0Q0_LACSI	Uncharacterized protein	LSAL_LOCUS37350	Lactuca saligna (Willowleaf lettuce)	sexual reproduction [GO:0019953]	extracellular region [GO:0005576]	extracellular region [GO:0005576]; sexual reproduction [GO:0019953]		TGDGSTK	tr|A0A6S7Q0Q0|A0A6S7Q0Q0_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS37350 PE=3 SV=1	0.92902	1.378	0	11424	8770.5	0	11863	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11424	10041	0	0	0	0	0	0	0	0	8770.5	0	0	0	0	0	0	0	0	0	0	0	11863	0	0	0	0	5130.6	0
A0A6S7Q6K9	A0A6S7Q6K9_LACSI	Uncharacterized protein	LSAL_LOCUS39104	Lactuca saligna (Willowleaf lettuce)	carbohydrate metabolic process [GO:0005975]		"hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]; carbohydrate metabolic process [GO:0005975]"	"hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]"	NSFSSSH	tr|A0A6S7Q6K9|A0A6S7Q6K9_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS39104 PE=3 SV=1	0.79945	1.378	0	0	0	14639	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14639	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7Q8M1	A0A6S7Q8M1_LACSI	Uncharacterized protein	LSAL_LOCUS39663	Lactuca saligna (Willowleaf lettuce)	carbohydrate metabolic process [GO:0005975]		"hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]; carbohydrate metabolic process [GO:0005975]"	"hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]"	NVKYVFK	tr|A0A6S7Q8M1|A0A6S7Q8M1_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS39663 PE=3 SV=1	0.77767	1.378	3097.6	0	0	0	3687.4	0	3097.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3687.4	0	0	0	0
A0A6S7QCD5	A0A6S7QCD5_LACSI	Uncharacterized protein	LSAL_LOCUS39801	Lactuca saligna (Willowleaf lettuce)			UDP-glycosyltransferase activity [GO:0008194]	UDP-glycosyltransferase activity [GO:0008194]	WGGHGEM	tr|A0A6S7QCD5|A0A6S7QCD5_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS39801 PE=4 SV=1	0.92311	1.378	0	6505.4	3165.1	0	4122.6	0	0	0	0	0	0	0	0	0	0	0	0	6505.4	0	0	0	0	0	0	0	0	0	0	0	0	3165.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4122.6	0	0
A0A6S7QHZ8	A0A6S7QHZ8_LACSI	Dimer_Tnp_hAT domain-containing protein	LSAL_LOCUS41040	Lactuca saligna (Willowleaf lettuce)			protein dimerization activity [GO:0046983]	protein dimerization activity [GO:0046983]	RPIDINE	tr|A0A6S7QHZ8|A0A6S7QHZ8_LACSI Dimer_Tnp_hAT domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS41040 PE=4 SV=1;tr|A0A6S7PQG0|A0A6S7PQG0_LACSI BED-type domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS41040 PE=4 SV=1	0.83058	1.378	0	11472	0	0	0	0	0	0	0	0	0	0	0	0	0	11472	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6S7QK36	A0A6S7QK36_LACSI	Uncharacterized protein	LSAL_LOCUS41390	Lactuca saligna (Willowleaf lettuce)					VFLKKFK	tr|A0A6S7QK36|A0A6S7QK36_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS41390 PE=4 SV=1	0.93457	1.378	7344.6	3672.3	0	0	4300.8	0	0	0	0	0	0	0	7344.6	0	0	0	0	0	0	3672.3	0	2671.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4300.8	0	0	0	0	0	0
A0A6S7QKU8	A0A6S7QKU8_LACSI	Uncharacterized protein	LSAL_LOCUS42421	Lactuca saligna (Willowleaf lettuce)					CYAPPSE	tr|A0A6S7QKU8|A0A6S7QKU8_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS42421 PE=4 SV=1	0.80829	1.378	0	0	0	63134	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	63134	0	0	0	0	0	0	0	0	0	0
A0A2J6JKK4	A0A2J6JKK4_LACSA	Lipoxygenase (EC 1.13.11.-)	LSAT_9X86300	Lactuca sativa (Garden lettuce)	fatty acid biosynthetic process [GO:0006633]; lipid oxidation [GO:0034440]; oxylipin biosynthetic process [GO:0031408]		"metal ion binding [GO:0046872]; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702]; fatty acid biosynthetic process [GO:0006633]; lipid oxidation [GO:0034440]; oxylipin biosynthetic process [GO:0031408]"	"metal ion binding [GO:0046872]; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702]"	DFHPHLKLNIPHLVSKR	tr|A0A2J6JKK4|A0A2J6JKK4_LACSA Lipoxygenase OS=Lactuca sativa OX=4236 GN=LSAT_9X86300 PE=3 SV=1;tr|A0A6S7L256|A0A6S7L256_LACSI Lipoxygenase OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS2099 PE=3 SV=1	0.94382	1.5954	14364	7553.6	8031.7	107950	0	0	0	0	14364	0	0	9593.6	0	0	0	0	0	0	7553.6	0	0	7261.3	6747.3	0	0	0	0	0	0	0	0	8031.7	0	0	0	0	0	1389.9	0	107950	0	0	0	0	0	0	0	0	0	0
A0A2J6JLH2	A0A2J6JLH2_LACSA	Polysacc_synt_4 domain-containing protein	LSAT_4X80860	Lactuca sativa (Garden lettuce)	plant-type secondary cell wall biogenesis [GO:0009834]; xylan biosynthetic process [GO:0045492]	Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; plant-type secondary cell wall biogenesis [GO:0009834]; xylan biosynthetic process [GO:0045492]		ILRVILSAIVLIFVLILIK	tr|A0A2J6JLH2|A0A2J6JLH2_LACSA Polysacc_synt_4 domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_4X80860 PE=4 SV=1;tr|A0A6S7MWA4|A0A6S7MWA4_LACSI Polysacc_synt_4 domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS20282 PE=4 SV=1	0.92135	1.5954	2060800	2425000	1247000	1597000	2232000	2060800	604980	1299800	1206500	1229000	873620	1059100	601450	521790	1020600	1320400	1505200	1547900	2274800	2425000	1993700	1567900	2215100	945520	703380	765030	582620	687980	1247000	628930	982160	1068200	462640	736710	1597000	1560300	1204600	843330	1271300	673440	1377700	1712600	2232000	464850	932370	895130	770670	1148500	785850	976650
A0A2J6JR29	A0A2J6JR29_LACSA	LRRNT_2 domain-containing protein	LSAT_8X140801	Lactuca sativa (Garden lettuce)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]		MEDGEER	tr|A0A2J6JR29|A0A2J6JR29_LACSA LRRNT_2 domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_8X140801 PE=4 SV=1	0.93688	1.378	11249	0	0	0	0	0	0	0	0	0	11249	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6JUH7	A0A2J6JUH7_LACSA	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (Ribophorin-2)	LSAT_5X182920	Lactuca sativa (Garden lettuce)	protein N-linked glycosylation [GO:0006487]	integral component of membrane [GO:0016021]; oligosaccharyltransferase complex [GO:0008250]	integral component of membrane [GO:0016021]; oligosaccharyltransferase complex [GO:0008250]; protein N-linked glycosylation [GO:0006487]		YGSLYFK	tr|A0A2J6JUH7|A0A2J6JUH7_LACSA Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Lactuca sativa OX=4236 GN=LSAT_5X182920 PE=3 SV=1;tr|A0A6S7NH80|A0A6S7NH80_LACSI Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subun	0.78535	1.378	305090	233610	249940	248660	306670	0	36894	0	164410	305090	219420	0	0	0	233610	0	76718	0	0	0	0	0	0	0	0	244300	0	249940	0	0	0	243610	226860	0	0	0	0	0	0	248660	166690	306670	0	0	196130	0	0	0	0	223610
A0A2J6JY08	A0A2J6JY08_LACSA	SBP-type domain-containing protein	LSAT_4X421	Lactuca sativa (Garden lettuce)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]	FSCQQCRR	tr|A0A2J6JY08|A0A2J6JY08_LACSA SBP-type domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_4X421 PE=4 SV=1;tr|A0A6S7MPG9|A0A6S7MPG9_LACSI SBP-type domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS18053 PE=4 SV=1;tr|A0A118JYC6|A0A	0.81356	2.1463	16660	44621	114860	94320	0	0	12153	10199	0	0	0	0	16660	0	43399	44621	0	41961	0	0	0	0	0	0	76660	114860	0	0	35464	0	16303	0	0	0	94320	13488	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6JYM6	A0A2J6JYM6_LACSA	Chromatin-remodeling ATPase INO80 (EC 3.6.4.-)	LSAT_5X160760	Lactuca sativa (Garden lettuce)	"ATP-dependent chromatin remodeling [GO:0043044]; DNA repair [GO:0006281]; nucleosome mobilization [GO:0042766]; regulation of transcription from RNA polymerase II promoter in response to stress [GO:0043618]; transcription, DNA-templated [GO:0006351]"	Ino80 complex [GO:0031011]	"Ino80 complex [GO:0031011]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0140603]; DNA binding [GO:0003677]; histone binding [GO:0042393]; nucleosome-dependent ATPase activity [GO:0070615]; ATP-dependent chromatin remodeling [GO:0043044]; DNA repair [GO:0006281]; nucleosome mobilization [GO:0042766]; regulation of transcription from RNA polymerase II promoter in response to stress [GO:0043618]; transcription, DNA-templated [GO:0006351]"	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0140603]; DNA binding [GO:0003677]; histone binding [GO:0042393]; nucleosome-dependent ATPase activity [GO:0070615]	SDTMPGR	tr|A0A2J6JYM6|A0A2J6JYM6_LACSA Chromatin-remodeling ATPase INO80 OS=Lactuca sativa OX=4236 GN=LSAT_5X160760 PE=3 SV=1;tr|A0A6S7NDX4|A0A6S7NDX4_LACSI Chromatin-remodeling ATPase INO80 OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS27086 PE=3 SV=1;tr|A0A103T456|A0	0.80858	1.378	0	157510	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	157510	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6K1L6	A0A2J6K1L6_LACSA	ABC-type xenobiotic transporter (EC 7.6.2.2)	LSAT_9X90181	Lactuca sativa (Garden lettuce)	transmembrane transport [GO:0055085]	integral component of membrane [GO:0016021]; membrane [GO:0016020]; plant-type vacuole [GO:0000325]; vacuolar membrane [GO:0005774]	integral component of membrane [GO:0016021]; membrane [GO:0016020]; plant-type vacuole [GO:0000325]; vacuolar membrane [GO:0005774]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]; transmembrane transport [GO:0055085]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	FGQQDFR	tr|A0A2J6K1L6|A0A2J6K1L6_LACSA ABC-type xenobiotic transporter OS=Lactuca sativa OX=4236 GN=LSAT_9X90181 PE=3 SV=1;tr|A0A6S7QMU1|A0A6S7QMU1_LACSI ABC-type xenobiotic transporter OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS41931 PE=3 SV=1;tr|A0A6S7PMY3|A0A6S7P	0.86957	2.1966	12952	7811.4	0	0	5719.2	0	0	0	10141	0	0	12952	0	0	0	0	0	7811.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5719.2
A0A2J6K2F7	A0A2J6K2F7_LACSA	Myb_DNA-bind_3 domain-containing protein	LSAT_1X68500	Lactuca sativa (Garden lettuce)					YECAETWEMADGSHGGM	tr|A0A2J6K2F7|A0A2J6K2F7_LACSA Myb_DNA-bind_3 domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_1X68500 PE=4 SV=1	0.92123	1.378	0	14033	0	0	34295	0	0	0	0	0	0	0	0	0	0	14033	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34295	0	0	0	21521	0	0	0
A0A2J6K6W0	A0A2J6K6W0_LACSA	Uncharacterized protein	LSAT_4X39520	Lactuca sativa (Garden lettuce)					EEVKKWK	tr|A0A2J6K6W0|A0A2J6K6W0_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_4X39520 PE=4 SV=1;tr|A0A6S7NKC1|A0A6S7NKC1_LACSI NAM-associated domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS29498 PE=4 SV=1;tr|A0A6S7MHG0|A0A6S7	0.93493	1.378	16733	0	0	0	5445.3	0	0	0	16733	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5445.3	0	0	0	0	0	0
A0A2J6KDC3	A0A2J6KDC3_LACSA	RRM domain-containing protein	LSAT_6X61781	Lactuca sativa (Garden lettuce)	"mRNA splicing, via spliceosome [GO:0000398]"	nuclear speck [GO:0016607]	"nuclear speck [GO:0016607]; RNA binding [GO:0003723]; mRNA splicing, via spliceosome [GO:0000398]"	RNA binding [GO:0003723]	RNQNFTFIR	tr|A0A2J6KDC3|A0A2J6KDC3_LACSA RRM domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_6X61781 PE=4 SV=1	0.91753	1.5349	0	0	36183	12257	11052	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	36183	28504	0	0	0	0	0	0	0	0	0	12257	0	0	0	0	11052	0	0	0	0	0	0	0
A0A2J6KEF1	A0A2J6KEF1_LACSA	O-fucosyltransferase family protein	LSAT_4X106080	Lactuca sativa (Garden lettuce)	fucose metabolic process [GO:0006004]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; transferase activity [GO:0016740]; fucose metabolic process [GO:0006004]	transferase activity [GO:0016740]	GFIKVVK	tr|A0A2J6KEF1|A0A2J6KEF1_LACSA O-fucosyltransferase family protein OS=Lactuca sativa OX=4236 GN=LSAT_4X106080 PE=3 SV=1;tr|A0A103YBG4|A0A103YBG4_CYNCS O-fucosyltransferase family protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_015637 PE=3 SV=1	0.82589	1.378	0	44521	31067	35687	35940	0	0	0	0	0	0	0	0	0	17577	0	0	0	0	44521	0	0	0	14644	0	23826	0	0	31067	0	0	0	0	0	0	0	35687	0	0	0	0	35940	0	0	0	5670.5	0	0	0	0
A0A2J6KHG9	A0A2J6KHG9_LACSA	Uncharacterized protein	LSAT_7X24741	Lactuca sativa (Garden lettuce)					ESEDDSE	tr|A0A2J6KHG9|A0A2J6KHG9_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_7X24741 PE=4 SV=1	0.81818	2.756	51430	10702	12785	23506	0	0	0	0	0	0	0	0	0	51430	10702	0	0	0	0	0	0	0	0	0	0	12785	0	0	0	3961.4	0	0	0	0	0	0	0	11536	0	23506	0	0	0	0	0	0	0	0	0	0
A0A2J6KIJ4	A0A2J6KIJ4_LACSA	Uncharacterized protein	LSAT_8X72081	Lactuca sativa (Garden lettuce)		plasma membrane [GO:0005886]	plasma membrane [GO:0005886]		SCDTEPR	tr|A0A2J6KIJ4|A0A2J6KIJ4_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_8X72081 PE=4 SV=1;tr|A0A6S7P6M3|A0A6S7P6M3_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS36780 PE=4 SV=1;tr|A0A6S7NUC7|A0A6S7NUC7_LACSI Unchar	0.86395	1.378	0	114870	0	0	0	0	0	0	0	0	0	0	0	0	114870	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6KKS8	A0A2J6KKS8_LACSA	PK_Tyr_Ser-Thr domain-containing protein	LSAT_1X82120	Lactuca sativa (Garden lettuce)	protein autophosphorylation [GO:0046777]	plasma membrane [GO:0005886]; plasmodesma [GO:0009506]	plasma membrane [GO:0005886]; plasmodesma [GO:0009506]; protein kinase activity [GO:0004672]; protein autophosphorylation [GO:0046777]	protein kinase activity [GO:0004672]	ADDDYCR	tr|A0A2J6KKS8|A0A2J6KKS8_LACSA PK_Tyr_Ser-Thr domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_1X82120 PE=4 SV=1;tr|A0A6S7LMZ6|A0A6S7LMZ6_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS9450 PE=4 SV=1;tr|A0A2J6KKP4|A0A2J6K	0.87037	1.409	0	4424.2	0	0	4857.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4424.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4857.5	0	0	0
A0A2J6KLH8	A0A2J6KLH8_LACSA	Response regulatory domain-containing protein	LSAT_1X115221	Lactuca sativa (Garden lettuce)	phosphorelay signal transduction system [GO:0000160]		phosphorelay signal transduction system [GO:0000160]		CSGLWVR	tr|A0A2J6KLH8|A0A2J6KLH8_LACSA Response regulatory domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_1X115221 PE=4 SV=1;tr|A0A699IMG3|A0A699IMG3_TANCI Histidine kinase CKI1-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_541425 PE=4 SV=1;tr|A0	0.79777	1.378	9986.5	18787	24395	30819	16920	9986.5	0	0	0	0	0	0	9577.9	0	0	0	18787	0	0	0	0	0	0	0	0	12409	0	0	11407	0	0	24395	0	0	18662	0	13494	30819	0	9802.9	19585	0	0	0	11464	0	16920	0	0	0
A0A2J6KN95	A0A2J6KN95_LACSA	Cyclic nucleotide-binding domain-containing protein	LSAT_8X63481	Lactuca sativa (Garden lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ion channel activity [GO:0005216]	ion channel activity [GO:0005216]	FAQPDLK	tr|A0A2J6KN95|A0A2J6KN95_LACSA Cyclic nucleotide-binding domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_8X63481 PE=3 SV=1;tr|A0A6S7PFJ9|A0A6S7PFJ9_LACSI Cyclic nucleotide-binding domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LO	0.78261	1.378	56708	0	0	0	32300	0	56708	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32300	0	0	0	0	0	0	15005	0
A0A2J6KNQ4	A0A2J6KNQ4_LACSA	Uncharacterized protein	LSAT_8X134580	Lactuca sativa (Garden lettuce)	ATP synthesis coupled proton transport [GO:0015986]	"proton-transporting ATP synthase complex, catalytic core F(1) [GO:0045261]"	"proton-transporting ATP synthase complex, catalytic core F(1) [GO:0045261]; ADP binding [GO:0043531]; ATP binding [GO:0005524]; ATP synthesis coupled proton transport [GO:0015986]"	ADP binding [GO:0043531]; ATP binding [GO:0005524]	PPGCEVF	tr|A0A2J6KNQ4|A0A2J6KNQ4_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_8X134580 PE=3 SV=1	0.89085	1.378	1157700	1801200	2492000	1553100	923390	1042900	0	0	941620	0	1157700	0	0	944320	1450800	652880	465240	165090	1748000	1069500	1801200	702580	784080	275660	512060	561030	2039700	2492000	660550	1665700	874340	1335000	0	801550	1420100	1553100	1390200	1383400	866560	944720	456540	578200	0	729910	393870	550200	801100	923390	742620	514990
A0A2J6KQ37	A0A2J6KQ37_LACSA	MI domain-containing protein	LSAT_8X21381	Lactuca sativa (Garden lettuce)	"mRNA splicing, via spliceosome [GO:0000398]; regulation of translation [GO:0006417]"	catalytic step 2 spliceosome [GO:0071013]	"catalytic step 2 spliceosome [GO:0071013]; RNA binding [GO:0003723]; mRNA splicing, via spliceosome [GO:0000398]; regulation of translation [GO:0006417]"	RNA binding [GO:0003723]	SDNDDDK	tr|A0A2J6KQ37|A0A2J6KQ37_LACSA MI domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_8X21381 PE=4 SV=1	0.94444	2.756	28727	2144.5	5319.1	0	66529	0	28727	0	0	0	0	0	0	0	2144.5	0	0	0	0	0	0	0	0	0	0	1570.9	5319.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5992.3	66529	0	0	0	15441	0	0	0
A0A2J6KSN2	A0A2J6KSN2_LACSA	TCP domain-containing protein	LSAT_1X4641	Lactuca sativa (Garden lettuce)	regulation of secondary shoot formation [GO:2000032]	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; regulation of secondary shoot formation [GO:2000032]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	SCSSSRK	tr|A0A2J6KSN2|A0A2J6KSN2_LACSA TCP domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_1X4641 PE=4 SV=1	0.87085	1.378	0	73050	59884	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27912	0	0	0	0	73050	0	0	0	0	0	0	59884	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6KSQ9	A0A2J6KSQ9_LACSA	Uncharacterized protein	LSAT_3X140321	Lactuca sativa (Garden lettuce)					KPLGFVK	tr|A0A2J6KSQ9|A0A2J6KSQ9_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_3X140321 PE=4 SV=1;tr|A0A6S7MPY5|A0A6S7MPY5_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS18005 PE=4 SV=1;tr|A0A2U1MPL5|A0A2U1MPL5_ARTAN RING-	0.75	2.756	16990	0	0	12291	12520	0	0	0	0	0	0	16990	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12291	0	0	0	0	0	0	0	0	0	12520
A0A2J6KVE6	A0A2J6KVE6_LACSA	Uncharacterized protein	LSAT_3X4660	Lactuca sativa (Garden lettuce)		Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; antiporter activity [GO:0015297]; UDP-galactose transmembrane transporter activity [GO:0005459]; UDP-glucose transmembrane transporter activity [GO:0005460]	antiporter activity [GO:0015297]; UDP-galactose transmembrane transporter activity [GO:0005459]; UDP-glucose transmembrane transporter activity [GO:0005460]	FFKRQSLIQQFPVIQFR	tr|A0A2J6KVE6|A0A2J6KVE6_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_3X4660 PE=4 SV=1	0.86861	1.378	23131	18960	4991.3	0	0	0	0	0	9824	0	0	23131	0	0	0	0	0	0	18960	0	0	13078	0	0	4991.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6KVX9	A0A2J6KVX9_LACSA	Uncharacterized protein	LSAT_9X112021	Lactuca sativa (Garden lettuce)					YCEICCEECK	tr|A0A2J6KVX9|A0A2J6KVX9_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_9X112021 PE=3 SV=1	0.89691	1.378	0	5099.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5099.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6KWH8	A0A2J6KWH8_LACSA	Uncharacterized protein	LSAT_5X54581	Lactuca sativa (Garden lettuce)					VIRVPPK	tr|A0A2J6KWH8|A0A2J6KWH8_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_5X54581 PE=4 SV=1;tr|A0A6S7MR84|A0A6S7MR84_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS17018 PE=4 SV=1	0.89965	1.378	66420	93233	126930	59055	46280	0	34753	34943	0	0	0	62647	66420	0	0	0	0	93233	69669	0	0	63733	0	10309	52801	0	0	0	0	0	0	126930	56459	10859	0	54112	28270	0	59055	0	0	0	0	0	36810	0	40454	46280	13002	0
A0A2J6KWM1	A0A2J6KWM1_LACSA	Uncharacterized protein	LSAT_3X136841	Lactuca sativa (Garden lettuce)			5'-nucleotidase activity [GO:0008253]; metal ion binding [GO:0046872]	5'-nucleotidase activity [GO:0008253]; metal ion binding [GO:0046872]	NLNEMCYDYR	tr|A0A2J6KWM1|A0A2J6KWM1_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_3X136841 PE=4 SV=1;tr|A0A2J6L9Z4|A0A2J6L9Z4_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_6X118301 PE=3 SV=1;tr|A0A6S7NZU4|A0A6S7NZU4_LACSI Uncharact	0.86909	1.378	0	0	0	14487	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14487	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6L257	A0A2J6L257_LACSA	Uncharacterized protein	LSAT_9X72241	Lactuca sativa (Garden lettuce)					KATTSKN	tr|A0A2J6L257|A0A2J6L257_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_9X72241 PE=4 SV=1	0.86245	1.378	35610	33340	33961	61104	34678	26731	33857	27146	35610	28115	0	0	0	0	0	0	0	0	17190	0	0	0	33340	0	0	0	0	1367.7	0	33961	0	0	61104	32339	0	0	0	0	0	0	0	0	0	30978	0	18819	0	30792	25490	34678
A0A2J6L3F8	A0A2J6L3F8_LACSA	Protein kinase domain-containing protein	LSAT_3X24421	Lactuca sativa (Garden lettuce)	signal transduction [GO:0007165]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; protein serine/threonine kinase activity [GO:0004674]; signal transduction [GO:0007165]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; protein serine/threonine kinase activity [GO:0004674]	RLLLKHK	tr|A0A2J6L3F8|A0A2J6L3F8_LACSA Protein kinase domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_3X24421 PE=4 SV=1;tr|A0A5N6NRS5|A0A5N6NRS5_9ASTR Protein kinase domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_17220 PE=4 SV=1;tr|A	0.79731	1.378	26159	59799	0	0	7789	23303	0	0	0	0	0	0	26159	0	0	0	31048	0	0	59799	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7717.2	0	7789	0	0
A0A2J6L4A6	A0A2J6L4A6_LACSA	Thioredoxin domain-containing protein	LSAT_1X12401	Lactuca sativa (Garden lettuce)	protein folding [GO:0006457]; response to endoplasmic reticulum stress [GO:0034976]	endoplasmic reticulum [GO:0005783]; integral component of membrane [GO:0016021]	endoplasmic reticulum [GO:0005783]; integral component of membrane [GO:0016021]; protein disulfide isomerase activity [GO:0003756]; protein folding [GO:0006457]; response to endoplasmic reticulum stress [GO:0034976]	protein disulfide isomerase activity [GO:0003756]	ASDDKED	tr|A0A2J6L4A6|A0A2J6L4A6_LACSA Thioredoxin domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_1X12401 PE=4 SV=1	0.86312	1.378	0	90835	24446	0	92878	0	0	0	0	0	0	0	0	0	37058	0	0	90835	0	0	0	0	0	0	24446	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	92878	0	0	0	0	0	0
A0A2J6L7M6	A0A2J6L7M6_LACSA	Uncharacterized protein	LSAT_1X53881	Lactuca sativa (Garden lettuce)					RPAARIK	tr|A0A2J6L7M6|A0A2J6L7M6_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_1X53881 PE=4 SV=1;tr|A0A6S7KTE0|A0A6S7KTE0_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS1163 PE=4 SV=1	0.86742	1.378	0	0	8447.9	0	2398.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8447.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2398.2	0	0	0	0	0	0	0
A0A2J6LC72	A0A2J6LC72_LACSA	Uncharacterized protein	LSAT_6X10381	Lactuca sativa (Garden lettuce)		anchored component of plasma membrane [GO:0046658]	anchored component of plasma membrane [GO:0046658]; electron transfer activity [GO:0009055]	electron transfer activity [GO:0009055]	CCEEGSMK	tr|A0A2J6LC72|A0A2J6LC72_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_6X10381 PE=4 SV=1;tr|A0A6S7NYT7|A0A6S7NYT7_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS28191 PE=4 SV=1	0.84211	2.001	6003.3	0	0	0	5570.9	0	0	0	0	0	0	6003.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5570.9
A0A2J6LER7	A0A2J6LER7_LACSA	Uncharacterized protein	LSAT_3X113841	Lactuca sativa (Garden lettuce)					GGKGGVM	tr|A0A2J6LER7|A0A2J6LER7_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_3X113841 PE=4 SV=1	0.85878	1.378	0	0	10160	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10160	7106.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6LF77	A0A2J6LF77_LACSA	Uncharacterized protein	LSAT_4X54081	Lactuca sativa (Garden lettuce)					LKKIQYR	tr|A0A2J6LF77|A0A2J6LF77_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_4X54081 PE=4 SV=1	0.86496	1.378	24079	0	0	0	5580.8	0	0	9806	0	24079	0	0	5822.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5580.8	0
A0A2J6LHJ2	A0A2J6LHJ2_LACSA	40S ribosomal protein S8	LSAT_5X7581	Lactuca sativa (Garden lettuce)	"maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000462]; translation [GO:0006412]"	cytosolic small ribosomal subunit [GO:0022627]	"cytosolic small ribosomal subunit [GO:0022627]; structural constituent of ribosome [GO:0003735]; maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000462]; translation [GO:0006412]"	structural constituent of ribosome [GO:0003735]	GKSGATA	tr|A0A2J6LHJ2|A0A2J6LHJ2_LACSA 40S ribosomal protein S8 OS=Lactuca sativa OX=4236 GN=LSAT_5X7581 PE=3 SV=1	0.86347	1.378	15395	0	16303	0	0	0	0	0	0	0	15395	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16303	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6LIK3	A0A2J6LIK3_LACSA	Uncharacterized protein	LSAT_5X135221	Lactuca sativa (Garden lettuce)	nucleolar large rRNA transcription by RNA polymerase I [GO:0042790]; RNA polymerase I preinitiation complex assembly [GO:0001188]; transcription elongation from RNA polymerase I promoter [GO:0006362]	RNA polymerase I complex [GO:0005736]	RNA polymerase I complex [GO:0005736]; DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; nucleolar large rRNA transcription by RNA polymerase I [GO:0042790]; RNA polymerase I preinitiation complex assembly [GO:0001188]; transcription elongation from RNA polymerase I promoter [GO:0006362]	DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]	KSTSFNK	"tr|A0A2J6LIK3|A0A2J6LIK3_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_5X135221 PE=3 SV=1;tr|A0A251TNH9|A0A251TNH9_HELAN Putative DNA binding,DNA-directed RNA polymerase OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0312341 PE=3 SV=1;tr|A"	0.82897	1.378	0	0	0	0	38325	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38325	0	0	0	0	0	0	0
A0A2J6LKV7	A0A2J6LKV7_LACSA	tRNA-synt_His domain-containing protein	LSAT_3X107861	Lactuca sativa (Garden lettuce)	histidyl-tRNA aminoacylation [GO:0006427]; mitochondrial translation [GO:0032543]	cytosol [GO:0005829]; mitochondrion [GO:0005739]	cytosol [GO:0005829]; mitochondrion [GO:0005739]; histidine-tRNA ligase activity [GO:0004821]; histidyl-tRNA aminoacylation [GO:0006427]; mitochondrial translation [GO:0032543]	histidine-tRNA ligase activity [GO:0004821]	KPVKLPR	tr|A0A2J6LKV7|A0A2J6LKV7_LACSA tRNA-synt_His domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_3X107861 PE=4 SV=1	0.90805	1.6935	0	0	19629	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19629	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6LL83	A0A2J6LL83_LACSA	RRM domain-containing protein	LSAT_6X111041	Lactuca sativa (Garden lettuce)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	DNAGHRR	tr|A0A2J6LL83|A0A2J6LL83_LACSA RRM domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_6X111041 PE=4 SV=1	0.86692	1.378	0	0	12313	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12313	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6LQY0	A0A2J6LQY0_LACSA	Uncharacterized protein	LSAT_3X102300	Lactuca sativa (Garden lettuce)					PKAEIVIVNLDPALKTR	tr|A0A2J6LQY0|A0A2J6LQY0_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_3X102300 PE=4 SV=1	0.86142	1.378	0	0	0	44559	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	44559	0	0	0	0	0	0	0	0	0
A0A2J6LT62	A0A2J6LT62_LACSA	Uncharacterized protein	LSAT_2X19801	Lactuca sativa (Garden lettuce)	aromatic compound biosynthetic process [GO:0019438]; methylation [GO:0032259]		O-methyltransferase activity [GO:0008171]; protein dimerization activity [GO:0046983]; S-adenosylmethionine-dependent methyltransferase activity [GO:0008757]; aromatic compound biosynthetic process [GO:0019438]; methylation [GO:0032259]	O-methyltransferase activity [GO:0008171]; protein dimerization activity [GO:0046983]; S-adenosylmethionine-dependent methyltransferase activity [GO:0008757]	LGGIPIK	tr|A0A2J6LT62|A0A2J6LT62_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_2X19801 PE=3 SV=1	0.86567	1.378	0	6785.6	23024	13995	12556	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6785.6	0	0	7420	0	11894	0	23024	0	0	0	6610.2	0	0	0	0	0	13995	9592.9	6686	0	12556	0	0	0	0	0	0	0	0
A0A2J6LU08	A0A2J6LU08_LACSA	Protein kinase domain-containing protein	LSAT_2X46981	Lactuca sativa (Garden lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	QWSLPPK	tr|A0A2J6LU08|A0A2J6LU08_LACSA Protein kinase domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_2X46981 PE=4 SV=1;tr|A0A5N6Q2N5|A0A5N6Q2N5_9ASTR Protein kinase domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_01224 PE=3 SV=1;tr|A	0.8404	1.378	0	25970	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25970	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6LUZ4	A0A2J6LUZ4_LACSA	Uncharacterized protein	LSAT_4X97800	Lactuca sativa (Garden lettuce)			acid phosphatase activity [GO:0003993]	acid phosphatase activity [GO:0003993]	LYKKLLK	tr|A0A2J6LUZ4|A0A2J6LUZ4_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_4X97800 PE=4 SV=1;tr|A0A251RT02|A0A251RT02_HELAN Putative SGNH hydrolase-type esterase domain-containing protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0563641 	0.83898	1.378	2558500	1557500	1300200	4535300	1796000	725350	2141800	11318	971820	0	0	2558500	0	0	17030	1327000	91687	0	0	1025500	1507500	1557500	1135100	0	0	0	0	0	41572	0	1300200	0	4535300	0	0	39488	1128100	1827400	0	694930	19055	0	0	0	0	0	2904.9	1796000	0	0
A0A2J6LV31	A0A2J6LV31_LACSA	Protein DETOXIFICATION (Multidrug and toxic compound extrusion protein)	LSAT_8X120320	Lactuca sativa (Garden lettuce)		chloroplast [GO:0009507]; integral component of membrane [GO:0016021]	chloroplast [GO:0009507]; integral component of membrane [GO:0016021]; antiporter activity [GO:0015297]; xenobiotic transmembrane transporter activity [GO:0042910]	antiporter activity [GO:0015297]; xenobiotic transmembrane transporter activity [GO:0042910]	QETMGNGNAEDSNDGQK	tr|A0A2J6LV31|A0A2J6LV31_LACSA Protein DETOXIFICATION OS=Lactuca sativa OX=4236 GN=LSAT_8X120320 PE=3 SV=1;tr|A0A6S7KYP6|A0A6S7KYP6_LACSI Protein DETOXIFICATION OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS813 PE=3 SV=1	0.90175	1.378	0	118150	101560	121880	135780	0	0	0	0	0	0	0	0	0	0	0	0	118150	111960	0	31248	0	0	0	20059	101560	0	0	0	0	0	0	0	51869	121880	0	0	0	0	0	0	135780	0	0	0	0	0	34078	41974	0
A0A2J6LYD7	A0A2J6LYD7_LACSA	Uncharacterized protein	LSAT_9X111100	Lactuca sativa (Garden lettuce)					GCEGNGK	tr|A0A2J6LYD7|A0A2J6LYD7_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_9X111100 PE=4 SV=1	0.93645	1.378	0	0	0	37231	18015	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17708	37231	0	0	0	18015	0	0	0	0	0	0	0	0
A0A2J6LZY9	A0A2J6LZY9_LACSA	DYW_deaminase domain-containing protein	LSAT_5X183100	Lactuca sativa (Garden lettuce)			zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	RAIQPGR	tr|A0A2J6LZY9|A0A2J6LZY9_LACSA DYW_deaminase domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_5X183100 PE=3 SV=1;tr|A0A103XW42|A0A103XW42_CYNCS Pentatricopeptide repeat-containing protein (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 G	0.92308	1.5954	0	0	1985.7	242360	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1985.7	0	0	0	0	242360	16594	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6M1L6	A0A2J6M1L6_LACSA	Uncharacterized protein	LSAT_9X68580	Lactuca sativa (Garden lettuce)	defense response [GO:0006952]; response to biotic stimulus [GO:0009607]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; defense response [GO:0006952]; response to biotic stimulus [GO:0009607]		PVRGQHEVDISDFSFGR	tr|A0A2J6M1L6|A0A2J6M1L6_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_9X68580 PE=3 SV=1	0.94719	1.378	0	0	0	158520	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	158520	0	0	0	0	0	0	0	0	0
A0A2J6M1W6	A0A2J6M1W6_LACSA	Alpha_adaptinC2 domain-containing protein	LSAT_2X96621	Lactuca sativa (Garden lettuce)	clathrin-dependent endocytosis [GO:0072583]; intracellular protein transport [GO:0006886]; receptor-mediated endocytosis [GO:0006898]	AP-2 adaptor complex [GO:0030122]	AP-2 adaptor complex [GO:0030122]; cargo adaptor activity [GO:0140312]; clathrin adaptor activity [GO:0035615]; clathrin-dependent endocytosis [GO:0072583]; intracellular protein transport [GO:0006886]; receptor-mediated endocytosis [GO:0006898]	cargo adaptor activity [GO:0140312]; clathrin adaptor activity [GO:0035615]	GMGSLAM	tr|A0A2J6M1W6|A0A2J6M1W6_LACSA Alpha_adaptinC2 domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_2X96621 PE=3 SV=1;tr|A0A165A9K1|A0A165A9K1_DAUCS AP-2 complex subunit alpha OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_015485 PE=3 SV=1;tr|A0A1	0.80388	1.378	2209.9	1793.1	0	2320.8	0	0	0	0	0	0	2209.9	0	0	0	1793.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2320.8	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6M2S0	A0A2J6M2S0_LACSA	Uncharacterized protein	LSAT_4X138820	Lactuca sativa (Garden lettuce)		Set1C/COMPASS complex [GO:0048188]	Set1C/COMPASS complex [GO:0048188]		VRKPLPK	tr|A0A2J6M2S0|A0A2J6M2S0_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_4X138820 PE=4 SV=1;tr|A0A6S7NAA9|A0A6S7NAA9_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS21855 PE=4 SV=1	0.9396	1.378	1790.5	0	0	0	0	0	0	0	1790.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6M2Z5	A0A2J6M2Z5_LACSA	Uncharacterized protein	LSAT_8X141780	Lactuca sativa (Garden lettuce)	double-strand break repair via synthesis-dependent strand annealing [GO:0045003]; interstrand cross-link repair [GO:0036297]; replication fork reversal [GO:0071932]		3'-5' DNA helicase activity [GO:0043138]; ATP binding [GO:0005524]; four-way junction DNA binding [GO:0000400]; four-way junction helicase activity [GO:0009378]; hydrolase activity [GO:0016787]; double-strand break repair via synthesis-dependent strand annealing [GO:0045003]; interstrand cross-link repair [GO:0036297]; replication fork reversal [GO:0071932]	3'-5' DNA helicase activity [GO:0043138]; ATP binding [GO:0005524]; four-way junction DNA binding [GO:0000400]; four-way junction helicase activity [GO:0009378]; hydrolase activity [GO:0016787]	SCAQLDR	tr|A0A2J6M2Z5|A0A2J6M2Z5_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_8X141780 PE=3 SV=1	0.93857	1.378	22546	0	21926	15956	14828	14771	12301	20918	0	22546	0	0	0	21450	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21926	11385	0	15956	0	0	0	0	0	0	0	0	0	0	0	0	10558	0	0	14828	0
A0A2J6M559	A0A2J6M559_LACSA	RWD domain-containing protein	LSAT_1X36441	Lactuca sativa (Garden lettuce)	cytoplasmic translation [GO:0002181]	polysome [GO:0005844]	polysome [GO:0005844]; cytoplasmic translation [GO:0002181]		QGSRKLK	tr|A0A2J6M559|A0A2J6M559_LACSA RWD domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_1X36441 PE=4 SV=1;tr|A0A6S7LGW8|A0A6S7LGW8_LACSI RWD domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS8020 PE=4 SV=1;tr|A0A6L2N9K0|A0A6L2N9K0_T	0.80398	1.378	6850.8	0	0	0	9255.9	0	0	6850.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9255.9	0
A0A2J6M6T3	A0A2J6M6T3_LACSA	Uncharacterized protein	LSAT_8X146920	Lactuca sativa (Garden lettuce)	lipid transport [GO:0006869]		lipid binding [GO:0008289]; lipid transport [GO:0006869]	lipid binding [GO:0008289]	GFSRNSK	tr|A0A2J6M6T3|A0A2J6M6T3_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_8X146920 PE=4 SV=1;tr|A0A6S7M0M2|A0A6S7M0M2_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS5856 PE=4 SV=1	0.90034	1.378	0	0	0	0	12799	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12799	0	0	0
A0A2J6M7H4	A0A2J6M7H4_LACSA	Protein kinase domain-containing protein	LSAT_4X88460	Lactuca sativa (Garden lettuce)			ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	GEMKEKFVEIENDEMFR	tr|A0A2J6M7H4|A0A2J6M7H4_LACSA Protein kinase domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_4X88460 PE=3 SV=1;tr|A0A6S7MWD7|A0A6S7MWD7_LACSI Protein kinase domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS20517 PE=3 SV=1	0.87097	1.378	0	0	0	101020	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	101020	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6M8I3	A0A2J6M8I3_LACSA	HTH myb-type domain-containing protein	LSAT_6X66681	Lactuca sativa (Garden lettuce)	"positive regulation of transcription, DNA-templated [GO:0045893]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; transcription cis-regulatory region binding [GO:0000976]; positive regulation of transcription, DNA-templated [GO:0045893]"	DNA-binding transcription factor activity [GO:0003700]; transcription cis-regulatory region binding [GO:0000976]	VLKGPFK	tr|A0A2J6M8I3|A0A2J6M8I3_LACSA HTH myb-type domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_6X66681 PE=4 SV=1;tr|A0A103XFF3|A0A103XFF3_CYNCS Homeodomain-like protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_008276 PE=4 SV=1;tr|A0A2J	0.80203	1.378	0	0	0	16869	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16869	0	0	0	0	0	0	0	0	0	0	0
A0A2J6M8U1	A0A2J6M8U1_LACSA	Aconitase domain-containing protein	LSAT_9X38321	Lactuca sativa (Garden lettuce)			iron-sulfur cluster binding [GO:0051536]; metal ion binding [GO:0046872]	iron-sulfur cluster binding [GO:0051536]; metal ion binding [GO:0046872]	NNGSKRK	tr|A0A2J6M8U1|A0A2J6M8U1_LACSA Aconitase domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_9X38321 PE=4 SV=1;tr|A0A2J6LUM5|A0A2J6LUM5_LACSA Aconitase domain-containing protein OS=Lactuca sativa OX=4236 GN=LSAT_1X49360 PE=4 SV=1;tr|A0A2J6LLH6|A0A2	0.85593	1.378	0	0	3504.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3504.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2J6MDB7	A0A2J6MDB7_LACSA	Uncharacterized protein	LSAT_4X134780	Lactuca sativa (Garden lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VPVKILK	tr|A0A2J6MDB7|A0A2J6MDB7_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_4X134780 PE=4 SV=1;tr|A0A251TUP4|A0A251TUP4_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr09g0254151 PE=4 SV=1;tr|A0A5N6NV74|A0A5N6NV74_9AST	0.84375	2.1262	17966	0	13347	0	5509.1	0	0	0	7708.8	0	0	0	0	17966	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13347	0	0	0	0	0	0	0	0	0	0	0	0	0	4339.8	0	0	0	0	5509.1	0
A0A2J6MDQ4	A0A2J6MDQ4_LACSA	Uncharacterized protein	LSAT_8X5381	Lactuca sativa (Garden lettuce)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		YSSGSDK	tr|A0A2J6MDQ4|A0A2J6MDQ4_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_8X5381 PE=4 SV=1;tr|A0A6S7LX26|A0A6S7LX26_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS1392 PE=4 SV=1	0.78905	1.378	0	0	0	0	5766.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5766.9
A0A2J6MF83	A0A2J6MF83_LACSA	Tubby-like F-box protein	LSAT_7X102620	Lactuca sativa (Garden lettuce)					WDDSTER	tr|A0A2J6MF83|A0A2J6MF83_LACSA Tubby-like F-box protein OS=Lactuca sativa OX=4236 GN=LSAT_7X102620 PE=3 SV=1	0.88968	1.378	41794	0	0	0	70698	0	0	41794	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	70698	0	0	0	0	0	0	0	0
A0A2J6MGA8	A0A2J6MGA8_LACSA	Uncharacterized protein	LSAT_1X31881	Lactuca sativa (Garden lettuce)					VPVKPLK	tr|A0A2J6MGA8|A0A2J6MGA8_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_1X31881 PE=4 SV=1	0.89046	1.378	0	0	111100	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	111100	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F5AL77	F5AL77_9ASTR	Serine/threonine phosphatase (Fragment)		Lactuca virosa		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VFRVIRR	tr|F5AL77|F5AL77_9ASTR Serine/threonine phosphatase (Fragment) OS=Lactuca virosa OX=75947 PE=4 SV=1;tr|F5AL76|F5AL76_LACSI Serine/threonine phosphatase (Fragment) OS=Lactuca saligna OX=75948 PE=4 SV=1;tr|F5AL57|F5AL57_LACSI Serine/threonine phosphatase (Fr	0.94408	1.378	0	19548	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19548	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1Z2QUJ8	A0A1Z2QUJ8_9ASTR	Protein Ycf2	ycf2 Le_val1Pt0801 Le_val1Pt1380	Legenere valdiviana		chloroplast stroma [GO:0009570]	chloroplast stroma [GO:0009570]; ATP binding [GO:0005524]	ATP binding [GO:0005524]	ELVRELQWLFKLFELNM	tr|A0A1Z2QUJ8|A0A1Z2QUJ8_9ASTR Protein Ycf2 OS=Legenere valdiviana OX=2010882 GN=ycf2 PE=3 SV=1	0.94881	1.378	26622	23021	16509	26796	0	26622	11645	13689	18332	0	0	0	15307	0	23021	0	0	0	0	0	0	13159	0	15474	16509	0	0	0	0	0	0	0	0	5019.7	0	0	0	0	0	0	26796	0	0	0	0	0	0	0	0	0
A0A6M8PY74	A0A6M8PY74_9ASTR	Protein TIC 214 (Translocon at the inner envelope membrane of chloroplasts 214)	ycf1 TIC214	Leptocodon hirsutus	protein transport [GO:0015031]	chloroplast inner membrane [GO:0009706]; integral component of membrane [GO:0016021]	chloroplast inner membrane [GO:0009706]; integral component of membrane [GO:0016021]; protein transport [GO:0015031]		PPIVRVLK	tr|A0A6M8PY74|A0A6M8PY74_9ASTR Protein TIC 214 OS=Leptocodon hirsutus OX=1334537 GN=ycf1 PE=3 SV=1	0.79625	1.378	0	0	0	4629.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4629.1	0	0	0	0	0	0	0	0	0	0
A0A076L9Z0	A0A076L9Z0_9ASTR	AccD (Fragment)	accD	Liabellum palmeri	fatty acid biosynthetic process [GO:0006633]	acetyl-CoA carboxylase complex [GO:0009317]; chloroplast [GO:0009507]	acetyl-CoA carboxylase complex [GO:0009317]; chloroplast [GO:0009507]; acetyl-CoA carboxylase activity [GO:0003989]; ATP binding [GO:0005524]; fatty acid biosynthetic process [GO:0006633]	acetyl-CoA carboxylase activity [GO:0003989]; ATP binding [GO:0005524]	EQENFMK	tr|A0A076L9Z0|A0A076L9Z0_9ASTR AccD (Fragment) OS=Liabellum palmeri OX=1227316 GN=accD PE=3 SV=1	0.94893	1.378	0	24472	5429.9	20370	32837	0	0	0	0	0	0	0	0	0	0	0	13131	0	0	24472	12599	0	0	5429.9	0	0	0	0	0	0	0	0	0	0	0	0	7923.7	14593	20370	0	0	20599	32837	0	0	0	0	0	0	0
A0A7D3U8V3	A0A7D3U8V3_9APIA	Protein TIC 214 (Translocon at the inner envelope membrane of chloroplasts 214)	ycf1 TIC214	Ligusticum scapiforme	protein transport [GO:0015031]	chloroplast inner membrane [GO:0009706]; integral component of membrane [GO:0016021]	chloroplast inner membrane [GO:0009706]; integral component of membrane [GO:0016021]; protein transport [GO:0015031]		NNNLNNEFLNR	tr|A0A7D3U8V3|A0A7D3U8V3_9APIA Protein TIC 214 OS=Ligusticum scapiforme OX=496674 GN=ycf1 PE=3 SV=1;tr|A0A7D3QKS6|A0A7D3QKS6_9APIA Protein TIC 214 OS=Ligusticum likiangense OX=1553917 GN=ycf1 PE=3 SV=1	0.80792	1.378	16160	40561	37453	53603	31809	0	12878	14488	0	0	0	16160	0	0	15672	0	0	0	31936	0	0	0	40561	12043	7351.3	0	0	0	0	23025	37453	0	0	16521	0	0	0	0	0	53603	7912.2	0	0	4909.8	0	10330	10325	11718	8839	31809
A0A291EZR3	A0A291EZR3_9ASTR	Hypothetical chloroplast RF2	ycf2 Lo_pat1Pt0825 Lo_pat1Pt1537	Lobelia patula		integral component of membrane [GO:0016021]; plastid [GO:0009536]	integral component of membrane [GO:0016021]; plastid [GO:0009536]; ATP binding [GO:0005524]	ATP binding [GO:0005524]	WCRRGLR	tr|A0A291EZR3|A0A291EZR3_9ASTR Hypothetical chloroplast RF2 OS=Lobelia patula OX=2041133 GN=ycf2 PE=3 SV=1	0.90299	1.378	0	4842.8	0	9792.3	26295	0	0	0	0	0	0	0	0	0	4842.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9792.3	0	0	0	0	0	0	0	0	26295	0
A0A1Z2R3E4	A0A1Z2R3E4_9ASTR	Ribosomal protein S11	rps11 Lo_spn2Pt0769	Lobelia sp. 2 EBK-2017	translation [GO:0006412]	plastid [GO:0009536]; ribosome [GO:0005840]	plastid [GO:0009536]; ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	LKLKAAM	tr|A0A1Z2R3E4|A0A1Z2R3E4_9ASTR Ribosomal protein S11 OS=Lobelia sp. 2 EBK-2017 OX=2010900 GN=rps11 PE=3 SV=1;tr|A0A1Z2R006|A0A1Z2R006_9ASTR Ribosomal protein S11 OS=Lobelia melliana OX=1715894 GN=rps11 PE=3 SV=1;tr|A0A1Z2QST5|A0A1Z2QST5_9ASTR Ribosomal pro	0.94539	1.378	0	0	6102.3	11545	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6102.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11545	7980.4	0	0	0	0	0	0	0	0	0
A0A4D6CY86	A0A4D6CY86_9ASTR	Protein TIC 214 (Translocon at the inner envelope membrane of chloroplasts 214)	ycf1 TIC214	Marshallia ramosa	protein transport [GO:0015031]	chloroplast inner membrane [GO:0009706]; integral component of membrane [GO:0016021]	chloroplast inner membrane [GO:0009706]; integral component of membrane [GO:0016021]; protein transport [GO:0015031]		NKSYIYR	tr|A0A4D6CY86|A0A4D6CY86_9ASTR Protein TIC 214 OS=Marshallia ramosa OX=1611549 GN=ycf1 PE=3 SV=1;tr|A0A4D6CZ58|A0A4D6CZ58_MARCE Protein TIC 214 OS=Marshallia caespitosa OX=41604 GN=ycf1 PE=3 SV=1;tr|A0A4D6CYQ1|A0A4D6CYQ1_9ASTR Protein TIC 214 OS=Marshallia	0.79207	1.378	19171	28762	21291	24869	13418	13252	16139	17344	0	0	0	0	19171	0	17793	0	0	28762	0	0	0	0	0	11151	0	0	0	0	0	0	0	21291	0	0	0	24869	0	0	0	0	22704	0	0	0	11780	10237	0	13418	0	0
A0A126X0H3	A0A126X0H3_MATMA	Putative LOV domain-containing protein		Matricaria matricarioides (Pineapple-weed) (Artemisia matricarioides)	protein-chromophore linkage [GO:0018298]; response to stimulus [GO:0050896]		ATP binding [GO:0005524]; photoreceptor activity [GO:0009881]; protein kinase activity [GO:0004672]; protein-chromophore linkage [GO:0018298]; response to stimulus [GO:0050896]	ATP binding [GO:0005524]; photoreceptor activity [GO:0009881]; protein kinase activity [GO:0004672]	QPLKLFR	tr|A0A126X0H3|A0A126X0H3_MATMA Putative LOV domain-containing protein OS=Matricaria matricarioides OX=56017 PE=2 SV=1	0.88374	1.378	0	0	0	0	8653.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8653.2	0	0	0	0	0	0	0	0
A0A5N6L6W3	A0A5N6L6W3_9ASTR	Uncharacterized protein	E3N88_46234	Mikania micrantha	"transcription, DNA-templated [GO:0006351]"		"DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; transcription, DNA-templated [GO:0006351]"	DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]	ARAGQIG	tr|A0A5N6L6W3|A0A5N6L6W3_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_46234 PE=3 SV=1	0.79396	1.378	0	3622.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3622.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6L7J3	A0A5N6L7J3_9ASTR	Uncharacterized protein	E3N88_46086	Mikania micrantha		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		PLHSGTR	tr|A0A5N6L7J3|A0A5N6L7J3_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_46086 PE=3 SV=1	0.90323	1.378	0	0	0	1222200	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1222200	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LA21	A0A5N6LA21_9ASTR	Uncharacterized protein	E3N88_45135	Mikania micrantha					STHTTSR	tr|A0A5N6LA21|A0A5N6LA21_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_45135 PE=4 SV=1;tr|A0A5N6PG81|A0A5N6PG81_9ASTR Integrase catalytic domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_08446 PE=4 SV=1	0.77903	1.378	0	0	249110	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	249110	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LAP4	A0A5N6LAP4_9ASTR	FolB domain-containing protein	E3N88_44908	Mikania micrantha	folic acid-containing compound metabolic process [GO:0006760]		dihydroneopterin aldolase activity [GO:0004150]; folic acid-containing compound metabolic process [GO:0006760]	dihydroneopterin aldolase activity [GO:0004150]	SDTHCEK	tr|A0A5N6LAP4|A0A5N6LAP4_9ASTR FolB domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_44908 PE=4 SV=1	0.77976	1.378	0	372960	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	49750	372960	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LAS5	A0A5N6LAS5_9ASTR	Uncharacterized protein	E3N88_44885	Mikania micrantha			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	RPTPCLR	tr|A0A5N6LAS5|A0A5N6LAS5_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_44885 PE=4 SV=1	0.78013	1.378	11174	10884	11220	10568	6680.1	0	0	0	0	11174	0	0	0	0	0	0	0	10884	9865.3	0	0	9286.2	0	0	7596	0	0	0	0	11220	0	0	0	0	0	10568	0	0	0	0	0	0	0	6680.1	0	0	0	0	0	0
A0A5N6LB72	A0A5N6LB72_9ASTR	Uncharacterized protein	E3N88_44953	Mikania micrantha		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		PVFDTFK	tr|A0A5N6LB72|A0A5N6LB72_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_44953 PE=4 SV=1	0.8882	1.378	0	6114	0	0	16448	0	0	0	0	0	0	0	0	0	0	0	6114	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16448	0	0	0	0	4713.9	0	0	0
A0A5N6LBP1	A0A5N6LBP1_9ASTR	Uncharacterized protein	E3N88_44776	Mikania micrantha					MMAKKYK	tr|A0A5N6LBP1|A0A5N6LBP1_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_44776 PE=4 SV=1	0.78197	1.378	21752	12060	1812200	11569	12462	0	13086	18863	0	0	0	0	21752	0	7557.8	0	12060	9546.6	0	0	0	0	0	5726.2	0	0	0	0	1812200	0	0	20792	0	8553.6	0	0	6794.6	0	0	0	11569	0	0	0	0	7287.5	0	0	12462	0
A0A5N6LBW7	A0A5N6LBW7_9ASTR	Uncharacterized protein	E3N88_44475	Mikania micrantha					RALLLIK	tr|A0A5N6LBW7|A0A5N6LBW7_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_44475 PE=4 SV=1;tr|A0A5N6LC26|A0A5N6LC26_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_44512 PE=4 SV=1;tr|A0A5N6LIF9|A0A5N6LIF9_9ASTR Unc	0.78271	1.378	5723.5	0	0	0	0	0	0	0	0	0	0	5723.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LD96	A0A5N6LD96_9ASTR	Uncharacterized protein	E3N88_44025	Mikania micrantha		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; zinc ion binding [GO:0008270]	DNA binding [GO:0003677]; zinc ion binding [GO:0008270]	TKKLLYR	tr|A0A5N6LD96|A0A5N6LD96_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_44025 PE=4 SV=1;tr|A0A5N6MX64|A0A5N6MX64_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_27579 PE=4 SV=1	0.28571	3.0026	0	0	14606	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14606	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LDQ7	A0A5N6LDQ7_9ASTR	Uncharacterized protein	E3N88_43851	Mikania micrantha			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	HYFCFSCIMEWSKVESR	"tr|A0A5N6LDQ7|A0A5N6LDQ7_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_43851 PE=4 SV=1;tr|A0A103YKW6|A0A103YKW6_CYNCS Zinc finger, FYVE/PHD-type OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_010573 PE=4 SV=1;tr|A0A5N6M0J7|A0A"	0.85441	1.378	0	0	17791	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17791	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LDX4	A0A5N6LDX4_9ASTR	Magnesium chelatase (EC 6.6.1.1)	E3N88_43782	Mikania micrantha	chlorophyll biosynthetic process [GO:0015995]; photosynthesis [GO:0015979]		ATP binding [GO:0005524]; magnesium chelatase activity [GO:0016851]; chlorophyll biosynthetic process [GO:0015995]; photosynthesis [GO:0015979]	ATP binding [GO:0005524]; magnesium chelatase activity [GO:0016851]	DEEMLKRLMNTNPNSFR	tr|A0A5N6LDX4|A0A5N6LDX4_9ASTR Magnesium chelatase OS=Mikania micrantha OX=192012 GN=E3N88_43782 PE=3 SV=1;tr|A0A5N6PF09|A0A5N6PF09_9ASTR Magnesium chelatase OS=Mikania micrantha OX=192012 GN=E3N88_10967 PE=3 SV=1	0.93919	1.378	0	0	0	238720	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	238720	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LE10	A0A5N6LE10_9ASTR	WRKY domain-containing protein	E3N88_43754	Mikania micrantha		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	NRTGHAR	tr|A0A5N6LE10|A0A5N6LE10_9ASTR WRKY domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_43754 PE=4 SV=1;tr|Q9SQ03|Q9SQ03_PETCR Transcription factor (Fragment) OS=Petroselinum crispum OX=4043 GN=WRKY3 PE=4 SV=1;tr|A0A5N6NI70|A0A5N6NI70_9ASTR W	0.82735	1.378	0	12948	10182	9667.9	5929.3	0	0	0	0	0	0	0	0	0	0	10502	12948	0	0	0	0	0	0	6629.9	0	8353	0	0	10182	0	0	0	0	0	0	0	0	9667.9	7441.8	0	0	0	0	0	5929.3	0	0	0	0	0
A0A5N6LE25	A0A5N6LE25_9ASTR	Uncharacterized protein	E3N88_20292 E3N88_43733	Mikania micrantha					DQCPCYR	tr|A0A5N6LE25|A0A5N6LE25_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_20292 PE=3 SV=1	0.78494	1.378	0	0	4971.7	8891.1	12117	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4971.7	0	0	0	0	0	0	0	0	0	0	0	0	8891.1	0	0	0	0	0	0	0	0	0	2966	0	12117	0
A0A5N6LEV2	A0A5N6LEV2_9ASTR	Uncharacterized protein	E3N88_44260	Mikania micrantha		Golgi apparatus [GO:0005794]	Golgi apparatus [GO:0005794]; glycosyltransferase activity [GO:0016757]	glycosyltransferase activity [GO:0016757]	CDTSKRR	"tr|A0A5N6LEV2|A0A5N6LEV2_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_44260 PE=4 SV=1;tr|A0A2U1KSA5|A0A2U1KSA5_ARTAN Homeodomain-like, Myb-like domain protein OS=Artemisia annua OX=35608 GN=CTI12_AA569980 PE=4 SV=1"	0.71875	2.756	0	67789	0	10676	0	0	0	0	0	0	0	0	0	0	0	0	0	67789	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10676	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LFU5	A0A5N6LFU5_9ASTR	GLOBIN domain-containing protein	E3N88_43430	Mikania micrantha			heme binding [GO:0020037]; metal ion binding [GO:0046872]; oxygen binding [GO:0019825]; oxygen carrier activity [GO:0005344]	heme binding [GO:0020037]; metal ion binding [GO:0046872]; oxygen binding [GO:0019825]; oxygen carrier activity [GO:0005344]	MGDDEGR	tr|A0A5N6LFU5|A0A5N6LFU5_9ASTR GLOBIN domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_43430 PE=3 SV=1	0.93103	1.378	64907	71846	61591	46259	22052	0	64907	50279	0	0	0	0	0	0	41352	0	0	71846	0	0	0	0	0	0	29207	0	0	0	46533	61591	0	0	0	0	0	0	0	0	0	46259	21981	0	0	0	17203	13961	22052	0	0	0
A0A5N6LGD1	A0A5N6LGD1_9ASTR	Uncharacterized protein	E3N88_42974	Mikania micrantha					PMGGPSR	tr|A0A5N6LGD1|A0A5N6LGD1_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_42974 PE=4 SV=1	0.79663	1.378	0	0	0	625000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35798	0	625000	0	0	0	0	0	0	0	0	0
A0A5N6LGP3	A0A5N6LGP3_9ASTR	Uncharacterized protein	E3N88_40170 E3N88_43105	Mikania micrantha					NTTTISI	tr|A0A5N6LGP3|A0A5N6LGP3_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_40170 PE=4 SV=1	0.93056	1.378	38808	32244	26605	26467	27260	38808	18442	0	0	31123	0	0	33630	0	0	0	0	29537	0	0	0	32244	0	26605	0	0	0	0	0	21312	10236	0	0	26467	0	13988	0	0	0	0	0	0	0	27260	0	13475	0	0	0	0
A0A5N6LH78	A0A5N6LH78_9ASTR	UDP-glucuronate decarboxylase (EC 4.1.1.35)	E3N88_38489 E3N88_42657	Mikania micrantha	D-xylose metabolic process [GO:0042732]; UDP-D-xylose biosynthetic process [GO:0033320]		NAD+ binding [GO:0070403]; UDP-glucuronate decarboxylase activity [GO:0048040]; D-xylose metabolic process [GO:0042732]; UDP-D-xylose biosynthetic process [GO:0033320]	NAD+ binding [GO:0070403]; UDP-glucuronate decarboxylase activity [GO:0048040]	RLGIPRV	tr|A0A5N6LH78|A0A5N6LH78_9ASTR UDP-glucuronate decarboxylase OS=Mikania micrantha OX=192012 GN=E3N88_38489 PE=3 SV=1	0.80908	1.378	0	30804	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30804	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LHE5	A0A5N6LHE5_9ASTR	Uncharacterized protein	E3N88_43365	Mikania micrantha			ATP binding [GO:0005524]	ATP binding [GO:0005524]	MGFCCYR	tr|A0A5N6LHE5|A0A5N6LHE5_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_43365 PE=4 SV=1	0.80987	1.378	13663	0	9192.8	0	0	0	0	0	0	0	0	0	0	13663	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9192.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LHN8	A0A5N6LHN8_9ASTR	Sulfotransferase (EC 2.8.2.-)	E3N88_42457	Mikania micrantha		cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; sulfotransferase activity [GO:0008146]	sulfotransferase activity [GO:0008146]	ISSFYLCR	tr|A0A5N6LHN8|A0A5N6LHN8_9ASTR Sulfotransferase OS=Mikania micrantha OX=192012 GN=E3N88_42457 PE=3 SV=1	0.84615	1.378	40766	79199	5581.9	55173	0	0	0	0	0	40766	0	39625	0	26883	0	0	0	0	46491	0	0	0	79199	0	0	0	0	0	0	0	5581.9	0	55173	22636	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LI11	A0A5N6LI11_9ASTR	Potassium transporter	E3N88_42347	Mikania micrantha		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; potassium ion transmembrane transporter activity [GO:0015079]	potassium ion transmembrane transporter activity [GO:0015079]	VNHPWIK	tr|A0A5N6LI11|A0A5N6LI11_9ASTR Potassium transporter OS=Mikania micrantha OX=192012 GN=E3N88_42347 PE=3 SV=1	0.81027	1.378	20291	19865	0	0	18964	0	0	0	11859	0	0	0	0	20291	0	0	0	0	19865	0	0	15661	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13708	0	0	0	18964
A0A5N6LI85	A0A5N6LI85_9ASTR	Uncharacterized protein	E3N88_42263	Mikania micrantha			GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	SNCCSSS	tr|A0A5N6LI85|A0A5N6LI85_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_42263 PE=4 SV=1;tr|A0A5N6M3A9|A0A5N6M3A9_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_35283 PE=4 SV=1	0.86517	1.378	37604	55479	139570	74346	32816	37604	0	0	0	0	0	0	0	0	0	32566	55479	0	0	0	19312	0	0	0	0	27774	0	0	52379	0	0	139570	0	0	0	25207	0	21500	48821	44708	74346	32816	0	0	19415	0	0	0	0	2051.8
A0A5N6LI88	A0A5N6LI88_9ASTR	Dof-type domain-containing protein	E3N88_42314	Mikania micrantha	"regulation of transcription, DNA-templated [GO:0006355]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]	RASTSTK	tr|A0A5N6LI88|A0A5N6LI88_9ASTR Dof-type domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_42314 PE=4 SV=1;tr|A0A5N6NJQ2|A0A5N6NJQ2_9ASTR Dof-type domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_21419 PE=4 SV=1	0.94118	2.756	10930	235490	195520	79393	190170	0	0	0	0	10841	0	0	0	10930	235490	0	0	9288.5	11976	0	0	12550	0	0	0	0	0	0	0	0	195520	0	12617	9959.3	0	0	0	0	0	79393	0	0	190170	10968	0	0	0	10815	0	0
A0A5N6LJ81	A0A5N6LJ81_9ASTR	Uncharacterized protein	E3N88_41998	Mikania micrantha					HVEIMDR	tr|A0A5N6LJ81|A0A5N6LJ81_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_41998 PE=4 SV=1;tr|A0A6L2MPN9|A0A6L2MPN9_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_047901 PE=4	0.81186	1.378	0	0	0	0	8866.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8866.5	0	0	0	0	0	0	0
A0A5N6LJM5	A0A5N6LJM5_9ASTR	Uncharacterized protein	E3N88_25798 E3N88_41799	Mikania micrantha					VHARNMK	tr|A0A5N6LJM5|A0A5N6LJM5_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_25798 PE=4 SV=1	0.81225	1.378	0	36996	0	3174300	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	36996	0	0	0	0	0	0	0	0	0	3174300	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LKA2	A0A5N6LKA2_9ASTR	Cytochrome c domain-containing protein	E3N88_41552	Mikania micrantha		mitochondrial intermembrane space [GO:0005758]	mitochondrial intermembrane space [GO:0005758]; electron transfer activity [GO:0009055]; heme binding [GO:0020037]; metal ion binding [GO:0046872]	electron transfer activity [GO:0009055]; heme binding [GO:0020037]; metal ion binding [GO:0046872]	RSDSDRNGDDEEDFDER	tr|A0A5N6LKA2|A0A5N6LKA2_9ASTR Cytochrome c domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_41552 PE=3 SV=1	0.89238	1.378	0	0	0	13619	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13619	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LKD1	A0A5N6LKD1_9ASTR	Uncharacterized protein	E3N88_41817	Mikania micrantha		nuclear pore [GO:0005643]	nuclear pore [GO:0005643]		HVFFQKK	tr|A0A5N6LKD1|A0A5N6LKD1_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_41817 PE=3 SV=1;tr|A0A251TSG8|A0A251TSG8_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr10g0315491 PE=3 SV=1;tr|A0A2J6K3Q3|A0A2J6K3Q3_L	0.80748	1.378	0	98765	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	98765	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LLJ1	A0A5N6LLJ1_9ASTR	Uncharacterized protein	E3N88_40004	Mikania micrantha					ALKKLGK	tr|A0A5N6LLJ1|A0A5N6LLJ1_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_40004 PE=4 SV=1;tr|A0A6L2NCC8|A0A6L2NCC8_TANCI Reverse transcriptase (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_055861 PE=4 SV=1	0.80164	1.378	0	20398	0	6874.1	7816.2	0	0	0	0	0	0	0	0	0	0	0	0	0	20398	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6874.1	0	0	0	0	0	0	0	5525.1	0	0	0	0	0	7816.2
A0A5N6LMD9	A0A5N6LMD9_9ASTR	Uncharacterized protein	E3N88_40343	Mikania micrantha	transcription elongation from RNA polymerase II promoter [GO:0006368]	elongin complex [GO:0070449]	elongin complex [GO:0070449]; transcription elongation from RNA polymerase II promoter [GO:0006368]		TACYNHR	tr|A0A5N6LMD9|A0A5N6LMD9_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_40343 PE=4 SV=1	0.81385	1.378	12845	10862	0	0	0	0	0	0	12845	0	0	0	0	0	0	0	0	0	10862	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LMY0	A0A5N6LMY0_9ASTR	Bet_v_1 domain-containing protein	E3N88_40560	Mikania micrantha	defense response [GO:0006952]		defense response [GO:0006952]		INIPQLQ	tr|A0A5N6LMY0|A0A5N6LMY0_9ASTR Bet_v_1 domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_40560 PE=4 SV=1	0.81425	1.378	0	0	0	0	5571.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5571.5
A0A5N6LN86	A0A5N6LN86_9ASTR	Uncharacterized protein	E3N88_40677	Mikania micrantha					EKMSHRR	tr|A0A5N6LN86|A0A5N6LN86_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_40677 PE=4 SV=1	0.81505	1.378	19432	16829	21954	22056	13252	0	0	0	0	0	19432	0	0	0	0	0	0	0	0	16829	13663	0	0	0	0	13631	21954	0	0	0	0	0	0	0	0	0	0	12104	11269	22056	7587.1	13252	0	0	10078	0	0	4485.5	0	0
A0A5N6LNI2	A0A5N6LNI2_9ASTR	RGS domain-containing protein	E3N88_40712	Mikania micrantha		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		RRLFSIR	tr|A0A5N6LNI2|A0A5N6LNI2_9ASTR RGS domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_40712 PE=4 SV=1	0.81545	1.378	0	0	49922	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	49922	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LNL1	A0A5N6LNL1_9ASTR	PMEI domain-containing protein	E3N88_40790	Mikania micrantha		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; enzyme inhibitor activity [GO:0004857]	enzyme inhibitor activity [GO:0004857]	KVVAMLK	tr|A0A5N6LNL1|A0A5N6LNL1_9ASTR PMEI domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_40790 PE=4 SV=1	0.81585	1.378	0	0	10742	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10742	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LNZ4	A0A5N6LNZ4_9ASTR	Uncharacterized protein	E3N88_40115	Mikania micrantha	DNA integration [GO:0015074]		catalytic activity [GO:0003824]; nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	catalytic activity [GO:0003824]; nucleic acid binding [GO:0003676]	HEGIRCK	tr|A0A5N6LNZ4|A0A5N6LNZ4_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_40115 PE=4 SV=1	0.81305	1.378	0	38281	0	94254	0	0	0	0	0	0	0	0	0	0	0	0	37440	0	0	38281	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34519	0	38285	94254	0	0	0	0	0	0	0	0	0	0
A0A5N6LQK3	A0A5N6LQK3_9ASTR	Uncharacterized protein	E3N88_41441	Mikania micrantha		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; glucuronosyltransferase activity [GO:0015020]	glucuronosyltransferase activity [GO:0015020]	QCQSENK	tr|A0A5N6LQK3|A0A5N6LQK3_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_41441 PE=4 SV=1;tr|A0A5N6LPX1|A0A5N6LPX1_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_40898 PE=4 SV=1	0.93407	1.5954	13906	0	22367	0	170100	0	0	13906	0	0	13470	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17621	22367	0	0	0	0	0	0	0	0	0	0	0	0	0	170100	11686	0	0	0	0	0	0	0
A0A5N6LQN8	A0A5N6LQN8_9ASTR	Uncharacterized protein	E3N88_41433	Mikania micrantha					GFCSDGK	tr|A0A5N6LQN8|A0A5N6LQN8_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_41433 PE=4 SV=1;tr|A0A5N6LNV7|A0A5N6LNV7_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_14534 PE=4 SV=1	0.81706	1.378	16493	0	4534.3	13365	7914.2	0	0	16493	0	0	0	0	0	11785	0	0	0	0	0	0	0	0	0	0	4534.3	0	0	0	0	0	0	0	0	0	0	13365	0	0	0	0	0	0	0	7914.2	0	0	0	0	0	0
A0A5N6LQS6	A0A5N6LQS6_9ASTR	Uncharacterized protein	E3N88_37334	Mikania micrantha					TMTMMGG	tr|A0A5N6LQS6|A0A5N6LQS6_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_37334 PE=4 SV=1	0.79894	1.378	333960	387110	113010	97198	141090	201880	186610	41355	187010	333960	0	76436	208820	231900	15948	0	35758	0	387110	141180	0	0	0	0	63100	0	0	0	0	101010	87275	113010	45278	62657	0	97198	50624	88331	38157	0	17636	141090	112020	63717	0	12694	35493	86646	0	19023
A0A5N6LR80	A0A5N6LR80_9ASTR	NB-ARC domain-containing protein	E3N88_37455	Mikania micrantha			ADP binding [GO:0043531]	ADP binding [GO:0043531]	HACQKNK	tr|A0A5N6LR80|A0A5N6LR80_9ASTR NB-ARC domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_37455 PE=4 SV=1	0.79932	1.378	0	6455.7	18967	6116.7	15214	0	0	0	0	0	0	0	0	0	0	6455.7	0	0	0	0	0	0	0	0	0	0	18967	0	0	0	0	0	0	0	0	0	0	6116.7	0	0	0	0	15214	0	2368.1	0	0	0	0	0
A0A5N6LRE0	A0A5N6LRE0_9ASTR	Phorbol-ester/DAG-type domain-containing protein	E3N88_40945	Mikania micrantha	intracellular signal transduction [GO:0035556]		intracellular signal transduction [GO:0035556]		SWVFHCPSCLEKHFYMR	tr|A0A5N6LRE0|A0A5N6LRE0_9ASTR Phorbol-ester/DAG-type domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_40945 PE=4 SV=1	0.88333	1.378	0	69719	18829	240900	0	0	0	0	0	0	0	0	0	0	0	69719	0	0	0	0	0	0	0	18829	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	240900	0	0	0	0	0	0	0	0	0
A0A5N6LS71	A0A5N6LS71_9ASTR	CASP-like protein	E3N88_37824	Mikania micrantha		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]		IIFYGDK	tr|A0A5N6LS71|A0A5N6LS71_9ASTR CASP-like protein OS=Mikania micrantha OX=192012 GN=E3N88_37824 PE=3 SV=1	0.80048	1.378	13463	15840	10716	14180	8431.5	0	0	0	0	12252	0	0	0	13463	0	0	0	13183	15840	0	0	12131	11879	0	0	0	0	0	0	0	10716	0	9309.7	9902.5	0	14180	0	0	0	0	0	0	0	0	0	0	0	8431.5	0	0
A0A5N6LUF8	A0A5N6LUF8_9ASTR	Protein kinase domain-containing protein	E3N88_38497	Mikania micrantha			ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	DGPADGK	tr|A0A5N6LUF8|A0A5N6LUF8_9ASTR Protein kinase domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_38497 PE=3 SV=1	0.80515	1.378	59461	19027	27016	26431	13213	29327	0	23673	22281	37779	0	0	59461	20469	0	0	0	0	0	0	0	19027	0	7153.2	10637	0	0	0	0	22504	27016	0	26431	22500	0	0	0	0	0	0	0	0	0	0	0	0	0	13213	0	0
A0A5N6LUG4	A0A5N6LUG4_9ASTR	Uncharacterized protein	E3N88_38600	Mikania micrantha					QRCARAK	tr|A0A5N6LUG4|A0A5N6LUG4_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_38600 PE=4 SV=1	0.80554	1.378	0	0	19539	17598	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16164	19539	0	0	0	0	0	0	0	0	0	0	17598	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LUH1	A0A5N6LUH1_9ASTR	Uncharacterized protein	E3N88_38596	Mikania micrantha		plastid outer membrane [GO:0009527]	plastid outer membrane [GO:0009527]		MEGILHR	tr|A0A5N6LUH1|A0A5N6LUH1_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_38596 PE=4 SV=1	0.80593	1.378	0	0	0	14213	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14213	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LVA9	A0A5N6LVA9_9ASTR	Integrase catalytic domain-containing protein	E3N88_38920	Mikania micrantha	DNA integration [GO:0015074]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	LLGFDYK	tr|A0A5N6LVA9|A0A5N6LVA9_9ASTR Integrase catalytic domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_38920 PE=4 SV=1;tr|A0A699HBB3|A0A699HBB3_TANCI Putative retrotransposon Ty3-gypsy subclass protein OS=Tanacetum cinerariifolium OX=118510 G	0.80672	1.378	0	13552	22439	9880.2	8687.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13552	0	7700.5	0	0	0	0	0	0	22439	9880.2	9467.9	0	0	0	0	0	0	0	0	0	0	0	0	0	8687.8	0	0
A0A5N6LVF9	A0A5N6LVF9_9ASTR	Uncharacterized protein	E3N88_38642	Mikania micrantha					GDTTEGP	tr|A0A5N6LVF9|A0A5N6LVF9_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_38642 PE=4 SV=1	0.75668	1.378	0	0	6973.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6973.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LWP8	A0A5N6LWP8_9ASTR	Uncharacterized protein	E3N88_39344	Mikania micrantha			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	NADEEEDVVEDVMDDEK	tr|A0A5N6LWP8|A0A5N6LWP8_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_39344 PE=4 SV=1	0.87451	1.378	22285	24046	12632	8408.7	0	20181	11543	22285	0	0	0	0	0	0	0	0	0	24046	0	0	0	0	0	0	12632	0	0	0	0	0	0	0	0	0	0	8408.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6LZC3	A0A5N6LZC3_9ASTR	Reverse transcriptase domain-containing protein	E3N88_34860	Mikania micrantha					EDDNWSK	tr|A0A5N6LZC3|A0A5N6LZC3_9ASTR Reverse transcriptase domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_34860 PE=4 SV=1;tr|A0A5N6M7V6|A0A5N6M7V6_9ASTR Reverse transcriptase domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_32	0.88095	1.378	0	0	6282.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6282.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6M3C5	A0A5N6M3C5_9ASTR	Uncharacterized protein	E3N88_36314	Mikania micrantha		integral component of membrane [GO:0016021]; late endosome [GO:0005770]	integral component of membrane [GO:0016021]; late endosome [GO:0005770]		LGGDNNR	tr|A0A5N6M3C5|A0A5N6M3C5_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_36314 PE=3 SV=1;tr|A0A251V2E9|A0A251V2E9_HELAN Putative FRIGIDA interacting protein 1 OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr04g0126011 PE=3 SV=1	0.93421	1.378	464650	496540	89063	239590	511480	0	464650	143860	0	0	0	0	0	0	0	0	0	0	0	496540	0	0	0	0	0	0	0	0	0	0	0	89063	0	0	0	0	239590	0	0	0	50369	511480	0	0	0	32530	0	0	377670	108950
A0A5N6M413	A0A5N6M413_9ASTR	Uncharacterized protein	E3N88_36351	Mikania micrantha					AMQIFRCLRPNTQTLNR	tr|A0A5N6M413|A0A5N6M413_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_36351 PE=4 SV=1	0.90948	1.378	0	23961	0	54529	0	0	0	0	0	0	0	0	0	0	0	0	0	23961	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	54529	0	0	0	0	0	0	0	0	0
A0A5N6M450	A0A5N6M450_9ASTR	Uncharacterized protein	E3N88_36579	Mikania micrantha			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	TPDGDDVACEVCGARDR	tr|A0A5N6M450|A0A5N6M450_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_36579 PE=4 SV=1	0.90558	1.378	0	0	24974	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24974	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6M5Z6	A0A5N6M5Z6_9ASTR	Uncharacterized protein	E3N88_37229	Mikania micrantha	iron ion homeostasis [GO:0055072]	nucleus [GO:0005634]	nucleus [GO:0005634]; ATP binding [GO:0005524]; DNA-binding transcription factor activity [GO:0003700]; protein dimerization activity [GO:0046983]; protein kinase activity [GO:0004672]; iron ion homeostasis [GO:0055072]	ATP binding [GO:0005524]; DNA-binding transcription factor activity [GO:0003700]; protein dimerization activity [GO:0046983]; protein kinase activity [GO:0004672]	AMRDHVK	tr|A0A5N6M5Z6|A0A5N6M5Z6_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_37229 PE=4 SV=1;tr|A0A5N6M8J5|A0A5N6M8J5_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_37213 PE=4 SV=1;tr|A0A103XB75|A0A103XB75_CYNCS Con	0.80295	1.378	0	11376	9116.7	9149.5	12747	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11376	0	0	0	0	0	0	0	0	9116.7	0	0	0	0	0	0	0	0	8968.9	9149.5	0	0	12747	0	0	5797.1	0	7517.5	0	0	0
A0A5N6M6Z0	A0A5N6M6Z0_9ASTR	Uncharacterized protein	E3N88_37196	Mikania micrantha					SFQFKNWMEWGAMNRFR	tr|A0A5N6M6Z0|A0A5N6M6Z0_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_37196 PE=4 SV=1	0.90295	1.378	0	0	0	364510	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	364510	0	0	0	0	0	0	0	0	0	0	0
A0A5N6M8H9	A0A5N6M8H9_9ASTR	PB1 domain-containing protein	E3N88_37193	Mikania micrantha					MEEPGSK	tr|A0A5N6M8H9|A0A5N6M8H9_9ASTR PB1 domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_37193 PE=4 SV=1	0.90717	1.378	7311.6	0	0	0	0	0	0	0	0	0	0	0	7311.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6MA20	A0A5N6MA20_9ASTR	Uncharacterized protein	E3N88_32960	Mikania micrantha		integral component of membrane [GO:0016021]; nuclear inner membrane [GO:0005637]	integral component of membrane [GO:0016021]; nuclear inner membrane [GO:0005637]		VECYQVKDSGQSFEHMK	tr|A0A5N6MA20|A0A5N6MA20_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_32960 PE=3 SV=1	0.89627	1.378	0	0	0	45438	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	45438	0	0	0	0	0	0	0	0	0	0
A0A5N6MJG2	A0A5N6MJG2_9ASTR	CCHC-type domain-containing protein	E3N88_29451	Mikania micrantha			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	AFVLGAK	tr|A0A5N6MJG2|A0A5N6MJG2_9ASTR CCHC-type domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_29451 PE=4 SV=1	0.90598	1.378	0	0	0	0	15604	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15604	0	0	0	0	0	0
A0A5N6MKL4	A0A5N6MKL4_9ASTR	Uncharacterized protein	E3N88_30094	Mikania micrantha					SISEIEN	tr|A0A5N6MKL4|A0A5N6MKL4_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_30094 PE=4 SV=1	0.90254	1.378	265810	297820	292220	0	245430	0	0	0	0	0	265810	0	0	0	297820	235360	0	63543	0	0	0	0	0	292220	0	180570	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	245430	0	0	0	0	0	0	0	0
A0A5N6MNS9	A0A5N6MNS9_9ASTR	Uncharacterized protein	E3N88_31012	Mikania micrantha					LDGNANR	tr|A0A5N6MNS9|A0A5N6MNS9_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_31012 PE=4 SV=1	0.88571	1.378	0	3881.1	0	0	0	0	0	0	0	0	0	0	0	0	3881.1	0	0	3020.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6MQA6	A0A5N6MQA6_9ASTR	F-box domain-containing protein	E3N88_30668	Mikania micrantha					SLPEMGR	"tr|A0A5N6MQA6|A0A5N6MQA6_9ASTR F-box domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_30668 PE=4 SV=1;tr|A0A251RKZ3|A0A251RKZ3_HELAN Putative F-box domain, NTF2-like domain protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr17g0534951 PE=4"	0.94521	1.378	769750	0	0	0	0	0	0	0	0	769750	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6MS23	A0A5N6MS23_9ASTR	Uncharacterized protein	E3N88_31531	Mikania micrantha					TKDRIMK	tr|A0A5N6MS23|A0A5N6MS23_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_31531 PE=4 SV=1	0.87402	1.378	0	0	0	0	3311.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3311.3
A0A5N6MWZ8	A0A5N6MWZ8_9ASTR	Reverse transcriptase	E3N88_27509	Mikania micrantha			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	VPLPDDR	tr|A0A5N6MWZ8|A0A5N6MWZ8_9ASTR Reverse transcriptase OS=Mikania micrantha OX=192012 GN=E3N88_27509 PE=4 SV=1;tr|A0A5N6PMW9|A0A5N6PMW9_9ASTR Reverse transcriptase OS=Mikania micrantha OX=192012 GN=E3N88_05867 PE=4 SV=1;tr|A0A5N6PTP2|A0A5N6PTP2_9ASTR Reverse	0.86434	1.378	0	2530600	0	1002300	15865	0	0	0	0	0	0	0	0	0	0	0	2530600	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34089	1002300	0	0	0	0	0	0	0	0	0	0	15865	0	0	0
A0A5N6MZS1	A0A5N6MZS1_9ASTR	Uncharacterized protein	E3N88_28108	Mikania micrantha	"mRNA splicing, via spliceosome [GO:0000398]"	U2AF complex [GO:0089701]	"U2AF complex [GO:0089701]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]; mRNA splicing, via spliceosome [GO:0000398]"	metal ion binding [GO:0046872]; RNA binding [GO:0003723]	EEEEEER	tr|A0A5N6MZS1|A0A5N6MZS1_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_28108 PE=4 SV=1;tr|A0A5N6MYU4|A0A5N6MYU4_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_28149 PE=4 SV=1;tr|A0A2U1PK13|A0A2U1PK13_ARTAN RNA	0.88664	1.378	0	19263	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19263	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6N000	A0A5N6N000_9ASTR	Cytokinin dehydrogenase (EC 1.5.99.12)	E3N88_28422	Mikania micrantha	cytokinin metabolic process [GO:0009690]		cytokinin dehydrogenase activity [GO:0019139]; FAD binding [GO:0071949]; cytokinin metabolic process [GO:0009690]	cytokinin dehydrogenase activity [GO:0019139]; FAD binding [GO:0071949]	NPSCGIN	tr|A0A5N6N000|A0A5N6N000_9ASTR Cytokinin dehydrogenase OS=Mikania micrantha OX=192012 GN=E3N88_28422 PE=3 SV=1;tr|A0A5N6MV54|A0A5N6MV54_9ASTR Cytokinin dehydrogenase OS=Mikania micrantha OX=192012 GN=E3N88_26607 PE=3 SV=1	0.87109	1.378	13988	2206900	1520600	1979900	1196700	0	0	13988	0	0	0	0	0	0	0	0	2201000	2206900	0	20635	17353	0	0	4677	438240	0	0	40612	15273	1520600	18662	0	0	0	0	1510800	0	1979900	1346000	0	171610	726490	30008	903490	0	0	0	0	11782	1196700
A0A5N6N0L7	A0A5N6N0L7_9ASTR	SHSP domain-containing protein	E3N88_28428	Mikania micrantha		cytoplasm [GO:0005737]	cytoplasm [GO:0005737]		FGRRIER	tr|A0A5N6N0L7|A0A5N6N0L7_9ASTR SHSP domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_28428 PE=3 SV=1;tr|A0A2U1PEH4|A0A2U1PEH4_ARTAN HSP20-like chaperone OS=Artemisia annua OX=35608 GN=CTI12_AA161720 PE=3 SV=1;tr|A0A103Y2V2|A0A103Y2V2_CYNCS	0.79167	2.756	48740	36042	66662	51449	191000	37150	18094	36463	31421	29860	0	0	17572	48740	25498	32319	0	0	36042	0	32263	29324	35480	38177	0	0	0	0	55676	33341	46101	66662	0	22478	0	51449	0	0	0	0	0	0	21465	35697	0	140630	191000	31488	48144	30046
A0A5N6N0R6	A0A5N6N0R6_9ASTR	Uncharacterized protein	E3N88_28478	Mikania micrantha					VWWKHRK	tr|A0A5N6N0R6|A0A5N6N0R6_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_28478 PE=4 SV=1;tr|A0A5N6PTF8|A0A5N6PTF8_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_04102 PE=4 SV=1	0.90336	1.378	0	0	0	0	10022	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10022	0
A0A5N6N292	A0A5N6N292_9ASTR	Uncharacterized protein	E3N88_28981	Mikania micrantha					DNDDDDM	tr|A0A5N6N292|A0A5N6N292_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_28981 PE=4 SV=1	0.87432	1.378	23510	61456	28738	13350	0	0	0	0	0	23510	0	16903	14390	15815	0	0	11073	61456	0	0	0	39365	17645	0	15078	0	0	0	0	0	28738	0	0	7930	0	13350	0	0	0	0	7433	0	0	0	0	0	0	0	0	0
A0A5N6N2I1	A0A5N6N2I1_9ASTR	Terpene_synth_C domain-containing protein	E3N88_24552	Mikania micrantha			magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333]	magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333]	DMYCEMK	tr|A0A5N6N2I1|A0A5N6N2I1_9ASTR Terpene_synth_C domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_24552 PE=4 SV=1;tr|A0A5N6N3M0|A0A5N6N3M0_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_24554 PE=4 SV=1	0.87978	1.378	15844	0	0	0	0	0	0	15844	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6N4U1	A0A5N6N4U1_9ASTR	KIX_2 domain-containing protein	E3N88_25120	Mikania micrantha		nucleus [GO:0005634]	nucleus [GO:0005634]; chromatin DNA binding [GO:0031490]; transcription coactivator activity [GO:0003713]	chromatin DNA binding [GO:0031490]; transcription coactivator activity [GO:0003713]	TWDVSAR	tr|A0A5N6N4U1|A0A5N6N4U1_9ASTR KIX_2 domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_25120 PE=4 SV=1	0.88525	1.378	7252.5	33624	20861	21082	14726	7252.5	0	0	0	0	0	0	0	0	0	0	33624	0	0	0	0	0	0	20861	0	0	0	0	16896	0	0	0	0	0	0	0	7303.2	21082	0	0	0	0	0	0	12392	14726	0	0	0	0
A0A5N6N5X6	A0A5N6N5X6_9ASTR	Uncharacterized protein	E3N88_25344	Mikania micrantha			ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; nucleic acid binding [GO:0003676]; RNA helicase activity [GO:0003724]	ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; nucleic acid binding [GO:0003676]; RNA helicase activity [GO:0003724]	DDGGWDR	tr|A0A5N6N5X6|A0A5N6N5X6_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_25344 PE=4 SV=1	0.89862	1.378	0	0	0	0	13500	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13500	0	0	0
A0A5N6N6A3	A0A5N6N6A3_9ASTR	Growth-regulating factor	E3N88_24966	Mikania micrantha	"developmental process [GO:0032502]; regulation of transcription, DNA-templated [GO:0006355]; transcription, DNA-templated [GO:0006351]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; ATP binding [GO:0005524]; developmental process [GO:0032502]; regulation of transcription, DNA-templated [GO:0006355]; transcription, DNA-templated [GO:0006351]"	ATP binding [GO:0005524]	CTEWFMR	tr|A0A5N6N6A3|A0A5N6N6A3_9ASTR Growth-regulating factor OS=Mikania micrantha OX=192012 GN=E3N88_24966 PE=3 SV=1;tr|A0A251UBY3|A0A251UBY3_HELAN Growth-regulating factor OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr07g0192351 PE=3 SV=1	0.89815	1.378	0	0	0	0	5173.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5173.5	0	0	0	0	0	0	0	0
A0A5N6N8P5	A0A5N6N8P5_9ASTR	Uncharacterized protein	E3N88_21843	Mikania micrantha					ALTPSPPPLITAFSTGR	tr|A0A5N6N8P5|A0A5N6N8P5_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_21843 PE=4 SV=1	0.89418	1.378	13275	0	35233	0	9856.1	0	0	0	0	0	0	0	13275	0	0	0	0	0	0	0	0	0	0	8625.7	0	0	0	0	0	0	35233	22379	0	0	0	0	0	0	0	0	0	0	0	0	0	9856.1	0	0	0	0
A0A5N6N925	A0A5N6N925_9ASTR	RING-type domain-containing protein	E3N88_21967	Mikania micrantha					FGSSDHR	tr|A0A5N6N925|A0A5N6N925_9ASTR RING-type domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_21967 PE=4 SV=1	0.9027	1.378	645410	1069500	223270	25305	18804	0	7925.9	645410	0	0	0	0	0	0	27515	76549	0	46077	0	1069500	20108	1033900	0	33308	223270	0	0	0	0	0	0	5648.2	0	25305	0	0	0	0	0	0	0	0	0	0	0	0	0	18804	0	0
A0A5N6NAQ8	A0A5N6NAQ8_9ASTR	SLH domain-containing protein	E3N88_22445	Mikania micrantha		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		LLPEADR	tr|A0A5N6NAQ8|A0A5N6NAQ8_9ASTR SLH domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_22445 PE=4 SV=1;tr|A0A5N6LGI5|A0A5N6LGI5_9ASTR SLH domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_43165 PE=4 SV=1	0.79702	1.378	20260	0	19312	29862	15459	11351	0	0	0	0	0	0	20260	0	0	0	0	0	0	0	0	0	0	11678	0	0	0	0	0	0	0	19312	0	0	0	29862	21359	0	0	0	20377	0	0	0	0	0	0	0	15459	0
A0A5N6NBW6	A0A5N6NBW6_9ASTR	CaM_binding domain-containing protein	E3N88_22424	Mikania micrantha			calmodulin binding [GO:0005516]	calmodulin binding [GO:0005516]	IARHTPK	tr|A0A5N6NBW6|A0A5N6NBW6_9ASTR CaM_binding domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_22424 PE=4 SV=1	0.88517	1.378	0	7958.1	7605.1	0	7346.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7958.1	0	0	0	0	0	5345.8	7605.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7346.9	0	0	0	0	0	0	0	0
A0A5N6NCG0	A0A5N6NCG0_9ASTR	Uncharacterized protein	E3N88_23142	Mikania micrantha		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	EPCSTSEHEVCSLKFSR	tr|A0A5N6NCG0|A0A5N6NCG0_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_23142 PE=4 SV=1	0.88995	1.378	0	0	0	6552.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6552.9	0	0	0	0	0	0	0	0	0	0	0
A0A5N6NDI0	A0A5N6NDI0_9ASTR	Methyltransf_11 domain-containing protein	E3N88_22576	Mikania micrantha		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; methyltransferase activity [GO:0008168]	methyltransferase activity [GO:0008168]	GGTSPEM	tr|A0A5N6NDI0|A0A5N6NDI0_9ASTR Methyltransf_11 domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_22576 PE=4 SV=1;tr|A0A103XQ89|A0A103XQ89_CYNCS Methyltransf_11 domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_0	0.81261	1.378	4173	0	0	4947.9	0	0	0	0	0	0	0	0	0	4173	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4947.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6NER4	A0A5N6NER4_9ASTR	Reverse transcriptase domain-containing protein	E3N88_23384	Mikania micrantha			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	KVKPTTK	tr|A0A5N6NER4|A0A5N6NER4_9ASTR Reverse transcriptase domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_23384 PE=4 SV=1	0.89151	1.378	4538.3	4900.6	0	4443.8	0	0	0	0	0	0	0	4538.3	0	0	0	0	0	0	0	4900.6	3799.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4443.8	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6NF04	A0A5N6NF04_9ASTR	Uncharacterized protein	E3N88_23099	Mikania micrantha		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	TDFWSIEMQVKMEFKCR	tr|A0A5N6NF04|A0A5N6NF04_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_23099 PE=4 SV=1;tr|A0A5N6NCI0|A0A5N6NCI0_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_23162 PE=4 SV=1	0.89474	1.378	0	0	3412.8	305230	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3412.8	0	0	0	0	0	0	0	0	0	0	0	0	0	305230	0	0	0	0	0	0	0	0	0	0	0
A0A5N6NIG2	A0A5N6NIG2_9ASTR	Uncharacterized protein	E3N88_20028	Mikania micrantha					VAGAMER	tr|A0A5N6NIG2|A0A5N6NIG2_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_20028 PE=4 SV=1	0.88462	1.378	0	0	0	0	4595.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4595.2	0
A0A5N6NIS4	A0A5N6NIS4_9ASTR	Protein FAR1-RELATED SEQUENCE	E3N88_21054	Mikania micrantha	"regulation of transcription, DNA-templated [GO:0006355]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; zinc ion binding [GO:0008270]; regulation of transcription, DNA-templated [GO:0006355]"	zinc ion binding [GO:0008270]	LCRTCNQLSYHDSRNCK	tr|A0A5N6NIS4|A0A5N6NIS4_9ASTR Protein FAR1-RELATED SEQUENCE OS=Mikania micrantha OX=192012 GN=E3N88_21054 PE=3 SV=1;tr|A0A5N6LW41|A0A5N6LW41_9ASTR Allene-oxide cyclase OS=Mikania micrantha OX=192012 GN=E3N88_39127 PE=3 SV=1	0.92248	1.378	0	0	87156	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	87156	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6NMZ5	A0A5N6NMZ5_9ASTR	DNA-directed RNA polymerase (EC 2.7.7.6)	E3N88_18364	Mikania micrantha	"transcription, DNA-templated [GO:0006351]"		"DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; ribonucleoside binding [GO:0032549]; transcription, DNA-templated [GO:0006351]"	DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; ribonucleoside binding [GO:0032549]	TDMSRRR	tr|A0A5N6NMZ5|A0A5N6NMZ5_9ASTR DNA-directed RNA polymerase OS=Mikania micrantha OX=192012 GN=E3N88_18364 PE=3 SV=1	0.89447	1.378	162820	48171	9001.1	0	70994	102940	0	0	0	128400	0	0	162820	7780	0	0	0	38883	0	0	0	48171	0	0	0	0	0	0	0	0	9001.1	0	0	0	0	0	0	0	0	0	0	0	0	9337.8	0	0	0	0	0	70994
A0A5N6NPG6	A0A5N6NPG6_9ASTR	Protein kinase domain-containing protein	E3N88_19306	Mikania micrantha			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	AHMIMFK	tr|A0A5N6NPG6|A0A5N6NPG6_9ASTR Protein kinase domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_19306 PE=4 SV=1;tr|A0A6S7MSF9|A0A6S7MSF9_LACSI Protein kinase domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS19091 PE=4 SV=1	0.80448	1.378	3712.7	0	5804.7	3820.4	3575.8	0	0	3712.7	0	0	0	0	2835	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5804.7	0	2440	0	3820.4	0	0	0	0	3274.3	0	0	0	0	0	0	0	3575.8	0
A0A5N6NPM9	A0A5N6NPM9_9ASTR	Uncharacterized protein	E3N88_19912	Mikania micrantha		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; oxidoreductase activity [GO:0016491]	oxidoreductase activity [GO:0016491]	PPKNLKK	tr|A0A5N6NPM9|A0A5N6NPM9_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_19912 PE=4 SV=1;tr|A0A103Y4Q8|A0A103Y4Q8_CYNCS Glucose/ribitol dehydrogenase OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_019264 PE=3 SV=1;tr|A0A164T324|	0.86728	1.378	40095	36788	16583	0	0	31429	0	0	0	30846	0	40095	0	0	0	0	0	0	36788	0	0	0	0	0	16583	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6NQL1	A0A5N6NQL1_9ASTR	Uncharacterized protein	E3N88_16957	Mikania micrantha					KPARLED	tr|A0A5N6NQL1|A0A5N6NQL1_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_16957 PE=4 SV=1	0.89048	1.378	6390100	4654100	6149500	5466700	3344200	182910	6390100	3700900	135290	125640	99607	358290	0	4386100	3263600	4269600	2486900	4654100	209380	2922700	4003600	0	4498100	0	4109400	0	4861800	0	5260100	6149500	1400800	0	166660	0	5466700	109330	2681300	659010	97913	907490	0	118570	3344200	0	0	128550	0	0	0	213830
A0A5N6NRI6	A0A5N6NRI6_9ASTR	Uncharacterized protein	E3N88_17312	Mikania micrantha					ISEYAFR	tr|A0A5N6NRI6|A0A5N6NRI6_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_17312 PE=4 SV=1	0.88732	1.378	17624	0	0	0	0	0	0	0	0	0	17624	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6NSH9	A0A5N6NSH9_9ASTR	Uncharacterized protein	E3N88_17607	Mikania micrantha					CNDGGEE	tr|A0A5N6NSH9|A0A5N6NSH9_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_17607 PE=4 SV=1	0.85714	2.1945	1743	0	0	2974.1	0	0	0	0	0	0	0	1743	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2974.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6NWB6	A0A5N6NWB6_9ASTR	Uncharacterized protein	E3N88_18221	Mikania micrantha					RLLLFRK	tr|A0A5N6NWB6|A0A5N6NWB6_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_18221 PE=4 SV=1;tr|A0A118K0W6|A0A118K0W6_CYNCS WD40 repeat-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_019703 PE=4 SV=1;tr|A0A2J6KZ47	0.92055	1.378	0	14893	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14893	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6NY74	A0A5N6NY74_9ASTR	Uncharacterized protein	E3N88_16400	Mikania micrantha	regulation of phosphoprotein phosphatase activity [GO:0043666]		protein phosphatase binding [GO:0019903]; regulation of phosphoprotein phosphatase activity [GO:0043666]	protein phosphatase binding [GO:0019903]	HALLTKK	tr|A0A5N6NY74|A0A5N6NY74_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_16400 PE=3 SV=1	0.8878	1.378	0	3611.7	0	0	2985.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3611.7	3192.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2985.1	0	0	0	0	0	0	0	0
A0A5N6NYX7	A0A5N6NYX7_9ASTR	Reverse transcriptase	E3N88_16167	Mikania micrantha			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	MIGAGHR	tr|A0A5N6NYX7|A0A5N6NYX7_9ASTR Reverse transcriptase OS=Mikania micrantha OX=192012 GN=E3N88_16167 PE=4 SV=1;tr|A0A5N6PEV6|A0A5N6PEV6_9ASTR Reverse transcriptase OS=Mikania micrantha OX=192012 GN=E3N88_07944 PE=4 SV=1;tr|A0A5N6PC98|A0A5N6PC98_9ASTR Reverse	0.81146	1.378	0	33009	0	21232	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33009	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21232	0	19581	0	0	0	0	0	0	0	0	0	0
A0A5N6P0K4	A0A5N6P0K4_9ASTR	AvrRpt-cleavage domain-containing protein	E3N88_16611	Mikania micrantha					HGGGGGK	tr|A0A5N6P0K4|A0A5N6P0K4_9ASTR AvrRpt-cleavage domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_16611 PE=4 SV=1;tr|A0A2J6LKE9|A0A2J6LKE9_LACSA Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_8X24740 PE=4 SV=1;tr|A0A6S7MMU2|A0A6S7	0.86722	1.378	864400	590650	631690	332380	519940	433840	176770	299050	864400	297480	105340	586010	334090	83876	147180	0	0	151500	590650	331020	131690	246210	0	58541	150580	0	0	454650	631690	391850	452420	538860	228350	310750	198620	332380	137120	138430	0	0	0	519940	0	9433.3	45946	0	46930	92878	125020	0
A0A5N6P5F9	A0A5N6P5F9_9ASTR	Uncharacterized protein	E3N88_12301	Mikania micrantha	translation [GO:0006412]	ribosome [GO:0005840]	ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	SGGGPAK	tr|A0A5N6P5F9|A0A5N6P5F9_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_12301 PE=3 SV=1;tr|A0A5N6LBP9|A0A5N6LBP9_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_44763 PE=3 SV=1	0.78234	1.378	0	0	0	24754	34616	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24754	0	0	34616	0	0	0	0	0	0	0	0
A0A5N6P7D7	A0A5N6P7D7_9ASTR	zinc_ribbon_12 domain-containing protein	E3N88_13014	Mikania micrantha	regulation of defense response to fungus [GO:1900150]		regulation of defense response to fungus [GO:1900150]		PHCCVHR	tr|A0A5N6P7D7|A0A5N6P7D7_9ASTR zinc_ribbon_12 domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_13014 PE=4 SV=1;tr|A0A5N6P8L2|A0A5N6P8L2_9ASTR zinc_ribbon_12 domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_12881 PE=4 SV=1;	0.76667	2.756	16183	134910	0	0	0	0	0	16183	0	0	0	0	0	0	134910	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6P9J4	A0A5N6P9J4_9ASTR	ENDO3c domain-containing protein	E3N88_13378	Mikania micrantha	base-excision repair [GO:0006284]		"4 iron, 4 sulfur cluster binding [GO:0051539]; DNA demethylase activity [GO:0035514]; DNA N-glycosylase activity [GO:0019104]; metal ion binding [GO:0046872]; base-excision repair [GO:0006284]"	"4 iron, 4 sulfur cluster binding [GO:0051539]; DNA demethylase activity [GO:0035514]; DNA N-glycosylase activity [GO:0019104]; metal ion binding [GO:0046872]"	GMNNLLADRIKDFLNR	tr|A0A5N6P9J4|A0A5N6P9J4_9ASTR ENDO3c domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_13378 PE=4 SV=1;tr|A0A5N6LUX9|A0A5N6LUX9_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_38472 PE=4 SV=1;tr|A0A5N6LAF1|A0A5N6LAF1_	0.87342	1.9304	2875.1	12203	0	0	0	0	0	0	2875.1	0	0	0	0	0	0	0	12203	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6PDT5	A0A5N6PDT5_9ASTR	Folylpolyglutamate synthase (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase) (Tetrahydrofolylpolyglutamate synthase)	E3N88_10923	Mikania micrantha	one-carbon metabolic process [GO:0006730]		ATP binding [GO:0005524]; metal ion binding [GO:0046872]; tetrahydrofolylpolyglutamate synthase activity [GO:0004326]; one-carbon metabolic process [GO:0006730]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]; tetrahydrofolylpolyglutamate synthase activity [GO:0004326]	VKPFIGK	tr|A0A5N6PDT5|A0A5N6PDT5_9ASTR Folylpolyglutamate synthase OS=Mikania micrantha OX=192012 GN=E3N88_10923 PE=3 SV=1;tr|A0A5N6PC18|A0A5N6PC18_9ASTR Folylpolyglutamate synthase OS=Mikania micrantha OX=192012 GN=E3N88_10896 PE=3 SV=1;tr|A0A251TN56|A0A251TN56_H	0.82888	1.378	0	0	7185.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7185.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6PE45	A0A5N6PE45_9ASTR	GST N-terminal domain-containing protein	E3N88_10657	Mikania micrantha	glutathione metabolic process [GO:0006749]		glutathione transferase activity [GO:0004364]; glutathione metabolic process [GO:0006749]	glutathione transferase activity [GO:0004364]	FFTLSHIPEKYYIYTSK	tr|A0A5N6PE45|A0A5N6PE45_9ASTR GST N-terminal domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_10657 PE=4 SV=1;tr|A0A5N6LB63|A0A5N6LB63_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_45533 PE=4 SV=1	0.92715	1.378	0	15030	6141.9	0	31443	0	0	0	0	0	0	0	0	0	0	9909.9	0	0	0	15030	13491	0	0	0	0	6141.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10559	31443	0	0	0	6991.9	0	0	0
A0A5N6PEP8	A0A5N6PEP8_9ASTR	Uncharacterized protein	E3N88_11098	Mikania micrantha					GFMTPCF	tr|A0A5N6PEP8|A0A5N6PEP8_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_11098 PE=4 SV=1;tr|A0A5N6PCF2|A0A5N6PCF2_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_11112 PE=4 SV=1	0.75	2.4924	0	0	0	0	9800	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9800	0
A0A5N6PFK6	A0A5N6PFK6_9ASTR	Fn3_like domain-containing protein	E3N88_11523	Mikania micrantha	carbohydrate metabolic process [GO:0005975]	extracellular region [GO:0005576]	"extracellular region [GO:0005576]; hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]; carbohydrate metabolic process [GO:0005975]"	"hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]"	AAEDSVR	tr|A0A5N6PFK6|A0A5N6PFK6_9ASTR Fn3_like domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_11523 PE=3 SV=1;tr|A0A5N6PDG7|A0A5N6PDG7_9ASTR Fn3_like domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_11492 PE=3 SV=1;tr|A0A251THJ	0.81117	1.378	0	0	229930	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	229930	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6PI80	A0A5N6PI80_9ASTR	Uncharacterized protein	E3N88_08794	Mikania micrantha					MGDEEER	tr|A0A5N6PI80|A0A5N6PI80_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_08794 PE=4 SV=1	0.85455	1.409	12871	38525	26118	18911	0	12871	0	0	0	0	0	0	0	0	16306	0	0	0	0	0	38525	0	0	26118	0	0	0	0	0	0	0	0	0	0	0	0	17362	0	0	15907	18911	0	0	0	0	0	0	0	0	0
A0A5N6PPD9	A0A5N6PPD9_9ASTR	Uncharacterized protein	E3N88_06700	Mikania micrantha					HVCCCNR	tr|A0A5N6PPD9|A0A5N6PPD9_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_06700 PE=4 SV=1	0.90426	1.5858	15211	0	0	6556.1	0	0	0	0	0	0	0	15211	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6556.1	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6PQ22	A0A5N6PQ22_9ASTR	Uncharacterized protein	E3N88_06894	Mikania micrantha		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	ARILCFK	"tr|A0A5N6PQ22|A0A5N6PQ22_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_06894 PE=4 SV=1;tr|A0A251SBE8|A0A251SBE8_HELAN Putative ABC transporter Tap-like, P-loop containing nucleoside triphosphate hydrolase OS=Helianthus annuus OX=423"	0.85535	1.378	4040.4	8208.8	0	0	0	0	0	0	0	4040.4	0	0	0	0	0	0	0	0	0	0	0	8208.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6PRY6	A0A5N6PRY6_9ASTR	Uncharacterized protein	E3N88_07589	Mikania micrantha					FCLRHVR	tr|A0A5N6PRY6|A0A5N6PRY6_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_07589 PE=4 SV=1;tr|A0A5N6MN03|A0A5N6MN03_9ASTR MULE domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_30170 PE=4 SV=1;tr|A0A5N6Q2A7|A0A5N6Q2A7_9A	0.86047	1.378	21292	0	40453	10233	13414	0	6890	21292	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10383	4426	40453	0	0	0	0	0	8405.2	8836	10233	0	0	0	0	0	0	0	0	0	0	0	0	0	11017	13414	0
A0A5N6PWJ6	A0A5N6PWJ6_9ASTR	Integrase catalytic domain-containing protein	E3N88_04544	Mikania micrantha	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	GFELLLNK	tr|A0A5N6PWJ6|A0A5N6PWJ6_9ASTR Integrase catalytic domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_04544 PE=4 SV=1;tr|A0A5N6PVT1|A0A5N6PVT1_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_04169 PE=4 SV=1;tr|A0A5N6N0V	0.875	1.882	221240	37673	34053	27351	177590	16311	221240	17814	0	0	11262	0	15902	0	32162	0	15034	22283	0	37673	11076	0	0	13557	17125	34053	16837	24599	0	0	0	0	0	0	27351	0	0	0	12901	0	22633	17385	16819	0	0	0	10696	0	2534.3	177590
A0A5N6PXI7	A0A5N6PXI7_9ASTR	ABC1 domain-containing protein	E3N88_05201	Mikania micrantha		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VVAVVLK	tr|A0A5N6PXI7|A0A5N6PXI7_9ASTR ABC1 domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_05201 PE=3 SV=1;tr|A0A6S7L696|A0A6S7L696_LACSI ABC1 domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS4487 PE=3 SV=1;tr|A0A6S7P3U3|A0A6S7	0.85377	1.378	0	0	0	3392.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3392.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6PY98	A0A5N6PY98_9ASTR	Uncharacterized protein	E3N88_00209	Mikania micrantha	vacuolar proton-transporting V-type ATPase complex assembly [GO:0070072]		vacuolar proton-transporting V-type ATPase complex assembly [GO:0070072]		HSMGASR	tr|A0A5N6PY98|A0A5N6PY98_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_00209 PE=4 SV=1;tr|A0A251RZV6|A0A251RZV6_HELAN Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr16g0516421 PE=4 SV=1;tr|A0A118K4L0|A0A118K4L0_C	0.90452	1.378	5098.3	0	8702.6	0	0	0	0	0	0	0	5098.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8702.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6Q407	A0A5N6Q407_9ASTR	Uncharacterized protein	E3N88_01932	Mikania micrantha	"regulation of transcription, DNA-templated [GO:0006355]"	chromatin [GO:0000785]; nucleus [GO:0005634]	"chromatin [GO:0000785]; nucleus [GO:0005634]; DNA binding [GO:0003677]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]	GRPPKPK	tr|A0A5N6Q407|A0A5N6Q407_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_01932 PE=4 SV=1;tr|A0A6S7M9A6|A0A6S7M9A6_LACSI H15 domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS12299 PE=4 SV=1;tr|A0A103YGG8|A0A103YGG8_CY	0.9265	1.378	3606.8	0	9098.4	0	0	0	0	0	0	0	3606.8	0	2964.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9098.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6Q5N2	A0A5N6Q5N2_9ASTR	Uncharacterized protein	E3N88_03121	Mikania micrantha	carbohydrate metabolic process [GO:0005975]		pullulanase activity [GO:0051060]; carbohydrate metabolic process [GO:0005975]	pullulanase activity [GO:0051060]	GFSGNGK	tr|A0A5N6Q5N2|A0A5N6Q5N2_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_03121 PE=4 SV=1	0.82016	1.378	0	0	0	27357	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16035	0	0	0	0	27357	0	0	0	0	0	0	0	0	0
A0A5N6Q6T5	A0A5N6Q6T5_9ASTR	Uncharacterized protein	E3N88_03485	Mikania micrantha		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		LATSIGT	tr|A0A5N6Q6T5|A0A5N6Q6T5_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_03485 PE=4 SV=1;tr|A0A5N6Q6Q3|A0A5N6Q6Q3_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_03455 PE=4 SV=1	0.82264	1.378	18202	43704	0	0	0	0	0	0	0	0	0	0	18202	0	0	0	0	43704	33795	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6Q6W4	A0A5N6Q6W4_9ASTR	Uncharacterized protein	E3N88_02643	Mikania micrantha					FAPLDPR	tr|A0A5N6Q6W4|A0A5N6Q6W4_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_02643 PE=4 SV=1;tr|A0A6S7MAH6|A0A6S7MAH6_LACSI Vacuolar protein sorting-associated protein 29 OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS12904 PE=3 SV=1;tr|A0A2J6K	0.87814	1.378	0	15762	15417	12788	0	0	0	0	0	0	0	0	0	0	0	15762	0	0	0	0	10268	0	0	0	0	14328	0	0	15417	0	0	0	0	0	0	0	12788	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5N6Q8M8	A0A5N6Q8M8_9ASTR	Uncharacterized protein	E3N88_03263	Mikania micrantha			GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	GSVCCGH	tr|A0A5N6Q8M8|A0A5N6Q8M8_9ASTR Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_03263 PE=4 SV=1	0.82414	1.378	0	0	0	0	14686	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14686	0	0	0	0	0	0	0
Q2TKR4	Q2TKR4_9DIPS	CYCLOIDEA-like (Fragment)	CYC3Bb	Morina chinensis			DNA-binding transcription factor activity [GO:0003700]	DNA-binding transcription factor activity [GO:0003700]	LPLKIAR	tr|Q2TKR4|Q2TKR4_9DIPS CYCLOIDEA-like (Fragment) OS=Morina chinensis OX=180071 GN=CYC3Bb PE=4 SV=1;tr|Q2TKR5|Q2TKR5_9DIPS CYCLOIDEA-like (Fragment) OS=Morina chinensis OX=180071 GN=CYC3Ba PE=4 SV=1;tr|Q2TKR3|Q2TKR3_9DIPS CYCLOIDEA-like (Fragment) OS=Morina	0.85345	1.378	4453600	2901700	3054000	2203800	664020	1065600	3638200	3925100	4453600	2375600	534200	3235400	2922100	2576800	516500	0	0	299460	1795800	2901700	1577800	2154500	2900700	421470	627610	549530	3054000	972630	1373100	2965400	619370	1001600	908130	1427600	327110	1167000	2203800	712940	0	0	0	0	0	0	75416	54990	539050	458080	664020	208810
C4P0J3	C4P0J3_MORLO	DIV3A protein (Fragment)	DIV3A	Morina longifolia (Whorlflower)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]	DNA binding [GO:0003677]	NNNCGTK	tr|C4P0J3|C4P0J3_MORLO DIV3A protein (Fragment) OS=Morina longifolia OX=180562 GN=DIV3A PE=4 SV=1	0.80644	1.378	125320	74398	0	0	0	0	0	0	0	0	0	125320	0	0	0	0	0	0	74398	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A7D5HHD5	A0A7D5HHD5_9ASTR	Ribosomal protein S11	rps11	Nordenstamia repanda	translation [GO:0006412]	plastid [GO:0009536]; ribosome [GO:0005840]	plastid [GO:0009536]; ribosome [GO:0005840]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]	EVDNAGK	tr|A0A7D5HHD5|A0A7D5HHD5_9ASTR Ribosomal protein S11 OS=Nordenstamia repanda OX=462475 GN=rps11 PE=3 SV=2	0.93539	1.378	0	0	2630.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2630.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A0D5ZDH9	A0A0D5ZDH9_PANGI	UGTPg38		Panax ginseng (Korean ginseng)	terpenoid biosynthetic process [GO:0016114]		UDP-glycosyltransferase activity [GO:0008194]; terpenoid biosynthetic process [GO:0016114]	UDP-glycosyltransferase activity [GO:0008194]	LPCMNFR	tr|A0A0D5ZDH9|A0A0D5ZDH9_PANGI UGTPg38 OS=Panax ginseng OX=4054 PE=2 SV=1	0.93111	1.378	267330	21875	0	14693	0	0	0	0	0	267330	0	0	0	0	0	0	0	0	0	0	0	21875	0	0	0	0	0	0	0	0	0	0	14693	0	0	14407	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6M9YZD2	A0A6M9YZD2_PANGI	Defensin-like protein 1		Panax ginseng (Korean ginseng)	defense response [GO:0006952]		defense response [GO:0006952]		CFCYSDC	tr|A0A6M9YZD2|A0A6M9YZD2_PANGI Defensin-like protein 1 OS=Panax ginseng OX=4054 PE=2 SV=1	0.79587	1.378	0	0	26148	20039	46351	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21119	0	0	0	0	0	0	26148	0	0	0	0	18322	0	0	20039	0	0	0	0	0	21890	7663.7	0	46351	0
A0A7G3KE51	A0A7G3KE51_PANGI	UGT91V1		Panax ginseng (Korean ginseng)	terpenoid biosynthetic process [GO:0016114]		UDP-glycosyltransferase activity [GO:0008194]; terpenoid biosynthetic process [GO:0016114]	UDP-glycosyltransferase activity [GO:0008194]	LAKLIAK	tr|A0A7G3KE51|A0A7G3KE51_PANGI UGT91V1 OS=Panax ginseng OX=4054 PE=2 SV=1;tr|A0A165WT71|A0A165WT71_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_014992 PE=4 SV=1;tr|A0A103XSY7|A0A103XSY7_CYNCS Uncharacterized protein OS=Cyn	0.92851	1.378	37583	0	0	0	0	0	0	0	0	37583	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
Q8WGU3	Q8WGU3_9APIA	"NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic (EC 7.1.1.-) (NADH-plastoquinone oxidoreductase subunit 5) (Fragment)"	ndhF	Pennantia cunninghamii	ATP synthesis coupled electron transport [GO:0042773]	chloroplast thylakoid membrane [GO:0009535]; integral component of membrane [GO:0016021]	chloroplast thylakoid membrane [GO:0009535]; integral component of membrane [GO:0016021]; NADH dehydrogenase (ubiquinone) activity [GO:0008137]; quinone binding [GO:0048038]; ATP synthesis coupled electron transport [GO:0042773]	NADH dehydrogenase (ubiquinone) activity [GO:0008137]; quinone binding [GO:0048038]	LAELTYF	"tr|Q8WGU3|Q8WGU3_9APIA NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic (Fragment) OS=Pennantia cunninghamii OX=159372 GN=ndhF PE=3 SV=1"	0.80311	1.378	0	0	0	0	15438	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15438	0	0	0	0	0	0	0	0
A0A140F7K3	A0A140F7K3_SAMSC	Putative LOV domain-containing protein		Sambucus nigra subsp. canadensis (American elderberry) (Sambucus canadensis)	protein-chromophore linkage [GO:0018298]; protein ubiquitination [GO:0016567]; response to stimulus [GO:0050896]; rhythmic process [GO:0048511]		photoreceptor activity [GO:0009881]; protein ubiquitination [GO:0016567]; protein-chromophore linkage [GO:0018298]; response to stimulus [GO:0050896]; rhythmic process [GO:0048511]	photoreceptor activity [GO:0009881]	NTGDPVR	tr|A0A140F7K3|A0A140F7K3_SAMSC Putative LOV domain-containing protein OS=Sambucus nigra subsp. canadensis OX=57008 PE=2 SV=1	0.90559	1.378	0	4956.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4956.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0FH78	A0FH78_9ASTR	Antifreeze protein		Saussurea involucrata	cell wall macromolecule catabolic process [GO:0016998]; chitin catabolic process [GO:0006032]		chitinase activity [GO:0004568]; cell wall macromolecule catabolic process [GO:0016998]; chitin catabolic process [GO:0006032]	chitinase activity [GO:0004568]	MGDGAAR	tr|A0FH78|A0FH78_9ASTR Antifreeze protein OS=Saussurea involucrata OX=200489 PE=2 SV=1	0.80718	1.378	119720	0	76942	60677	8610.2	56717	58620	63715	91033	110460	0	68163	119720	53802	0	0	0	0	0	0	0	0	0	0	37915	0	0	0	0	0	55367	76942	60677	50250	0	0	0	0	0	0	0	0	0	0	0	8610.2	0	0	0	2476.1
A0A0G2QUB6	A0A0G2QUB6_9ASTR	Thioredoxin h	kTrxh	Saussurea japonica	glycerol ether metabolic process [GO:0006662]		protein-disulfide reductase activity [GO:0015035]; glycerol ether metabolic process [GO:0006662]	protein-disulfide reductase activity [GO:0015035]	HSAVVAA	tr|A0A0G2QUB6|A0A0G2QUB6_9ASTR Thioredoxin h OS=Saussurea japonica OX=254911 GN=kTrxh PE=2 SV=1	0.92937	1.378	0	0	12408	22593	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12408	0	0	0	0	0	0	0	0	0	0	0	0	13002	14610	0	22593	0	0	0	0	0	0	0	0	0
Q309D0	Q309D0_STERE	p450 mono-oxygenase		Stevia rebaudiana (Stevia) (Eupatorium rebaudianum)			"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	NKLLPPK	tr|Q309D0|Q309D0_STERE p450 mono-oxygenase OS=Stevia rebaudiana OX=55670 PE=2 SV=1	0.80385	1.378	17547	46641	56269	19909	41838	0	0	0	0	0	17547	0	0	0	0	46641	0	0	0	0	0	0	0	0	0	0	56269	0	0	0	0	49879	0	0	0	19909	0	0	0	0	0	0	0	0	0	41838	0	0	0	0
Q6VAA7	U88B1_STERE	UDP-glycosyltransferase 88B1 (EC 2.4.1.-)	UGT88B1	Stevia rebaudiana (Stevia) (Eupatorium rebaudianum)			UDP-glycosyltransferase activity [GO:0008194]	UDP-glycosyltransferase activity [GO:0008194]	KPPSDGGK	sp|Q6VAA7|U88B1_STERE UDP-glycosyltransferase 88B1 OS=Stevia rebaudiana OX=55670 GN=UGT88B1 PE=2 SV=1	0.83929	2.1586	64774	184360	138020	168820	146920	0	0	0	0	0	64774	0	0	0	0	60782	184360	0	0	157040	0	0	0	0	29021	0	138020	32342	32907	0	0	0	0	0	107120	120660	168820	117120	0	22114	24649	146920	0	134910	16259	12232	0	0	0	0
A0A699GDI8	A0A699GDI8_TANCI	Uncharacterized protein	Tci_000032	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RCLPSSR	tr|A0A699GDI8|A0A699GDI8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000032 PE=4 SV=1	0.82916	1.378	0	0	0	9492.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9492.4	0	0	0	0	0	0	0	0	0	0	0
A0A699GDZ1	A0A699GDZ1_TANCI	Dephospho-CoA kinase	Tci_000060	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	coenzyme A biosynthetic process [GO:0015937]		ATP binding [GO:0005524]; dephospho-CoA kinase activity [GO:0004140]; coenzyme A biosynthetic process [GO:0015937]	ATP binding [GO:0005524]; dephospho-CoA kinase activity [GO:0004140]	AGQDDCR	tr|A0A699GDZ1|A0A699GDZ1_TANCI Dephospho-CoA kinase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000060 PE=3 SV=1	0.94737	2.756	82259	18649	0	0	0	0	0	0	0	0	82259	0	0	0	0	18649	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GE49	A0A699GE49_TANCI	Uncharacterized protein	Tci_000187	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PGGVGGR	tr|A0A699GE49|A0A699GE49_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000187 PE=4 SV=1	0.80653	1.378	0	11797	0	0	13429	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11797	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13429	0	0
A0A699GE62	A0A699GE62_TANCI	Uncharacterized protein	Tci_000181	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	carbohydrate metabolic process [GO:0005975]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; DNA binding [GO:0003677]; peptidase activity [GO:0008233]; phosphatase activity [GO:0016791]; carbohydrate metabolic process [GO:0005975]	DNA binding [GO:0003677]; peptidase activity [GO:0008233]; phosphatase activity [GO:0016791]	ALRILLHRR	tr|A0A699GE62|A0A699GE62_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000181 PE=4 SV=1	0.84416	1.9793	30696	44745	60929	117270	37723	0	18708	0	0	0	30696	0	0	0	17163	30954	29843	28021	0	44745	25634	19264	0	7296.3	0	33345	60929	0	25024	0	0	0	0	0	17530	0	5840.1	41205	43409	0	117270	37723	25688	0	0	0	0	0	0	0
A0A699GEB2	A0A699GEB2_TANCI	15-cis-phytoene synthase (EC 2.5.1.32)	Tci_000108	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	carotenoid biosynthetic process [GO:0016117]		farnesyltranstransferase activity [GO:0004311]; oxidoreductase activity [GO:0016491]; carotenoid biosynthetic process [GO:0016117]	farnesyltranstransferase activity [GO:0004311]; oxidoreductase activity [GO:0016491]	HAAGPAR	tr|A0A699GEB2|A0A699GEB2_TANCI 15-cis-phytoene synthase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000108 PE=3 SV=1	0.80749	1.378	22238	31610	34460	213650	180700	0	22238	0	0	0	0	0	0	0	27130	31610	0	0	0	0	0	0	0	20389	20788	0	0	0	27551	0	0	34460	0	0	0	0	24696	25835	213650	33486	0	180700	39649	42822	21072	0	19524	0	0	0
A0A699GEE9	A0A699GEE9_TANCI	Modular polyketide synthase type I	Tci_000180	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	carbohydrate metabolic process [GO:0005975]; fatty acid biosynthetic process [GO:0006633]		3-oxoacyl-[acyl-carrier-protein] synthase activity [GO:0004315]; ADP-glyceromanno-heptose 6-epimerase activity [GO:0008712]; NADP binding [GO:0050661]; phosphopantetheine binding [GO:0031177]; carbohydrate metabolic process [GO:0005975]; fatty acid biosynthetic process [GO:0006633]	3-oxoacyl-[acyl-carrier-protein] synthase activity [GO:0004315]; ADP-glyceromanno-heptose 6-epimerase activity [GO:0008712]; NADP binding [GO:0050661]; phosphopantetheine binding [GO:0031177]	DAGGMAR	tr|A0A699GEE9|A0A699GEE9_TANCI Modular polyketide synthase type I OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000180 PE=3 SV=1	0	3.831	73910	25161	29971	0	25603	0	19049	26591	20101	26006	0	0	0	73910	0	0	0	0	0	0	13920	25161	0	12820	0	0	0	0	29971	22614	0	0	0	0	0	0	0	0	0	0	0	0	16641	21971	0	25603	0	0	23270	0
A0A699GEG1	A0A699GEG1_TANCI	Uncharacterized protein	Tci_000019	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PGSDDGK	tr|A0A699GEG1|A0A699GEG1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000019 PE=4 SV=1	0.80941	1.378	14215	0	22892	17264	0	13652	14215	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22892	15689	0	0	16252	0	17264	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GEG5	A0A699GEG5_TANCI	Uncharacterized protein	Tci_000267	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PVCARPR	tr|A0A699GEG5|A0A699GEG5_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000267 PE=4 SV=1	0.80989	1.378	3826100	18096	3318400	2910200	23558	11115	3357800	13061	3826100	18432	0	3393500	119370	3350100	9184.9	0	0	15711	18096	0	0	0	0	10134	34118	3318400	0	0	2461800	2481300	0	0	15443	2910200	0	14488	0	0	0	0	0	0	0	12928	0	6989.5	0	14217	23558	0
A0A699GEY2	A0A699GEY2_TANCI	Probable copper-transporting ATPase HMA5	Tci_000401	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	"biosynthetic process [GO:0009058]; positive regulation of transcription, DNA-templated [GO:0045893]"	integral component of membrane [GO:0016021]	"integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase-coupled cation transmembrane transporter activity [GO:0019829]; catalytic activity [GO:0003824]; copper ion binding [GO:0005507]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; pyridoxal phosphate binding [GO:0030170]; biosynthetic process [GO:0009058]; positive regulation of transcription, DNA-templated [GO:0045893]"	ATPase-coupled cation transmembrane transporter activity [GO:0019829]; ATP binding [GO:0005524]; catalytic activity [GO:0003824]; copper ion binding [GO:0005507]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; pyridoxal phosphate binding [GO:0030170]	QGQGGGR	tr|A0A699GEY2|A0A699GEY2_TANCI Probable copper-transporting ATPase HMA5 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000401 PE=4 SV=1	0.81622	1.378	0	7320.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7320.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GEZ2	A0A699GEZ2_TANCI	DAGKc domain-containing protein	Tci_000411	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; NAD+ kinase activity [GO:0003951]	NAD+ kinase activity [GO:0003951]	CADAGGAR	tr|A0A699GEZ2|A0A699GEZ2_TANCI DAGKc domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000411 PE=4 SV=1	0.88889	1.821	0	14560	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14560	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GF30	A0A699GF30_TANCI	Uncharacterized protein	Tci_000215	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QTPGWWK	tr|A0A699GF30|A0A699GF30_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000215 PE=4 SV=1	0.83068	1.378	0	0	7253.9	10029	18558	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2518.5	0	7253.9	0	0	0	0	0	0	0	0	0	0	0	6571.8	10029	0	0	0	18558	0	0	0	0	0	0	0
A0A699GF39	A0A699GF39_TANCI	GGDEF domain-containing protein	Tci_000370	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RPQNADR	tr|A0A699GF39|A0A699GF39_TANCI GGDEF domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000370 PE=4 SV=1	0.8317	1.378	0	14067	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14067	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GFD1	A0A699GFD1_TANCI	"Elongation factor G, mitochondrial (EF-Gmt) (Elongation factor G 1, mitochondrial) (mEF-G 1) (Elongation factor G1)"	Tci_000491	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	chemotaxis [GO:0006935]; mismatch repair [GO:0006298]; mitochondrial translational elongation [GO:0070125]; signal transduction [GO:0007165]	integral component of membrane [GO:0016021]; mitochondrion [GO:0005739]; plasma membrane [GO:0005886]; plastid [GO:0009536]; small ribosomal subunit [GO:0015935]	integral component of membrane [GO:0016021]; mitochondrion [GO:0005739]; plasma membrane [GO:0005886]; plastid [GO:0009536]; small ribosomal subunit [GO:0015935]; ATP binding [GO:0005524]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; mismatched DNA binding [GO:0030983]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation elongation factor activity [GO:0003746]; transmembrane signaling receptor activity [GO:0004888]; chemotaxis [GO:0006935]; mismatch repair [GO:0006298]; mitochondrial translational elongation [GO:0070125]; signal transduction [GO:0007165]	ATP binding [GO:0005524]; GTPase activity [GO:0003924]; GTP binding [GO:0005525]; mismatched DNA binding [GO:0030983]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation elongation factor activity [GO:0003746]; transmembrane signaling receptor activity [GO:0004888]	FGESEECK	"tr|A0A699GFD1|A0A699GFD1_TANCI Elongation factor G, mitochondrial OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000491 PE=3 SV=1"	0.82927	2.2707	0	10074	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10074	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GFF4	A0A699GFF4_TANCI	Uncharacterized protein	Tci_000325	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GDCGGHR	tr|A0A699GFF4|A0A699GFF4_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000325 PE=4 SV=1	0.84991	1.378	21369	22277	12231	12523	10580	21369	0	0	0	11471	0	0	13244	8210.8	16209	0	10918	0	22277	0	18201	0	16876	0	7848.9	0	0	0	0	12231	0	0	0	0	0	0	12523	0	0	0	0	0	0	9851.8	0	0	0	10580	0	0
A0A699GFG4	A0A699GFG4_TANCI	Uncharacterized protein	Tci_000562	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HVHHAVR	tr|A0A699GFG4|A0A699GFG4_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000562 PE=4 SV=1	0.85044	1.378	0	0	0	0	24135	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24135	0	0
A0A699GFI3	A0A699GFI3_TANCI	Polynucleotide phosphorylase 1 (EC 2.7.7.8)	Tci_000355	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	mRNA catabolic process [GO:0006402]; RNA processing [GO:0006396]; translation [GO:0006412]	chloroplast [GO:0009507]; ribosome [GO:0005840]	chloroplast [GO:0009507]; ribosome [GO:0005840]; polyribonucleotide nucleotidyltransferase activity [GO:0004654]; RNA binding [GO:0003723]; structural constituent of ribosome [GO:0003735]; mRNA catabolic process [GO:0006402]; RNA processing [GO:0006396]; translation [GO:0006412]	polyribonucleotide nucleotidyltransferase activity [GO:0004654]; RNA binding [GO:0003723]; structural constituent of ribosome [GO:0003735]	PGCLRYR	tr|A0A699GFI3|A0A699GFI3_TANCI Polynucleotide phosphorylase 1 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000355 PE=3 SV=1	0.85097	1.378	0	8763.2	5539.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8763.2	0	0	0	0	0	0	0	0	0	0	0	5539.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GFP8	A0A699GFP8_TANCI	Uncharacterized protein	Tci_000488	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					FVARQNLR	tr|A0A699GFP8|A0A699GFP8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000488 PE=4 SV=1	0.8	2.1169	0	0	71255	0	112660	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	71255	0	0	19584	0	0	0	0	0	0	0	0	0	0	112660	0	0	0	53899	0	0	0
A0A699GFS7	A0A699GFS7_TANCI	Bifunctional epoxide hydrolase 2-like	Tci_000425	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		ATP-binding cassette (ABC) transporter complex [GO:0043190]	ATP-binding cassette (ABC) transporter complex [GO:0043190]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]; hydrolase activity [GO:0016787]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]; hydrolase activity [GO:0016787]	TGPRPGR	tr|A0A699GFS7|A0A699GFS7_TANCI Bifunctional epoxide hydrolase 2-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000425 PE=4 SV=1	0.85472	1.378	34325	45090	54757	0	51416	0	22473	23803	0	0	0	0	34325	32944	17486	0	0	45090	0	0	0	28306	0	38276	27579	0	0	0	0	54757	0	0	0	0	0	0	0	0	0	0	0	0	0	43797	24405	0	0	0	51416	0
A0A699GFV8	A0A699GFV8_TANCI	"Adenylosuccinate synthetase, chloroplastic (AMPSase) (AdSS) (EC 6.3.4.4) (IMP--aspartate ligase)"	PURA Tci_000349	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	'de novo' AMP biosynthetic process [GO:0044208]; chemotaxis [GO:0006935]; chitin catabolic process [GO:0006032]; CTP biosynthetic process [GO:0006241]; GTP biosynthetic process [GO:0006183]; histidine biosynthetic process [GO:0000105]; UTP biosynthetic process [GO:0006228]	chloroplast [GO:0009507]; integral component of membrane [GO:0016021]	chloroplast [GO:0009507]; integral component of membrane [GO:0016021]; adenylosuccinate synthase activity [GO:0004019]; carbohydrate binding [GO:0030246]; carboxypeptidase activity [GO:0004180]; DNA binding [GO:0003677]; endopeptidase inhibitor activity [GO:0004866]; GTP binding [GO:0005525]; magnesium ion binding [GO:0000287]; nucleoside diphosphate kinase activity [GO:0004550]; penicillin binding [GO:0008658]; peptidoglycan glycosyltransferase activity [GO:0008955]; protein-L-isoaspartate (D-aspartate) O-methyltransferase activity [GO:0004719]; 'de novo' AMP biosynthetic process [GO:0044208]; chemotaxis [GO:0006935]; chitin catabolic process [GO:0006032]; CTP biosynthetic process [GO:0006241]; GTP biosynthetic process [GO:0006183]; histidine biosynthetic process [GO:0000105]; UTP biosynthetic process [GO:0006228]	adenylosuccinate synthase activity [GO:0004019]; carbohydrate binding [GO:0030246]; carboxypeptidase activity [GO:0004180]; DNA binding [GO:0003677]; endopeptidase inhibitor activity [GO:0004866]; GTP binding [GO:0005525]; magnesium ion binding [GO:0000287]; nucleoside diphosphate kinase activity [GO:0004550]; penicillin binding [GO:0008658]; peptidoglycan glycosyltransferase activity [GO:0008955]; protein-L-isoaspartate (D-aspartate) O-methyltransferase activity [GO:0004719]	GEQGCGR	"tr|A0A699GFV8|A0A699GFV8_TANCI Adenylosuccinate synthetase, chloroplastic OS=Tanacetum cinerariifolium OX=118510 GN=PURA PE=3 SV=1"	0.16667	3.0389	2883.2	19627	75769	84980	209380	0	0	0	0	2883.2	0	0	0	0	0	0	0	0	0	0	0	19627	0	0	0	0	0	0	0	0	0	75769	0	84980	0	0	0	0	0	0	6056.1	0	209380	0	6975.6	0	0	0	0	0
A0A699GFX6	A0A699GFX6_TANCI	"DEAD-box ATP-dependent RNA helicase, putative"	Tci_000369	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			helicase activity [GO:0004386]	helicase activity [GO:0004386]	HAALFQVR	"tr|A0A699GFX6|A0A699GFX6_TANCI DEAD-box ATP-dependent RNA helicase, putative OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000369 PE=4 SV=1"	0.86792	2.1664	0	0	14994	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14994	0	0	0	0	6860.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GFZ4	A0A699GFZ4_TANCI	Probable RuBisCO transcriptional regulator	Tci_000389	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			DNA-binding transcription factor activity [GO:0003700]	DNA-binding transcription factor activity [GO:0003700]	QVCTDAR	tr|A0A699GFZ4|A0A699GFZ4_TANCI Probable RuBisCO transcriptional regulator OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000389 PE=3 SV=1	0.85687	1.378	25582	0	0	0	0	0	0	0	25582	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GFZ8	A0A699GFZ8_TANCI	CpSecY	Tci_000495	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	"protein transport [GO:0015031]; transcription, DNA-templated [GO:0006351]"	chloroplast thylakoid membrane [GO:0009535]; integral component of membrane [GO:0016021]; large ribosomal subunit [GO:0015934]; small ribosomal subunit [GO:0015935]	"chloroplast thylakoid membrane [GO:0009535]; integral component of membrane [GO:0016021]; large ribosomal subunit [GO:0015934]; small ribosomal subunit [GO:0015935]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; metallopeptidase activity [GO:0008237]; phosphorelay sensor kinase activity [GO:0000155]; protein dimerization activity [GO:0046983]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation initiation factor activity [GO:0003743]; zinc ion binding [GO:0008270]; protein transport [GO:0015031]; transcription, DNA-templated [GO:0006351]"	DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; metallopeptidase activity [GO:0008237]; phosphorelay sensor kinase activity [GO:0000155]; protein dimerization activity [GO:0046983]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation initiation factor activity [GO:0003743]; zinc ion binding [GO:0008270]	SDRQGAR	tr|A0A699GFZ8|A0A699GFZ8_TANCI CpSecY OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000495 PE=3 SV=1	0.85741	1.378	0	0	544680	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	544680	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GG92	A0A699GG92_TANCI	Autoinducer 2-binding protein LsrB	Tci_000658	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	rhamnose transmembrane transport [GO:0015762]	ATP-binding cassette (ABC) transporter complex [GO:0043190]; periplasmic space [GO:0042597]	ATP-binding cassette (ABC) transporter complex [GO:0043190]; periplasmic space [GO:0042597]; rhamnose transmembrane transport [GO:0015762]		DHHHQRR	tr|A0A699GG92|A0A699GG92_TANCI Autoinducer 2-binding protein LsrB OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000658 PE=3 SV=1	0.8441	1.378	0	0	0	3979.2	3129.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3979.2	0	0	0	3129.5	0	0	0	0	0	0	0	0
A0A699GGD8	A0A699GGD8_TANCI	Toprim domain-containing protein	Tci_000635	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	"DNA-templated transcription, initiation [GO:0006352]"	cytoplasm [GO:0005737]	"cytoplasm [GO:0005737]; DNA binding [GO:0003677]; DNA primase activity [GO:0003896]; glycosyltransferase activity [GO:0016757]; sigma factor activity [GO:0016987]; zinc ion binding [GO:0008270]; DNA-templated transcription, initiation [GO:0006352]"	DNA binding [GO:0003677]; DNA primase activity [GO:0003896]; glycosyltransferase activity [GO:0016757]; sigma factor activity [GO:0016987]; zinc ion binding [GO:0008270]	TLIKFGK	tr|A0A699GGD8|A0A699GGD8_TANCI Toprim domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000635 PE=3 SV=1	0.83374	1.378	0	7877.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7877.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GHA9	A0A699GHA9_TANCI	"Carboxyl-terminal-processing peptidase 2, chloroplastic isoform X1"	Tci_000176	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	chemotaxis [GO:0006935]; signal transduction [GO:0007165]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; serine-type peptidase activity [GO:0008236]; transmembrane signaling receptor activity [GO:0004888]; chemotaxis [GO:0006935]; signal transduction [GO:0007165]	serine-type peptidase activity [GO:0008236]; transmembrane signaling receptor activity [GO:0004888]	EREQQEAR	"tr|A0A699GHA9|A0A699GHA9_TANCI Carboxyl-terminal-processing peptidase 2, chloroplastic isoform X1 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000176 PE=3 SV=1"	0.8	2.1455	0	13768	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13768	0	0	8997.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GHH1	A0A699GHH1_TANCI	Uncharacterized protein	Tci_001161	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]; DNA recombination [GO:0006310]		DNA binding [GO:0003677]; DNA integration [GO:0015074]; DNA recombination [GO:0006310]	DNA binding [GO:0003677]	HAALLVR	tr|A0A699GHH1|A0A699GHH1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_001161 PE=4 SV=1	0.83837	1.378	0	0	0	0	6907.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6907.9	0	0	0
A0A699GHJ7	A0A699GHJ7_TANCI	Uncharacterized protein	Tci_000256	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		CGEDGGM	tr|A0A699GHJ7|A0A699GHJ7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000256 PE=4 SV=1	0.83099	2.0926	0	0	7075.5	5668.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7075.5	0	0	5668.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GHZ1	A0A699GHZ1_TANCI	Class I glutamine amidotransferase-like protein	Tci_000386	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	glutamine metabolic process [GO:0006541]; protein-chromophore linkage [GO:0018298]		DNA-binding transcription factor activity [GO:0003700]; oxidoreductase activity [GO:0016491]; phosphorelay sensor kinase activity [GO:0000155]; photoreceptor activity [GO:0009881]; glutamine metabolic process [GO:0006541]; protein-chromophore linkage [GO:0018298]	DNA-binding transcription factor activity [GO:0003700]; oxidoreductase activity [GO:0016491]; phosphorelay sensor kinase activity [GO:0000155]; photoreceptor activity [GO:0009881]	GRMLLVAR	tr|A0A699GHZ1|A0A699GHZ1_TANCI Class I glutamine amidotransferase-like protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000386 PE=3 SV=1	0.88095	2.2571	14153	76183	12771	23405	8574	0	0	7503.1	0	14153	0	0	7666.5	0	76183	0	10246	0	0	0	11578	0	0	0	0	12771	0	0	0	0	0	0	0	0	0	0	0	11853	0	0	23405	0	0	0	8574	0	7310.3	0	0	0
A0A699GI40	A0A699GI40_TANCI	Peptidase M38	Tci_000426	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			"hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds [GO:0016810]"	"hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds [GO:0016810]"	HQVAHVR	tr|A0A699GI40|A0A699GI40_TANCI Peptidase M38 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000426 PE=4 SV=1	0.84097	1.378	10295	0	0	0	0	10295	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GIF3	A0A699GIF3_TANCI	Peptidase_S9 domain-containing protein	Tci_000516	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			serine-type peptidase activity [GO:0008236]	serine-type peptidase activity [GO:0008236]	CGHDTGR	tr|A0A699GIF3|A0A699GIF3_TANCI Peptidase_S9 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000516 PE=3 SV=1	0.83119	1.378	0	15027	11195	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15027	0	0	0	0	0	0	11195	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GIZ6	A0A699GIZ6_TANCI	CCHC-type domain-containing protein	Tci_001722	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	DDNNSTR	tr|A0A699GIZ6|A0A699GIZ6_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_001722 PE=4 SV=1	0.77041	1.378	176110	0	0	0	0	0	0	0	0	0	0	176110	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GJH6	A0A699GJH6_TANCI	Probable GMP synthase [glutamine-hydrolyzing]	Tci_001509	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	base-excision repair [GO:0006284]		DNA-3-methyladenine glycosylase activity [GO:0008725]; base-excision repair [GO:0006284]	DNA-3-methyladenine glycosylase activity [GO:0008725]	PIVSTFR	tr|A0A699GJH6|A0A699GJH6_TANCI Probable GMP synthase [glutamine-hydrolyzing] OS=Tanacetum cinerariifolium OX=118510 GN=Tci_001509 PE=4 SV=1	0.7726	1.378	1707.7	10820	6380.6	0	3644.8	0	0	0	0	0	0	0	0	1707.7	0	0	0	0	0	0	0	10820	0	0	0	0	0	0	0	6380.6	0	0	0	0	0	0	0	0	0	0	0	0	0	3644.8	0	0	0	0	0	0
A0A699GJM6	A0A699GJM6_TANCI	"Acetyl-CoA acetyltransferase, cytosolic 1"	Tci_000293	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	HHGPRSR	"tr|A0A699GJM6|A0A699GJM6_TANCI Acetyl-CoA acetyltransferase, cytosolic 1 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000293 PE=3 SV=1"	0.76923	2.3984	0	0	0	0	17031	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17031	0	0	0	0	0	0	0	0
A0A699GK10	A0A699GK10_TANCI	Glucose and ribitol dehydrogenase homolog	Tci_000433	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	cellular phosphate ion homeostasis [GO:0030643]; glutathione metabolic process [GO:0006749]; negative regulation of phosphate metabolic process [GO:0045936]; phosphate ion transmembrane transport [GO:0035435]	membrane [GO:0016020]	membrane [GO:0016020]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]; inorganic phosphate transmembrane transporter activity [GO:0005315]; oxidoreductase activity [GO:0016491]; cellular phosphate ion homeostasis [GO:0030643]; glutathione metabolic process [GO:0006749]; negative regulation of phosphate metabolic process [GO:0045936]; phosphate ion transmembrane transport [GO:0035435]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]; inorganic phosphate transmembrane transporter activity [GO:0005315]; oxidoreductase activity [GO:0016491]	AAVPLLK	tr|A0A699GK10|A0A699GK10_TANCI Glucose and ribitol dehydrogenase homolog OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000433 PE=4 SV=1	0.77524	1.378	4119	0	0	0	0	0	0	0	0	2841.9	0	0	0	4119	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GK15	A0A699GK15_TANCI	Rhodanese domain-containing protein	Tci_000443	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RMLVKIK	tr|A0A699GK15|A0A699GK15_TANCI Rhodanese domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000443 PE=4 SV=1	0.77568	1.378	0	0	0	11327	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11327	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GKC6	A0A699GKC6_TANCI	Reverse transcriptase domain-containing protein	Tci_001769	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	KEGGGGI	tr|A0A699GKC6|A0A699GKC6_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_001769 PE=4 SV=1	0.77657	1.378	0	10644	10496	0	4681.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10644	0	0	3875.7	0	10496	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4681.8	0	0	0	0
A0A699GKJ8	A0A699GKJ8_TANCI	"Retrotransposon protein, putative, Ty1-copia subclass"	Tci_001186	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SDCGSKR	"tr|A0A699GKJ8|A0A699GKJ8_TANCI Retrotransposon protein, putative, Ty1-copia subclass OS=Tanacetum cinerariifolium OX=118510 GN=Tci_001186 PE=4 SV=1"	0.77835	1.378	0	0	0	36426	20783	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	36426	0	0	0	0	0	0	0	0	0	0	20783	0	0	0
A0A699GKN6	A0A699GKN6_TANCI	Integrase catalytic domain-containing protein (Fragment)	Tci_038522	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	TTMIRRR	tr|A0A699GKN6|A0A699GKN6_TANCI Integrase catalytic domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_038522 PE=4 SV=1;tr|A0A699J0X6|A0A699J0X6_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum ci	0.7748	1.378	15710	15190	0	21407	0	0	0	0	15710	0	0	0	0	0	0	0	0	0	15190	0	0	0	0	0	0	0	0	0	0	0	0	0	21407	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GLB7	A0A699GLB7_TANCI	Tricorn_C1 domain-containing protein	Tci_000004	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; serine-type peptidase activity [GO:0008236]	serine-type peptidase activity [GO:0008236]	CAPPGCR	tr|A0A699GLB7|A0A699GLB7_TANCI Tricorn_C1 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000004 PE=3 SV=1	0.84884	1.7571	2031.8	22413	0	0	0	0	0	0	0	0	0	0	2031.8	0	0	0	0	22413	0	0	0	0	3578	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GLV5	A0A699GLV5_TANCI	Uncharacterized protein	Tci_000194	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ARAVCVR	tr|A0A699GLV5|A0A699GLV5_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000194 PE=4 SV=1	0.7622	1.378	0	0	18024	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18024	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GN23	A0A699GN23_TANCI	Reverse transcriptase domain-containing protein	Tci_112325	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	FGGGHCK	tr|A0A699GN23|A0A699GN23_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_112325 PE=4 SV=1	0.7665	1.378	0	0	9042.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9042.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GN24	A0A699GN24_TANCI	Ribonuclease H	Tci_116759	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; RNA-DNA hybrid ribonuclease activity [GO:0004523]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	DHTRSRK	tr|A0A699GN24|A0A699GN24_TANCI Ribonuclease H OS=Tanacetum cinerariifolium OX=118510 GN=Tci_116759 PE=4 SV=1	0.76693	1.378	12602	12960	15639	11632	8123.5	0	0	0	0	12602	0	0	0	0	0	12521	0	0	0	0	12294	0	12960	7566.8	8722.8	0	0	0	13293	0	8067.3	15639	0	0	0	0	11632	11526	0	0	0	0	0	6792.4	0	7213.6	8123.5	0	0	0
A0A699GN33	A0A699GN33_TANCI	Reverse transcriptase Ty1/copia-type domain-containing protein	Tci_113796	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NYLPPPK	tr|A0A699GN33|A0A699GN33_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_113796 PE=4 SV=1	0.76736	1.378	4510400	4107500	5710400	4424300	6552800	0	3644600	0	4510400	3558500	0	0	0	0	0	0	0	3412700	0	3825600	0	4107500	3305700	5710400	0	0	0	3042200	0	0	0	0	0	0	0	0	4424300	0	0	0	0	0	6552800	0	0	0	6178400	0	0	0
A0A699GNS1	A0A699GNS1_TANCI	Putative ribonuclease H-like domain-containing protein	Tci_115857	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	QQHEKTK	tr|A0A699GNS1|A0A699GNS1_TANCI Putative ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_115857 PE=4 SV=1;tr|A0A699I6M2|A0A699I6M2_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinera	0.86538	1.4598	0	0	30353	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30353	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GP97	A0A699GP97_TANCI	CCHC-type domain-containing protein	Tci_138396	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	KGWKSPK	tr|A0A699GP97|A0A699GP97_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_138396 PE=4 SV=1	0.79381	1.378	0	0	0	0	10957	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10957	0
A0A699GPM0	A0A699GPM0_TANCI	Integrase catalytic domain-containing protein	Tci_149393	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	MMIQPKK	tr|A0A699GPM0|A0A699GPM0_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_149393 PE=4 SV=1	0.7952	1.378	18437	28989	13564	10836	0	0	0	0	18437	13698	0	0	0	0	0	0	0	2300.1	19451	0	0	13595	28989	0	0	0	0	0	0	13564	0	0	10836	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GPM4	A0A699GPM4_TANCI	Uncharacterized protein	Tci_141994	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PCFKIIR	tr|A0A699GPM4|A0A699GPM4_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_141994 PE=4 SV=1;tr|A0A6L2P574|A0A6L2P574_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_0655	0.79567	1.378	167030	0	0	0	156000	0	0	0	0	0	0	0	0	167030	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	156000	0	0	0
A0A699GQE2	A0A699GQE2_TANCI	Uncharacterized protein	Tci_034209	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SPGLPNG	tr|A0A699GQE2|A0A699GQE2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_034209 PE=4 SV=1	0.79335	1.378	5619.6	0	0	7359.1	0	0	0	5619.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7196.1	0	0	0	7359.1	0	0	0	0	0	0	0	0	0	0
A0A699GQK3	A0A699GQK3_TANCI	Uncharacterized protein	Tci_146480	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MPRQPAR	tr|A0A699GQK3|A0A699GQK3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_146480 PE=4 SV=1	0.80035	1.378	0	0	0	0	14891	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14891	0
A0A699GQK7	A0A699GQK7_TANCI	CCHC-type domain-containing protein (Fragment)	Tci_155311	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	NKYFSDK	tr|A0A699GQK7|A0A699GQK7_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_155311 PE=4 SV=1	0.8013	1.378	0	14494	33852	0	0	0	0	0	0	0	0	0	0	0	11176	14494	0	0	0	0	0	0	0	0	7055	15012	0	0	33852	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GR01	A0A699GR01_TANCI	Uncharacterized protein	Tci_172841	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	ARMDYNK	tr|A0A699GR01|A0A699GR01_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_172841 PE=4 SV=1	0.80272	1.378	0	15946	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15946	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GRA8	A0A699GRA8_TANCI	Reverse transcriptase Ty1/copia-type domain-containing protein	Tci_167557	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HVAEIFR	tr|A0A699GRA8|A0A699GRA8_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_167557 PE=4 SV=1	0.79894	1.378	0	16620	16355	21116	0	0	0	0	0	0	0	0	0	0	0	0	0	16620	0	0	0	0	0	0	0	0	0	0	0	0	0	16355	0	0	0	21116	0	0	0	19970	0	0	0	0	0	0	0	0	0	0
A0A699GRI0	A0A699GRI0_TANCI	Uncharacterized protein	Tci_001814	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PKQVKPK	tr|A0A699GRI0|A0A699GRI0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_001814 PE=4 SV=1	0.80282	2.1044	0	35927	0	0	3207.6	0	0	0	0	0	0	0	0	0	0	0	0	35927	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3207.6	0	0	0	0	0	0	0	0
A0A699GRS6	A0A699GRS6_TANCI	Reverse transcriptase domain-containing protein	Tci_177767	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	YLPQLQK	tr|A0A699GRS6|A0A699GRS6_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_177767 PE=4 SV=1	0.79242	1.378	13521	0	0	0	0	0	0	0	0	0	0	0	0	13521	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GSH9	A0A699GSH9_TANCI	Reverse transcriptase domain-containing protein	Tci_016461	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	VLLKTSK	tr|A0A699GSH9|A0A699GSH9_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_016461 PE=4 SV=1	0.78283	1.378	17227	19228	9683.4	20518	11453	16534	0	17227	0	0	0	0	0	0	10598	0	0	9632.6	0	0	0	12632	19228	0	9683.4	0	0	0	0	0	0	0	9593.6	0	0	20518	0	0	0	0	14694	0	0	0	0	3909.5	0	9919.5	11453	0
A0A699GSP7	A0A699GSP7_TANCI	Uncharacterized protein	Tci_178488	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					REHQDLM	tr|A0A699GSP7|A0A699GSP7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_178488 PE=4 SV=1;tr|A0A6L2KLY0|A0A6L2KLY0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_021083 PE=4 SV=1;tr|A0A103Y0D1|A0A103	0.72727	2.6637	18313	30329	0	0	18931	0	18313	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30329	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17440	0	18931	0	0	0	0
A0A699GT40	A0A699GT40_TANCI	Uncharacterized protein (Fragment)	Tci_187760	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ALRIIHV	tr|A0A699GT40|A0A699GT40_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_187760 PE=4 SV=1;tr|A0A699SMQ2|A0A699SMQ2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_870087 PE=4 SV=	0.78419	1.378	18970	23457	11195	17262	11795	16441	0	13983	14513	18970	0	0	16285	0	0	0	0	23457	0	0	0	0	0	0	9965.8	0	0	0	0	0	11195	0	13273	0	0	0	0	0	0	0	17262	0	0	9873.1	0	6526.2	0	9844.5	11795	0
A0A699GTB8	A0A699GTB8_TANCI	Integrase catalytic domain-containing protein	Tci_054418	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	RALVKVR	tr|A0A699GTB8|A0A699GTB8_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_054418 PE=4 SV=1	0.78464	1.378	6028.9	11104	0	0	0	0	0	0	0	6028.9	0	0	0	0	0	0	0	0	7537.8	0	0	0	11104	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GUX0	A0A699GUX0_TANCI	Copia protein	Tci_213845	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MSIMEHM	tr|A0A699GUX0|A0A699GUX0_TANCI Copia protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_213845 PE=4 SV=1	0.79058	1.378	0	0	0	0	24280	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24280	0	0	0
A0A699GUZ0	A0A699GUZ0_TANCI	DNA-directed DNA polymerase	Tci_114732	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			DNA-directed DNA polymerase activity [GO:0003887]; nucleic acid binding [GO:0003676]	DNA-directed DNA polymerase activity [GO:0003887]; nucleic acid binding [GO:0003676]	PPKLELK	tr|A0A699GUZ0|A0A699GUZ0_TANCI DNA-directed DNA polymerase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_114732 PE=4 SV=1	0.7915	1.378	29124	13237	30981	35040	43567	6909.9	0	0	0	0	29124	0	0	0	8152.8	10835	0	0	0	13237	10162	0	0	0	0	10714	30981	0	19462	0	0	0	0	0	35040	0	0	0	9094.3	11590	0	0	43567	0	8960.6	0	0	0	0	0
A0A699GV61	A0A699GV61_TANCI	Molybdate transporter 1	Tci_192872	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; molybdate ion transmembrane transporter activity [GO:0015098]	molybdate ion transmembrane transporter activity [GO:0015098]	YLKKIVK	tr|A0A699GV61|A0A699GV61_TANCI Molybdate transporter 1 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_192872 PE=4 SV=1	0.8585	1.378	51284	47369	35946	34543	30956	39760	41327	0	41746	45791	0	0	51284	0	32801	0	0	44855	47369	0	45326	0	28429	35946	30045	0	0	0	0	7701.5	16711	0	34543	0	0	0	0	0	0	0	18085	0	0	0	30956	17235	0	0	28388	0
A0A699GV77	A0A699GV77_TANCI	Copia protein	Tci_168433	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	LFFEADLNLKCECYERK	tr|A0A699GV77|A0A699GV77_TANCI Copia protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_168433 PE=4 SV=1	0.75	2.756	2535	2263.7	0	364510	0	0	0	0	2535	0	0	0	0	0	0	0	0	0	0	0	0	2263.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	364510	0	0	0	0	0	0	0	0	0	0	0
A0A699GW55	A0A699GW55_TANCI	Root phototropism protein 3-like	Tci_240397	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	protein ubiquitination [GO:0016567]		protein ubiquitination [GO:0016567]		VVGYFAR	tr|A0A699GW55|A0A699GW55_TANCI Root phototropism protein 3-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_240397 PE=3 SV=1	0.94179	1.378	13731	0	0	0	0	0	0	0	0	13731	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GWB0	A0A699GWB0_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_232676	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GFWREAK	tr|A0A699GWB0|A0A699GWB0_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_232676 PE=4 SV=1	0.9431	1.378	13829	0	18965	14281	0	0	0	0	0	0	13829	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18965	0	0	0	0	0	0	0	0	0	14281	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GWH8	A0A699GWH8_TANCI	Uncharacterized protein (Fragment)	Tci_232015	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			ATP binding [GO:0005524]	ATP binding [GO:0005524]	LSQEEIK	tr|A0A699GWH8|A0A699GWH8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_232015 PE=4 SV=1	0.85714	2.2586	535340	0	0	0	0	0	0	0	15932	0	535340	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699GWK5	A0A699GWK5_TANCI	Putative ribonuclease H-like domain-containing protein	Tci_229291	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	DDQAFWR	tr|A0A699GWK5|A0A699GWK5_TANCI Putative ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_229291 PE=4 SV=1	0.94441	1.378	21094	29777	20320	0	5268.3	21094	0	0	0	0	0	0	0	0	19672	0	0	29777	0	0	0	0	15147	0	0	0	0	0	0	0	20320	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5268.3	0	0	0	0
A0A699GXT8	A0A699GXT8_TANCI	U2 snRNP auxiliary factor large subunit	Tci_247437	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	mRNA processing [GO:0006397]; RNA splicing [GO:0008380]	nucleus [GO:0005634]	nucleus [GO:0005634]; RNA binding [GO:0003723]; mRNA processing [GO:0006397]; RNA splicing [GO:0008380]	RNA binding [GO:0003723]	SSSREESR	tr|A0A699GXT8|A0A699GXT8_TANCI U2 snRNP auxiliary factor large subunit OS=Tanacetum cinerariifolium OX=118510 GN=Tci_247437 PE=3 SV=1;tr|A0A2U1PEN3|A0A2U1PEN3_ARTAN Splicing factor U2af large subunit B OS=Artemisia annua OX=35608 GN=CTI12_AA161270 PE=3 SV=	0.80645	2.1397	0	29693	36769	0	15802	0	0	0	0	0	0	0	0	0	0	0	0	0	29693	0	0	0	0	0	0	0	0	0	0	0	23600	36769	0	0	0	0	0	0	0	0	0	0	0	0	0	15802	0	0	0	0
A0A699GYF9	A0A699GYF9_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_254062	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	HGLVRGLPKLK	"tr|A0A699GYF9|A0A699GYF9_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_254062 PE=4 SV=1;tr|A0A6L2JKP1|A0A6L2JKP1_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic"	0.93789	1.378	15845	0	0	0	6723.3	0	0	0	0	0	0	15845	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6723.3
A0A699GYG4	A0A699GYG4_TANCI	Uncharacterized protein	Tci_255407	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TEETSSR	tr|A0A699GYG4|A0A699GYG4_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_255407 PE=4 SV=1	0.93724	1.378	72205	77163	103920	108080	52645	51305	0	72205	0	0	0	0	0	0	0	0	0	62922	60783	0	77163	76397	0	44585	0	0	0	0	83442	0	0	103920	0	0	0	86233	64282	62468	0	0	108080	0	52543	0	30661	0	0	0	52645	0
A0A699GYJ9	A0A699GYJ9_TANCI	Copia protein (Fragment)	Tci_237571	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MSNRIMK	tr|A0A699GYJ9|A0A699GYJ9_TANCI Copia protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_237571 PE=4 SV=1	0.92261	1.378	53297	16392	0	0	32815	0	0	0	27488	34212	0	53297	0	35538	0	0	0	0	16392	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32815	0
A0A699GZI1	A0A699GZI1_TANCI	Uncharacterized protein	Tci_255912	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	LLIKRHK	tr|A0A699GZI1|A0A699GZI1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_255912 PE=4 SV=1	0.92891	1.378	0	0	0	98679	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	98679	0	44014	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699H059	A0A699H059_TANCI	Putative ribonuclease H-like domain-containing protein	Tci_262919	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DNDGPCK	tr|A0A699H059|A0A699H059_TANCI Putative ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_262919 PE=4 SV=1;tr|A0A5N6PSZ6|A0A5N6PSZ6_9ASTR RING-type domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_	0.93146	1.378	0	0	4733.8	3762.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4733.8	0	0	3762.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699H164	A0A699H164_TANCI	Uncharacterized protein	Tci_281756	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VSCSGSY	tr|A0A699H164|A0A699H164_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_281756 PE=4 SV=1	0.93402	1.378	10110	10981	0	10286	0	0	0	0	0	0	0	0	0	10110	0	0	0	0	10981	0	0	0	10442	0	0	0	0	0	0	0	0	0	0	0	0	10286	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699H8R5	A0A699H8R5_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_335567	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DDKDGDA	tr|A0A699H8R5|A0A699H8R5_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_335567 PE=4 SV=1	0.80328	2.1435	0	0	76729	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8162.5	0	0	0	0	0	76729	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HAI6	A0A699HAI6_TANCI	Uncharacterized protein	Tci_346756	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VHSGTNA	tr|A0A699HAI6|A0A699HAI6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_346756 PE=4 SV=1	0.92136	1.378	0	15365	0	0	25363	0	0	0	0	0	0	0	0	0	15365	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25363	0
A0A699HD92	A0A699HD92_TANCI	Uncharacterized protein	Tci_380467	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MMCNTPK	tr|A0A699HD92|A0A699HD92_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_380467 PE=4 SV=1	0.87847	1.378	0	53962	28047	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	53962	0	0	28047	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HD96	A0A699HD96_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment)	Tci_323269	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	NGGCDGR	tr|A0A699HD96|A0A699HD96_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_323269 PE=4 SV=1	0.87904	1.378	0	42827	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42827	0	0	0	23521	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HDA8	A0A699HDA8_TANCI	Integrase catalytic domain-containing protein	Tci_380844	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	HGWVSLI	tr|A0A699HDA8|A0A699HDA8_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_380844 PE=4 SV=1	0.88018	1.378	13229	11400	6404.9	10336	7850	0	0	0	13229	11948	0	0	0	0	0	0	0	8152.2	11400	0	0	0	0	0	6404.9	0	0	0	0	0	0	0	0	10336	0	0	0	0	0	0	0	0	0	0	0	0	0	7850	0	0
A0A699HET3	A0A699HET3_TANCI	Uncharacterized protein (Fragment)	Tci_390070	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QGDCCTE	tr|A0A699HET3|A0A699HET3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_390070 PE=4 SV=1	0.88534	1.378	0	0	3670.8	4878.8	2335.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3670.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4878.8	0	0	0	0	0	2335.9	0	0	0	0
A0A699HFB1	A0A699HFB1_TANCI	Uncharacterized protein	Tci_373779	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TLLHKRR	tr|A0A699HFB1|A0A699HFB1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_373779 PE=4 SV=1;tr|A0A6L2K018|A0A6L2K018_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_014337 PE=4 SV=	0.87339	1.378	5591.5	4994.4	7526.4	3543	5079.7	0	0	0	0	0	5591.5	0	0	0	0	0	0	0	0	4994.4	0	0	0	0	0	0	5148.3	7526.4	0	0	0	0	0	0	3543	0	0	0	0	0	0	0	5079.7	0	0	0	0	0	0	0
A0A699HGD0	A0A699HGD0_TANCI	Uncharacterized protein (Fragment)	Tci_382557	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					WWMRDGD	tr|A0A699HGD0|A0A699HGD0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_382557 PE=4 SV=1	0.86286	1.378	39115	0	0	72895	0	0	0	0	0	0	39115	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	72895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HHG5	A0A699HHG5_TANCI	Uncharacterized protein	Tci_397387	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		TFHGLAK	tr|A0A699HHG5|A0A699HHG5_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_397387 PE=4 SV=1	0.86782	1.378	23956	0	0	0	0	0	0	0	0	0	0	0	23956	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HHX5	A0A699HHX5_TANCI	RT_RNaseH_2 domain-containing protein	Tci_402065	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					IYVDRRR	tr|A0A699HHX5|A0A699HHX5_TANCI RT_RNaseH_2 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_402065 PE=4 SV=1	0.87115	1.378	31158	27518	23035	15793	26619	0	0	0	0	19491	0	31158	21167	0	0	0	0	27518	20456	0	0	20651	0	0	0	0	0	0	0	23035	0	0	15793	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26619	0	16550
A0A699HHY1	A0A699HHY1_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_394615	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	LAPSEPK	"tr|A0A699HHY1|A0A699HHY1_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_394615 PE=4 SV=1;tr|A0A6L2JHV1|A0A6L2JHV1_TANCI Retrotransposon protein, putative, Ty3-gypsy subclass OS=Tanace"	0.87171	1.378	13641	9427.8	9099	12015	13222	9414.8	7727.2	0	0	0	0	0	13641	0	0	0	9427.8	0	0	0	0	0	8051.5	0	9099	0	0	0	0	0	0	0	0	8476.1	0	12015	0	0	0	0	0	0	0	0	0	9031.3	0	13222	0	0
A0A699HIH2	A0A699HIH2_TANCI	Zf-CCHC domain-containing protein/DUF4219 domain-containing protein/UBN2 domain-containing protein (Fragment)	Tci_395132	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MPAIPQK	tr|A0A699HIH2|A0A699HIH2_TANCI Zf-CCHC domain-containing protein/DUF4219 domain-containing protein/UBN2 domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_395132 PE=4 SV=1	0.906	1.378	39473	60655	99943	88949	98421	0	0	0	0	0	39473	0	0	0	0	45238	55673	60655	0	0	0	0	0	0	59998	0	75715	68326	99943	0	46742	63848	0	0	88949	58558	73165	0	72062	0	42802	55475	80194	61972	53322	0	60264	98421	75349	0
A0A699HJ87	A0A699HJ87_TANCI	"RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein"	Tci_404068	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	VVKLKAR	"tr|A0A699HJ87|A0A699HJ87_TANCI RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_404068 PE=4 SV=1"	0.90842	1.378	0	0	0	0	2634.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2634.3	0	0	0	0	0	0
A0A699HJA0	A0A699HJA0_TANCI	"Retrotransposon protein, putative, Ty3-gypsy subclass (Fragment)"	Tci_399285	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ILIKPVK	"tr|A0A699HJA0|A0A699HJA0_TANCI Retrotransposon protein, putative, Ty3-gypsy subclass (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_399285 PE=4 SV=1"	0.90903	1.378	40589	0	0	0	0	0	0	0	0	7302.8	0	40589	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HJB5	A0A699HJB5_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_378606	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ACDIFSNEMSSK	tr|A0A699HJB5|A0A699HJB5_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_378606 PE=4 SV=1	0.90964	1.378	17709	9698.1	9701.2	0	7888.2	0	8782.4	0	0	17709	0	0	0	0	0	0	0	9698.1	0	0	0	0	0	0	0	0	0	0	0	0	9701.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7888.2	0	0	0	0
A0A699HJQ8	A0A699HJQ8_TANCI	"Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic"	Tci_413792	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KHKYMPR	"tr|A0A699HJQ8|A0A699HJQ8_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic OS=Tanacetum cinerariifolium OX=118510 GN=Tci_413792 PE=4 SV=1"	0.9054	1.378	0	0	18024	23360	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10371	0	0	0	0	18024	0	0	16209	0	0	0	0	0	0	0	23360	0	0	0	0	0	0	0	0	0
A0A699HJR5	A0A699HJR5_TANCI	Uncharacterized protein	Tci_381247	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HVEGTAK	tr|A0A699HJR5|A0A699HJR5_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_381247 PE=4 SV=1	0.91208	1.378	20149	39850	0	22171	0	0	0	20149	0	0	0	0	0	0	0	33919	0	0	0	39850	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22171	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HJY5	A0A699HJY5_TANCI	Reverse transcriptase	Tci_414768	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	LLQQPVK	tr|A0A699HJY5|A0A699HJY5_TANCI Reverse transcriptase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_414768 PE=4 SV=1	0.91392	1.378	0	32518	27333	26528	0	0	0	0	0	0	0	0	0	0	0	25483	32518	0	0	0	0	0	0	24621	0	27333	0	0	0	0	0	0	0	0	0	26528	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HK37	A0A699HK37_TANCI	Uncharacterized protein	Tci_403214	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RFLILPK	tr|A0A699HK37|A0A699HK37_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_403214 PE=4 SV=1	0.84615	1.9715	0	0	8184.1	7298.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8184.1	0	0	0	0	0	0	0	7298.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HMH5	A0A699HMH5_TANCI	Putative reverse transcriptase domain-containing protein	Tci_420770	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	PPVIVKR	tr|A0A699HMH5|A0A699HMH5_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_420770 PE=4 SV=1	0.91886	1.378	64651	0	0	0	0	0	0	0	64651	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HN31	A0A699HN31_TANCI	Gag-Pol polyprotein	Tci_413662 Tci_423581	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	SRSPKVK	tr|A0A699HN31|A0A699HN31_TANCI Gag-Pol polyprotein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_413662 PE=4 SV=1	0.90419	1.378	0	542940	457140	460070	306770	0	0	0	0	0	0	0	0	0	0	0	542940	0	0	0	0	479040	0	0	0	0	0	0	425250	457140	0	0	0	0	375750	0	0	0	32207	457060	460070	0	0	273780	304590	0	306770	0	0	0
A0A699HNX0	A0A699HNX0_TANCI	Uncharacterized protein	Tci_422212	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					AMAMTEC	tr|A0A699HNX0|A0A699HNX0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_422212 PE=4 SV=1	0.89232	1.378	0	11849	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11849	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HP87	A0A699HP87_TANCI	Uncharacterized protein	Tci_424662	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DSQSRSK	tr|A0A699HP87|A0A699HP87_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_424662 PE=4 SV=1	0.89349	1.378	13904	0	0	0	0	0	0	0	0	0	0	13904	0	12539	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HPM8	A0A699HPM8_TANCI	Uncharacterized protein	Tci_408311	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VFVLRKR	tr|A0A699HPM8|A0A699HPM8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_408311 PE=4 SV=1	0.89526	1.378	0	11937	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11937	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HPW7	A0A699HPW7_TANCI	Uncharacterized protein (Fragment)	Tci_409853	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DGDGDEEDEGDDGEER	tr|A0A699HPW7|A0A699HPW7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_409853 PE=4 SV=1	0	5.9474	62885	57435	0	31118	73988	62885	21613	48102	0	0	61115	0	23144	0	57435	57399	0	0	0	0	0	19892	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31118	0	0	0	0	63419	0	69972	0	0	73988	0	0	0
A0A699HRE9	A0A699HRE9_TANCI	Probable auxin efflux carrier component 1c isoform X1	Tci_442985	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	auxin-activated signaling pathway [GO:0009734]; transmembrane transport [GO:0055085]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; auxin-activated signaling pathway [GO:0009734]; transmembrane transport [GO:0055085]		EDDGYMK	tr|A0A699HRE9|A0A699HRE9_TANCI Probable auxin efflux carrier component 1c isoform X1 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_442985 PE=4 SV=1;tr|A0A118K0B6|A0A118K0B6_CYNCS Auxin efflux carrier (Fragment) OS=Cynara cardunculus var. scolymus OX=59895 	0.80056	1.378	7069.7	0	0	0	4939	0	0	0	0	0	7069.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4939	0	0	0
A0A699HRF6	A0A699HRF6_TANCI	Uncharacterized protein	Tci_443861	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HGKLVKK	tr|A0A699HRF6|A0A699HRF6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_443861 PE=4 SV=1;tr|A0A699HIV2|A0A699HIV2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_397025 PE=4 SV=1	0.90721	1.378	0	0	17134	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17134	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HRT3	A0A699HRT3_TANCI	Uncharacterized protein (Fragment)	Tci_420205	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SNKIVIK	tr|A0A699HRT3|A0A699HRT3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_420205 PE=4 SV=1	0.90179	1.378	25105	0	0	0	0	0	0	0	0	0	0	25105	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HRV8	A0A699HRV8_TANCI	Putative reverse transcriptase domain-containing protein	Tci_432346	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	CTIKFHK	tr|A0A699HRV8|A0A699HRV8_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_432346 PE=4 SV=1	0.90239	1.378	0	0	12880	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9210.7	12880	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HSD1	A0A699HSD1_TANCI	Uncharacterized protein	Tci_437918	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					IARIHSK	tr|A0A699HSD1|A0A699HSD1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_437918 PE=4 SV=1	0.81287	1.378	0	8663.9	22101	8392.5	8370.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8663.9	5932.7	0	0	0	0	0	22101	0	0	0	0	0	0	0	8392.5	0	0	0	5935.7	0	0	8370.1	0	0	0	0	0	0	0	0
A0A699HUF0	A0A699HUF0_TANCI	Uncharacterized protein	Tci_455226	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VQIDNDK	tr|A0A699HUF0|A0A699HUF0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_455226 PE=4 SV=1	0.90119	1.378	0	15953	0	35282	33936	0	0	0	0	0	0	0	0	0	0	15953	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13391	0	0	35282	0	0	0	33936	19462	0	0	0	0	0
A0A699HUQ3	A0A699HUQ3_TANCI	Leucine-rich repeat protein	Tci_452865	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NYGFVKK	tr|A0A699HUQ3|A0A699HUQ3_TANCI Leucine-rich repeat protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_452865 PE=4 SV=1	0.875	2.1966	0	35166	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35166	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HV86	A0A699HV86_TANCI	Uncharacterized protein	Tci_423567	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RAIMVVK	tr|A0A699HV86|A0A699HV86_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_423567 PE=4 SV=1	0.9	1.378	16218	8890.7	12739	5527.1	0	0	0	0	0	10094	0	16218	0	10861	0	0	0	0	0	0	0	8117.6	8890.7	0	0	0	0	0	0	12739	0	0	0	5527.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HX71	A0A699HX71_TANCI	"RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein"	Tci_458125	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	MSADETR	"tr|A0A699HX71|A0A699HX71_TANCI RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_458125 PE=4 SV=1"	0.8994	1.378	0	0	0	27982	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27982	0	0	0	0	0	0	0	0	0	0
A0A699HXJ8	A0A699HXJ8_TANCI	DNA-directed DNA polymerase	Tci_448421	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		DNA-directed DNA polymerase activity [GO:0003887]; nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	DNA-directed DNA polymerase activity [GO:0003887]; nucleic acid binding [GO:0003676]	QRNVNPK	tr|A0A699HXJ8|A0A699HXJ8_TANCI DNA-directed DNA polymerase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_448421 PE=4 SV=1	0.89881	1.378	21519	0	23737	18950	0	0	0	0	18067	21519	0	13859	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23737	0	0	18950	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HXR0	A0A699HXR0_TANCI	"Putative reverse transcriptase domain, ribonuclease H-like domain, aspartic peptidase domain protein"	Tci_462574	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	GIDCENS	"tr|A0A699HXR0|A0A699HXR0_TANCI Putative reverse transcriptase domain, ribonuclease H-like domain, aspartic peptidase domain protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_462574 PE=4 SV=1"	0.89822	1.378	0	0	8712.6	9970.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8712.6	0	0	0	0	0	0	0	0	0	0	0	0	0	9970.5	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HXS6	A0A699HXS6_TANCI	Uncharacterized protein	Tci_435660	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	PLKPIIK	tr|A0A699HXS6|A0A699HXS6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_435660 PE=4 SV=1	0.89762	1.378	6468.8	5979	0	0	0	0	0	0	6468.8	0	0	0	0	0	0	0	0	0	5979	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HXV6	A0A699HXV6_TANCI	RT_RNaseH_2 domain-containing protein (Fragment)	Tci_461122	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	AQRPGINR	tr|A0A699HXV6|A0A699HXV6_TANCI RT_RNaseH_2 domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_461122 PE=4 SV=1	0.82812	2.1262	10054	11641	16094	0	12784	0	0	0	0	0	10054	0	0	0	0	0	0	0	0	11641	9294.1	0	0	0	0	0	0	16094	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12784	0	8674.5	0	0	0	0	0
A0A699HY19	A0A699HY19_TANCI	Uncharacterized protein	Tci_462006	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PTVDVLP	tr|A0A699HY19|A0A699HY19_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_462006 PE=4 SV=1	0.89703	1.378	0	37354	31807	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37354	0	0	0	0	0	31807	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HY58	A0A699HY58_TANCI	Uncharacterized protein	Tci_455374	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					IEVVTQK	tr|A0A699HY58|A0A699HY58_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_455374 PE=4 SV=1;tr|A0A6L2P003|A0A6L2P003_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_063175 PE=4 SV=	0.89644	1.378	0	0	0	9149.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9149.5	0	0	0	6382.9	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HY62	A0A699HY62_TANCI	Reverse transcriptase	Tci_466966	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			aspartic-type endopeptidase activity [GO:0004190]	aspartic-type endopeptidase activity [GO:0004190]	TTTGLTK	tr|A0A699HY62|A0A699HY62_TANCI Reverse transcriptase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_466966 PE=4 SV=1	0.89585	1.378	0	20700	0	30967	0	0	0	0	0	0	0	0	0	0	20700	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30967	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699HZE7	A0A699HZE7_TANCI	Putative reverse transcriptase domain-containing protein	Tci_467485	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	LYHASIK	tr|A0A699HZE7|A0A699HZE7_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_467485 PE=4 SV=1	0.89467	1.378	0	27445	0	0	24470	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27445	26345	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24470	0	0	13036	0	12617	0	0	0
A0A699HZW2	A0A699HZW2_TANCI	Homeodomain-like protein	Tci_463222	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			DNA binding [GO:0003677]	DNA binding [GO:0003677]	DDEFNTR	tr|A0A699HZW2|A0A699HZW2_TANCI Homeodomain-like protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_463222 PE=4 SV=1	0.89408	1.378	0	0	3872.1	0	951.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3872.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	951.74	0	0	0
A0A699I075	A0A699I075_TANCI	Reverse transcriptase domain-containing protein	Tci_464724	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	KSFPPWR	tr|A0A699I075|A0A699I075_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_464724 PE=4 SV=1;tr|A0A6L2JSW6|A0A6L2JSW6_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118	0.8929	1.378	0	0	0	0	534600	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	534600	0	0	0	0	0	0	0
A0A699I0C5	A0A699I0C5_TANCI	Uncharacterized protein	Tci_471892	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RVAKPVK	tr|A0A699I0C5|A0A699I0C5_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_471892 PE=4 SV=1;tr|A0A699STB1|A0A699STB1_TANCI Ribonuclease H-like domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_8728	0.89796	2.1937	5890.9	0	0	0	3144	0	0	5890.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1970.2	0	3144	0
A0A699I145	A0A699I145_TANCI	Reverse transcriptase domain-containing protein	Tci_473641	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	INLDLLE	tr|A0A699I145|A0A699I145_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_473641 PE=4 SV=1	0.89173	1.378	0	322050	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	322050	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699I199	A0A699I199_TANCI	Reverse transcriptase domain-containing protein	Tci_464567	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	IIPLECK	tr|A0A699I199|A0A699I199_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_464567 PE=4 SV=1	0.89115	1.378	0	0	18499	14239	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18499	0	0	0	0	0	0	0	0	14239	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699I1A6	A0A699I1A6_TANCI	Uncharacterized protein (Fragment)	Tci_480856	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HVEWPTCNWK	tr|A0A699I1A6|A0A699I1A6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_480856 PE=4 SV=1	0.89056	1.378	0	10943	0	4866.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10943	0	0	0	0	0	0	0	0	0	4866.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699I1R2	A0A699I1R2_TANCI	Reverse transcriptase domain-containing protein	Tci_466242	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	EEMHEMR	tr|A0A699I1R2|A0A699I1R2_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_466242 PE=4 SV=1;tr|A0A699LEU3|A0A699LEU3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_709285 PE=4 S	0.79196	1.378	0	0	0	0	10990	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10990	0	0	0	0	0	0	0
A0A699I2E9	A0A699I2E9_TANCI	Phospholipase-like protein (Fragment)	Tci_480286	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VTAKTIR	tr|A0A699I2E9|A0A699I2E9_TANCI Phospholipase-like protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_480286 PE=4 SV=1	0.88998	1.378	0	19769	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19769	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699I4K7	A0A699I4K7_TANCI	CCHC-type domain-containing protein	Tci_483871	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	PLLKAHK	tr|A0A699I4K7|A0A699I4K7_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_483871 PE=4 SV=1	0.91269	1.378	30385	27078	21490	16834	18458	0	30385	16035	0	0	0	0	0	0	13114	0	27078	7613.9	0	0	0	0	15274	11838	21490	0	0	0	0	0	0	8968.6	16834	0	0	0	0	0	0	12593	0	0	0	10343	0	18458	0	0	0	0
A0A699I722	A0A699I722_TANCI	CCHC-type domain-containing protein	Tci_492858	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	IIFSQHK	tr|A0A699I722|A0A699I722_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_492858 PE=4 SV=1	0.91824	1.378	0	16549	21793	10510	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16549	0	0	6024.4	0	0	0	0	0	0	0	21793	0	0	10510	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699I7I3	A0A699I7I3_TANCI	Uncharacterized protein	Tci_495957	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SDDDTAR	tr|A0A699I7I3|A0A699I7I3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_495957 PE=4 SV=1	0.91762	1.378	164380	0	0	0	0	0	0	0	0	164380	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699I9B7	A0A699I9B7_TANCI	Uncharacterized protein	Tci_482569	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MMMMRRR	tr|A0A699I9B7|A0A699I9B7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_482569 PE=4 SV=1;tr|A0A699TD40|A0A699TD40_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_880414 PE=4 SV=1	0.73333	2.756	492630	97464	0	0	0	0	0	0	0	492630	0	411040	0	0	0	97464	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699IBZ0	A0A699IBZ0_TANCI	Putative reverse transcriptase domain-containing protein	Tci_510850	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	VVRIPCR	tr|A0A699IBZ0|A0A699IBZ0_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_510850 PE=4 SV=1	0.91639	1.378	0	12561	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12561	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699IDD4	A0A699IDD4_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_507496	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	MNGHRHK	tr|A0A699IDD4|A0A699IDD4_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_507496 PE=4 SV=1	0.91577	1.378	210590	0	0	130780	0	0	0	0	0	0	0	0	210590	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	130780	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699IE01	A0A699IE01_TANCI	Uncharacterized protein	Tci_522472	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SCETRLR	tr|A0A699IE01|A0A699IE01_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_522472 PE=4 SV=1	0.91515	1.378	0	193070	0	0	0	0	0	0	0	0	0	0	0	0	0	193070	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699IH13	A0A699IH13_TANCI	Uncharacterized protein	Tci_533476	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KKTFLFK	tr|A0A699IH13|A0A699IH13_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_533476 PE=4 SV=1	0.91331	1.378	0	0	0	20141	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20141	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699IHM9	A0A699IHM9_TANCI	"Putative transposase (Putative), gypsy type"	Tci_534503	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VLLFIGK	"tr|A0A699IHM9|A0A699IHM9_TANCI Putative transposase (Putative), gypsy type OS=Tanacetum cinerariifolium OX=118510 GN=Tci_534503 PE=4 SV=1"	0.91147	1.378	0	0	0	0	5052.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5052.4	0	0	0	0	0	0
A0A699II38	A0A699II38_TANCI	Uncharacterized protein	Tci_528016	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EENMGMK	tr|A0A699II38|A0A699II38_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_528016 PE=4 SV=1	0.91086	1.378	0	0	16194	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16194	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699IJ39	A0A699IJ39_TANCI	Probable cyclic nucleotide-gated ion channel 5 (Fragment)	Tci_538016	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					FVVAWRR	tr|A0A699IJ39|A0A699IJ39_TANCI Probable cyclic nucleotide-gated ion channel 5 (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_538016 PE=4 SV=1	0.91025	1.378	0	0	0	34223	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34223	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699IJK4	A0A699IJK4_TANCI	Ribonuclease H-like domain-containing protein (Fragment)	Tci_540698	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VHLLLAK	tr|A0A699IJK4|A0A699IJK4_TANCI Ribonuclease H-like domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_540698 PE=4 SV=1	0.90782	1.378	10992	174630	125290	282390	0	0	0	0	0	0	10992	0	0	0	0	0	174630	0	0	0	0	0	0	0	0	96906	125290	0	0	0	0	0	0	0	118460	0	0	0	0	282390	140270	0	0	0	0	0	0	0	0	0
A0A699IKD0	A0A699IKD0_TANCI	Uncharacterized protein (Fragment)	Tci_534430	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RGVLLLR	tr|A0A699IKD0|A0A699IKD0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_534430 PE=4 SV=1	0.9066	1.378	0	0	0	3742	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3742	0	0	0	0	0	0	0	0	0
A0A699IKX8	A0A699IKX8_TANCI	Uncharacterized protein	Tci_531029	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					IKTHCFR	tr|A0A699IKX8|A0A699IKX8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_531029 PE=4 SV=1	0.8894	1.378	12154	9084.5	12762	10765	13205	0	0	0	0	0	12154	0	0	0	0	0	0	0	0	0	9084.5	0	0	0	0	0	12762	0	0	0	0	0	0	0	10765	0	0	0	8224.6	0	0	13205	11473	0	0	0	0	0	0	0
A0A699IL20	A0A699IL20_TANCI	Transposon TX1 (Fragment)	Tci_544624	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					FGEEFLK	tr|A0A699IL20|A0A699IL20_TANCI Transposon TX1 (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_544624 PE=4 SV=1;tr|A0A2U1LR33|A0A2U1LR33_ARTAN DUF4283 domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA427690 PE=4 SV=1	0.85752	1.378	9804.5	6038.4	12928	0	13502	0	8118	9804.5	0	7453.1	0	0	0	0	0	6038.4	0	0	0	0	0	0	0	0	0	0	0	12928	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13502	0
A0A699ILC9	A0A699ILC9_TANCI	Putative reverse transcriptase domain-containing protein	Tci_537389	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	GAFCCYK	tr|A0A699ILC9|A0A699ILC9_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_537389 PE=4 SV=1	0.88824	1.378	0	55916	0	0	91770	0	0	0	0	0	0	0	0	0	0	54821	55916	0	0	48227	46752	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	66667	91770	0	41915	0	0	0	0	0
A0A699ILY9	A0A699ILY9_TANCI	Uncharacterized protein (Fragment)	Tci_539713	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PNDDDEV	tr|A0A699ILY9|A0A699ILY9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_539713 PE=4 SV=1	0.85958	1.378	3153.1	3825.7	6430.8	0	0	3153.1	0	0	0	0	0	0	0	0	0	0	0	0	3825.7	0	0	0	0	0	0	0	0	6430.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699IMS3	A0A699IMS3_TANCI	ARID DNA-binding domain-containing protein (Fragment)	Tci_551249	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			DNA binding [GO:0003677]	DNA binding [GO:0003677]	PIKEEDR	tr|A0A699IMS3|A0A699IMS3_TANCI ARID DNA-binding domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_551249 PE=4 SV=1	0.88766	1.378	0	0	0	0	24408	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24408	0	0	0	0	0
A0A699IMU9	A0A699IMU9_TANCI	Integrase catalytic domain-containing protein	Tci_547401	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	KKTLVPK	tr|A0A699IMU9|A0A699IMU9_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_547401 PE=4 SV=1	0.87227	1.378	8814.1	6870.4	9683	47476	4928.8	5022	0	8814.1	0	8505.2	0	0	0	3384.4	0	0	0	2956.4	6870.4	0	0	4419.2	0	0	0	0	0	0	9683	6212.9	2744.2	0	0	4542.7	0	47476	0	0	0	0	0	0	0	0	0	0	0	4928.8	0	0
A0A699IPN7	A0A699IPN7_TANCI	Reverse transcriptase Ty1/copia-type domain-containing protein	Tci_530934	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PSGSSDR	tr|A0A699IPN7|A0A699IPN7_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_530934 PE=4 SV=1	0.8706	1.378	0	0	18186	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18186	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699IQR8	A0A699IQR8_TANCI	"FAR1 DNA binding domain, zinc finger, SWIM-type, MULE transposase domain, FHY3/FAR1 family"	Tci_556585	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SVDVQEE	"tr|A0A699IQR8|A0A699IQR8_TANCI FAR1 DNA binding domain, zinc finger, SWIM-type, MULE transposase domain, FHY3/FAR1 family OS=Tanacetum cinerariifolium OX=118510 GN=Tci_556585 PE=4 SV=1"	0.86893	1.378	16012	857230	561030	569840	149990	0	0	0	0	0	0	0	16012	0	857230	0	0	0	0	0	0	24126	22727	0	0	561030	0	0	0	0	0	0	0	569840	0	0	0	0	0	0	0	0	0	0	0	149990	0	0	13641	0
A0A699IQU1	A0A699IQU1_TANCI	RT_RNaseH domain-containing protein	Tci_556772	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EPKEEHR	tr|A0A699IQU1|A0A699IQU1_TANCI RT_RNaseH domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_556772 PE=4 SV=1	0.86837	1.378	0	30804	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30804	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699IRX6	A0A699IRX6_TANCI	Uncharacterized protein	Tci_539164	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NLLLTSK	tr|A0A699IRX6|A0A699IRX6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_539164 PE=4 SV=1	0.86726	1.378	0	0	12092	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12092	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699IRZ4	A0A699IRZ4_TANCI	E-beta-farnesene synthase	Tci_553338	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KPKVPTR	tr|A0A699IRZ4|A0A699IRZ4_TANCI E-beta-farnesene synthase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_553338 PE=4 SV=1	0.86671	1.378	19999	16660	9830	0	11144	13928	14775	16752	0	0	0	19999	0	9580.8	15279	0	0	0	0	0	0	4617.8	16660	0	9830	0	0	0	0	0	6464.4	0	0	0	0	0	0	0	0	0	0	0	0	3722	10240	0	0	11144	0	0
A0A699IS30	A0A699IS30_TANCI	CCHC-type domain-containing protein (Fragment)	Tci_547018	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	NCIVKPR	tr|A0A699IS30|A0A699IS30_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_547018 PE=4 SV=1;tr|A0A6L2M1U0|A0A6L2M1U0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_039946 PE=4 SV	0.86616	1.378	0	0	0	0	6069.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6069.6	0	0	0	0	0	0
A0A699IU85	A0A699IU85_TANCI	Phytochrome (Fragment)	Tci_558194	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	"detection of visible light [GO:0009584]; heme oxidation [GO:0006788]; protein-chromophore linkage [GO:0018298]; regulation of transcription, DNA-templated [GO:0006355]"		"heme oxygenase (decyclizing) activity [GO:0004392]; phosphorelay sensor kinase activity [GO:0000155]; photoreceptor activity [GO:0009881]; detection of visible light [GO:0009584]; heme oxidation [GO:0006788]; protein-chromophore linkage [GO:0018298]; regulation of transcription, DNA-templated [GO:0006355]"	heme oxygenase (decyclizing) activity [GO:0004392]; phosphorelay sensor kinase activity [GO:0000155]; photoreceptor activity [GO:0009881]	CCHCRGR	tr|A0A699IU85|A0A699IU85_TANCI Phytochrome (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_558194 PE=3 SV=1	0.86561	1.378	0	0	0	0	8306.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8306.2	0	0	0	5409.3	0	0	0
A0A699IUD3	A0A699IUD3_TANCI	Copia protein (Fragment)	Tci_558317	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		MMSFSYR	tr|A0A699IUD3|A0A699IUD3_TANCI Copia protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_558317 PE=4 SV=1	0.86505	1.378	0	0	0	0	60310	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	60310	0
A0A699IUL2	A0A699IUL2_TANCI	Uncharacterized protein (Fragment)	Tci_558992	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NSSRDDR	tr|A0A699IUL2|A0A699IUL2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_558992 PE=4 SV=1	0.8645	1.378	0	20596	0	0	0	0	0	0	0	0	0	0	0	0	0	20596	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699IVJ7	A0A699IVJ7_TANCI	Uncharacterized protein (Fragment)	Tci_561519	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	MTDYSLWEVILNGESLAPTRVVDGVLQPVAPTTTEQRLAR	tr|A0A699IVJ7|A0A699IVJ7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_561519 PE=4 SV=1	0	9.7499	0	0	0	0	3602.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3602.2	0	0	0	0	0	0	0	0
A0A699IVP8	A0A699IVP8_TANCI	Uncharacterized protein (Fragment)	Tci_561865	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NMDRDWR	tr|A0A699IVP8|A0A699IVP8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_561865 PE=4 SV=1	0.86176	1.378	56540	0	11475	53485	55585	56540	0	0	9069.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7035	0	0	0	0	0	11475	0	0	53485	0	12836	0	0	0	0	0	0	0	0	0	0	0	0	0	55585
A0A699IVU5	A0A699IVU5_TANCI	Replication protein A 70 kDa DNA-binding subunit B	Tci_562216	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			DNA binding [GO:0003677]	DNA binding [GO:0003677]	INWWNCK	tr|A0A699IVU5|A0A699IVU5_TANCI Replication protein A 70 kDa DNA-binding subunit B OS=Tanacetum cinerariifolium OX=118510 GN=Tci_562216 PE=4 SV=1;tr|A0A699GQI1|A0A699GQI1_TANCI Replication protein A 70 kDa DNA-binding subunit B (Fragment) OS=Tanacetum ciner	0.79941	1.378	511500	0	0	0	0	0	0	0	0	0	329680	511500	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699IW10	A0A699IW10_TANCI	"Zinc finger, CCHC-type"	Tci_562468	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NNMVPFR	"tr|A0A699IW10|A0A699IW10_TANCI Zinc finger, CCHC-type OS=Tanacetum cinerariifolium OX=118510 GN=Tci_562468 PE=4 SV=1;tr|A0A6L2L350|A0A6L2L350_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic OS=Tanacetum cinerariifol"	0.86122	1.378	0	217760	0	0	0	0	0	0	0	0	0	0	0	0	0	0	217760	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699IX83	A0A699IX83_TANCI	Uncharacterized protein	Tci_565419	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		LPLILTK	tr|A0A699IX83|A0A699IX83_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_565419 PE=4 SV=1;tr|A0A6S7N142|A0A6S7N142_LACSI GRF-type domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS19001 PE=4 SV=1	0.86033	1.378	0	35953	45390	0	19561	0	0	0	0	0	0	0	0	0	0	35953	0	0	0	0	0	0	0	0	19261	45390	0	0	28062	0	0	35940	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19561	0	0
A0A699IXQ5	A0A699IXQ5_TANCI	"Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic"	Tci_566560	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HDGCSNM	"tr|A0A699IXQ5|A0A699IXQ5_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic OS=Tanacetum cinerariifolium OX=118510 GN=Tci_566560 PE=4 SV=1;tr|A0A699GTR5|A0A699GTR5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum "	0.57143	2.756	5282.2	4770	0	0	1916.8	4395.7	5282.2	4047.5	0	0	0	0	0	0	0	4770	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1916.8	0
A0A699IY36	A0A699IY36_TANCI	Uncharacterized protein (Fragment)	Tci_567958	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PVDEHDD	tr|A0A699IY36|A0A699IY36_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_567958 PE=4 SV=1	0.86067	1.378	0	0	12645	11804	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12645	0	0	0	0	0	0	0	11804	0	0	0	11224	0	0	0	0	0	0	0	0	0
A0A699IZV7	A0A699IZV7_TANCI	Uncharacterized protein	Tci_571147	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TCGNYLK	tr|A0A699IZV7|A0A699IZV7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_571147 PE=4 SV=1;tr|A0A699GXA1|A0A699GXA1_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_242550 PE=4 SV=1	0.9477	1.378	0	0	0	48077	35255	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	48077	0	0	0	0	0	0	0	0	0	0	35255	0	0
A0A699J018	A0A699J018_TANCI	Uncharacterized protein	Tci_572625	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HEGGTYK	tr|A0A699J018|A0A699J018_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_572625 PE=4 SV=1	0.86013	1.378	0	0	0	292770	123400	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	292770	0	0	0	0	0	0	0	0	0	0	0	0	0	123400	0
A0A699J0N8	A0A699J0N8_TANCI	Uncharacterized protein (Fragment)	Tci_574309	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PEEDSTG	tr|A0A699J0N8|A0A699J0N8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_574309 PE=4 SV=1	0.87283	1.378	23059	21284	0	0	0	23059	13858	0	0	0	0	0	0	0	0	0	0	21284	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699J0Q0	A0A699J0Q0_TANCI	Uncharacterized protein	Tci_574337	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PNNSDAC	tr|A0A699J0Q0|A0A699J0Q0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_574337 PE=4 SV=1	0.87395	1.378	12184	9542.2	11340	0	0	0	0	0	0	0	12184	0	0	0	0	0	0	0	0	9542.2	0	0	0	0	0	0	11340	0	7079.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699J0R0	A0A699J0R0_TANCI	Uncharacterized protein (Fragment)	Tci_570553 Tci_574133	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	APMVNDA	tr|A0A699J0R0|A0A699J0R0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_570553 PE=4 SV=1;tr|A0A699IAX9|A0A699IAX9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_514644 PE=4 SV=	0.917	1.378	8529.4	0	0	0	0	0	0	0	0	0	0	0	0	8529.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699J1E6	A0A699J1E6_TANCI	Cell differentiation protein RCD1 homolog isoform X1 (Fragment)	Tci_575196	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SCDREDK	tr|A0A699J1E6|A0A699J1E6_TANCI Cell differentiation protein RCD1 homolog isoform X1 (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_575196 PE=4 SV=1	0.88708	1.378	9856.4	0	0	0	0	9856.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699J1G4	A0A699J1G4_TANCI	Uncharacterized protein (Fragment)	Tci_575871	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SSSAPAK	tr|A0A699J1G4|A0A699J1G4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_575871 PE=4 SV=1	0.8865	1.378	8631	0	0	0	4870	8631	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4171.8	4870	0	0
A0A699J1G9	A0A699J1G9_TANCI	Uncharacterized protein (Fragment)	Tci_576061	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QFHSVSS	tr|A0A699J1G9|A0A699J1G9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_576061 PE=4 SV=1	0.88592	1.378	0	0	240820	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	240820	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699J2P2	A0A699J2P2_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_578855	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	GIHVDPAKIESIKDWASSK	tr|A0A699J2P2|A0A699J2P2_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_578855 PE=4 SV=1;tr|A0A699RM33|A0A699RM33_TANCI Putative reverse transcriptase domain-containing protein (Fragm	0.88477	1.378	0	0	0	35300	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35300	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699J381	A0A699J381_TANCI	SWIB/MDM2 domain-containing protein	Tci_576225	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VIYEWVR	"tr|A0A699J381|A0A699J381_TANCI SWIB/MDM2 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_576225 PE=4 SV=1;tr|A0A103Y239|A0A103Y239_CYNCS DEK, C-terminal OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_020618 PE=4 SV=1;tr|A0A251"	0.80994	1.378	0	0	0	0	17214	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17214	0	0	0	0	0
A0A699J3M9	A0A699J3M9_TANCI	"Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic (Fragment)"	Tci_579516	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	PPRECLK	"tr|A0A699J3M9|A0A699J3M9_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_579516 PE=4 SV=1"	0.88419	1.378	0	15865	12076	805340	17221	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15865	0	0	0	0	12076	0	0	11556	0	0	0	0	0	0	0	0	11286	13051	805340	0	0	17221	0	9052.8	0	8711.6	0	0	0
A0A699J4X2	A0A699J4X2_TANCI	Uncharacterized protein	Tci_583799	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TIKLIIT	tr|A0A699J4X2|A0A699J4X2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_583799 PE=4 SV=1	0.88304	1.378	19647	19020	17114	19093	12341	3289.6	0	19647	0	0	0	0	0	0	19020	0	7797	0	0	0	0	0	0	9367.9	0	0	0	0	0	0	0	17114	0	0	0	11307	19093	0	0	0	0	0	0	0	0	2405.6	0	12341	3408.7	0
A0A699J5K4	A0A699J5K4_TANCI	Ent-kaurenoic acid oxidase (Fragment)	Tci_585799	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	terpenoid biosynthetic process [GO:0016114]		"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]; terpenoid biosynthetic process [GO:0016114]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	WDDLIPK	tr|A0A699J5K4|A0A699J5K4_TANCI Ent-kaurenoic acid oxidase (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_585799 PE=3 SV=1	0.88247	1.378	83939	17868	60155	12819	43578	0	83939	0	0	0	0	0	0	13311	17868	0	0	6765.4	0	0	0	0	0	60155	0	0	0	0	0	0	9454.6	0	0	0	0	12819	0	0	0	0	0	0	0	0	0	0	0	0	12848	43578
A0A699J8F6	A0A699J8F6_TANCI	ABC transporter E family member 2-like	Tci_590149	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	IHPPPKK	tr|A0A699J8F6|A0A699J8F6_TANCI ABC transporter E family member 2-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_590149 PE=4 SV=1;tr|A0A6L2J017|A0A6L2J017_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_	0.88075	1.378	8311	10676	0	0	0	0	0	0	0	8311	0	0	0	7896	0	0	0	8101.5	10676	0	0	0	9943.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699J9Y9	A0A699J9Y9_TANCI	"Proteinaceous RNase P 1, chloroplastic/mitochondrial (Fragment)"	Tci_594407	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GFEIFGK	"tr|A0A699J9Y9|A0A699J9Y9_TANCI Proteinaceous RNase P 1, chloroplastic/mitochondrial (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_594407 PE=3 SV=1"	0.87961	1.378	0	0	18235	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18235	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699JBG0	A0A699JBG0_TANCI	Uncharacterized protein (Fragment)	Tci_593083	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HMCTYSK	tr|A0A699JBG0|A0A699JBG0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_593083 PE=4 SV=1	0.87791	1.378	0	21472	0	0	8071	0	0	0	0	0	0	0	0	0	21472	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8071	0	0	0	0	0
A0A699JC41	A0A699JC41_TANCI	Uncharacterized protein	Tci_596326	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KSCLPPK	tr|A0A699JC41|A0A699JC41_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_596326 PE=4 SV=1	0.87734	1.378	445040	0	0	0	0	0	0	0	0	0	0	0	0	445040	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699JEJ3	A0A699JEJ3_TANCI	Putative reverse transcriptase domain-containing protein	Tci_603284	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	MPAMPSR	tr|A0A699JEJ3|A0A699JEJ3_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_603284 PE=4 SV=1	0.87677	1.378	0	397530	0	224040	0	0	0	0	0	0	0	0	0	0	0	397530	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	224040	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699JFG9	A0A699JFG9_TANCI	Uncharacterized protein (Fragment)	Tci_606080	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					INIWKLK	tr|A0A699JFG9|A0A699JFG9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_606080 PE=4 SV=1	0.87621	1.378	4302	0	0	3546.6	0	0	0	0	0	4302	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3097.6	0	0	3546.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699JHH4	A0A699JHH4_TANCI	Uncharacterized protein (Fragment)	Tci_607854	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RYYGFKK	tr|A0A699JHH4|A0A699JHH4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_607854 PE=4 SV=1	0.87564	1.378	23694	36701	29735	32443	25427	0	0	0	0	0	0	0	23694	0	0	0	23126	0	0	25250	19435	0	36701	0	0	0	29735	0	0	0	0	0	0	0	0	0	0	32443	0	0	0	25427	0	0	0	0	0	0	0	0
A0A699JI86	A0A699JI86_TANCI	Uncharacterized protein (Fragment)	Tci_608269	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MMGDNYE	tr|A0A699JI86|A0A699JI86_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_608269 PE=4 SV=1	0.87508	1.378	0	0	6434.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6434.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699JIA1	A0A699JIA1_TANCI	Uncharacterized protein	Tci_606422	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					YGFVPKK	tr|A0A699JIA1|A0A699JIA1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_606422 PE=4 SV=1	0.91949	1.378	0	0	0	2373.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2373.7	0	0	0	0	0	0	0	0	0	0
A0A699JIG9	A0A699JIG9_TANCI	Uncharacterized protein	Tci_606802	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GEDMYDK	tr|A0A699JIG9|A0A699JIG9_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_606802 PE=4 SV=1	0.92011	1.378	13819	9241.6	12540	15950	0	13819	0	12793	0	0	0	0	0	0	0	0	9241.6	0	0	0	0	0	0	0	12540	0	0	0	0	0	6490.2	0	0	0	0	0	0	0	0	11926	15950	0	0	0	0	0	0	0	0	0
A0A699JJT1	A0A699JJT1_TANCI	Reverse transcriptase domain-containing protein	Tci_613125	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	CEGIGLI	tr|A0A699JJT1|A0A699JJT1_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_613125 PE=4 SV=1	0.92073	1.378	0	20696	0	13435	0	0	0	0	0	0	0	0	0	0	20696	15998	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13435	0	0	0	0	0	0	0	0	0	0
A0A699JJV4	A0A699JJV4_TANCI	"Serine/threonine-protein kinase STN8, chloroplastic (Fragment)"	Tci_614397	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		thylakoid [GO:0009579]	thylakoid [GO:0009579]; protein serine/threonine kinase activity [GO:0004674]	protein serine/threonine kinase activity [GO:0004674]	DDRFKEK	"tr|A0A699JJV4|A0A699JJV4_TANCI Serine/threonine-protein kinase STN8, chloroplastic (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_614397 PE=4 SV=1;tr|A0A699J3E4|A0A699J3E4_TANCI Serine/threonine-protein kinase STN8, chloroplastic (Fragment) OS=Ta"	0.76071	1.378	0	0	0	9846.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9846.2	0	0	0	0	0	0	0	0	0	0
A0A699JXH7	A0A699JXH7_TANCI	Putative reverse transcriptase domain-containing protein	Tci_635477	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	RAKPVQK	tr|A0A699JXH7|A0A699JXH7_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_635477 PE=4 SV=1;tr|A0A5N6LPD0|A0A5N6LPD0_9ASTR IENR2 domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_41	0.8075	1.378	0	5222	2445	0	4751.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5222	0	0	0	0	0	2445	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4751.8	0	0	0	0	0	0	0	0
A0A699KI89	A0A699KI89_TANCI	Uncharacterized protein (Fragment)	Tci_667875	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MMGDDSK	tr|A0A699KI89|A0A699KI89_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_667875 PE=4 SV=1;tr|A0A699GJJ3|A0A699GJJ3_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_0018	0.77304	1.378	0	0	15153	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15153	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699KTM6	A0A699KTM6_TANCI	Uncharacterized protein	Tci_682841	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					IARLHAK	tr|A0A699KTM6|A0A699KTM6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_682841 PE=4 SV=1;tr|A0A6L2MK46|A0A6L2MK46_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_045140 PE=4 SV=1;tr|A0A699HN59|A0A699	0.90359	1.378	0	0	14039	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9945	14039	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699KU84	A0A699KU84_TANCI	Reverse transcriptase domain-containing protein	Tci_683146	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	RIASTLK	tr|A0A699KU84|A0A699KU84_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_683146 PE=4 SV=1;tr|A0A699IQL2|A0A699IQL2_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifo	0.86948	1.378	0	20518	10661	0	4884.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20518	0	0	0	10661	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4884.6	0	0	0	0
A0A699KY51	A0A699KY51_TANCI	DNA/RNA polymerases superfamily protein (Fragment)	Tci_688585	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	MQAPRVR	tr|A0A699KY51|A0A699KY51_TANCI DNA/RNA polymerases superfamily protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_688585 PE=4 SV=1	0.93595	1.378	8244.3	0	15212	0	6945.1	0	0	0	0	0	0	8244.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15212	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6945.1
A0A699KY78	A0A699KY78_TANCI	CCHC-type domain-containing protein (Fragment)	Tci_687064	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	CDYHHDG	tr|A0A699KY78|A0A699KY78_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_687064 PE=4 SV=1	0.93531	1.378	12444	0	0	0	0	0	0	0	0	12444	0	0	0	12271	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699L0G8	A0A699L0G8_TANCI	Uncharacterized protein	Tci_686855	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TGGGGPK	tr|A0A699L0G8|A0A699L0G8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_686855 PE=4 SV=1	0.93466	1.378	0	0	28230	16059	6846.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18945	26887	28230	0	0	0	0	0	0	16059	0	0	0	0	0	0	0	0	0	6846.6	0	0	0	0	0
A0A699L1G4	A0A699L1G4_TANCI	Ribonuclease H-like domain-containing protein (Fragment)	Tci_686991	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DSDYYEK	tr|A0A699L1G4|A0A699L1G4_TANCI Ribonuclease H-like domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_686991 PE=4 SV=1;tr|A0A6L2J2H0|A0A6L2J2H0_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium	0.78374	1.378	0	6343.4	0	0	0	0	0	0	0	0	0	0	0	0	6343.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699L214	A0A699L214_TANCI	Ribonuclease H-like domain-containing protein (Fragment)	Tci_691724	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	PKNSPPK	tr|A0A699L214|A0A699L214_TANCI Ribonuclease H-like domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_691724 PE=4 SV=1	0.93274	1.378	0	0	0	0	6013.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6013.7
A0A699L6B2	A0A699L6B2_TANCI	Uncharacterized protein (Fragment)	Tci_700080	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PSISLTP	tr|A0A699L6B2|A0A699L6B2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_700080 PE=4 SV=1	0.9321	1.378	11028	6376.5	0	0	3201.2	0	0	0	0	0	0	0	0	11028	0	0	0	0	0	0	0	0	6376.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3201.2	0	0	0	0	0	0
A0A699L970	A0A699L970_TANCI	Integrase catalytic domain-containing protein (Fragment)	Tci_696743	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	VVVKFAK	tr|A0A699L970|A0A699L970_TANCI Integrase catalytic domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_696743 PE=4 SV=1	0.93082	1.378	22945	0	0	27060	24571	0	0	0	0	0	22945	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27060	0	0	0	0	0	0	24571	18928	0	0	0	0	0	0	0
A0A699LBB0	A0A699LBB0_TANCI	CCHC-type domain-containing protein	Tci_697853	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	DSFLIAL	tr|A0A699LBB0|A0A699LBB0_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_697853 PE=4 SV=1	0.93018	1.378	0	0	0	314200	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	314200	0	0	0	0	0	0	0	0	0
A0A699LBC3	A0A699LBC3_TANCI	Uncharacterized protein (Fragment)	Tci_703637	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SMEEEPR	tr|A0A699LBC3|A0A699LBC3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_703637 PE=4 SV=1	0.92955	1.378	214770	224480	196070	0	0	214770	0	0	0	0	0	0	0	0	224480	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	196070	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699LD58	A0A699LD58_TANCI	CCHC-type domain-containing protein (Fragment)	Tci_704127	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	PPSTMAR	tr|A0A699LD58|A0A699LD58_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_704127 PE=4 SV=1	0.92828	1.378	0	1296.8	4735.4	0	4536.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1296.8	0	0	0	0	0	4735.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4536.4	0	0	0	0	0	0	0
A0A699LD61	A0A699LD61_TANCI	Uncharacterized protein (Fragment)	Tci_700331	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					AHYDYLK	tr|A0A699LD61|A0A699LD61_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_700331 PE=4 SV=1;tr|A0A6L2LWD9|A0A6L2LWD9_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_0380	0.91454	1.378	0	0	0	25946	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25946	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699LDU1	A0A699LDU1_TANCI	"B-box-type zinc finger, zinc finger, PHD-type, DC1 (Fragment)"	Tci_709394	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GSSDTPN	"tr|A0A699LDU1|A0A699LDU1_TANCI B-box-type zinc finger, zinc finger, PHD-type, DC1 (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_709394 PE=4 SV=1"	0.92765	1.378	0	7050.2	7034.5	0	18530	0	0	0	0	0	0	0	0	0	0	7050.2	6638.4	0	0	0	0	0	0	0	0	5123	0	0	7034.5	0	0	0	0	0	0	0	0	0	0	0	0	0	18530	0	0	0	0	0	0	0
A0A699LE29	A0A699LE29_TANCI	Putative ribonuclease H-like domain-containing protein (Fragment)	Tci_702346	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PLLKDPK	tr|A0A699LE29|A0A699LE29_TANCI Putative ribonuclease H-like domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_702346 PE=4 SV=1;tr|A0A6L2NEG1|A0A6L2NEG1_TANCI Uncharacterized mitochondrial protein AtMg00810-like OS=Tanacetum	0.92701	1.378	2916.3	0	3741.9	0	0	0	0	0	0	0	2916.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3741.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699LEI1	A0A699LEI1_TANCI	Uncharacterized protein (Fragment)	Tci_704023	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LLNVHLL	tr|A0A699LEI1|A0A699LEI1_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_704023 PE=4 SV=1	0.92638	1.378	0	0	16518	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16518	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699LF99	A0A699LF99_TANCI	Uncharacterized protein (Fragment)	Tci_709845	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					CTCMDCA	tr|A0A699LF99|A0A699LF99_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_709845 PE=4 SV=1	0.92575	1.378	3575.8	0	0	3798	0	0	0	0	0	3575.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3798	0	0	0	0	0	0	0	0	0	0	0
A0A699LFT9	A0A699LFT9_TANCI	Uncharacterized protein (Fragment)	Tci_710465	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ILIHTLV	tr|A0A699LFT9|A0A699LFT9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_710465 PE=4 SV=1	0.92512	1.378	0	23429	0	0	0	0	0	0	0	0	0	0	0	0	0	23429	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699LFW1	A0A699LFW1_TANCI	"Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic (Fragment)"	Tci_712009	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RPQPEGK	"tr|A0A699LFW1|A0A699LFW1_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_712009 PE=4 SV=1;tr|A0A2U1NW17|A0A2U1NW17_ARTAN UDP-glycosyltransferase 71E1 OS=Artem"	0.7823	1.378	0	41692	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	41692	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699LGX8	A0A699LGX8_TANCI	Uncharacterized protein (Fragment)	Tci_706914	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TFCDYSK	tr|A0A699LGX8|A0A699LGX8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_706914 PE=4 SV=1	0.92449	1.378	0	165380	0	115780	0	0	0	0	0	0	0	0	0	0	0	0	139500	165380	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	115780	0	0	0	0	0	0	0	0	0	0
A0A699LGZ2	A0A699LGZ2_TANCI	Uridine 5'-monophosphate synthase	Tci_711901	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	'de novo' pyrimidine nucleobase biosynthetic process [GO:0006207]; carbohydrate derivative metabolic process [GO:1901135]		carbohydrate derivative binding [GO:0097367]; orotidine-5'-phosphate decarboxylase activity [GO:0004590]; 'de novo' pyrimidine nucleobase biosynthetic process [GO:0006207]; carbohydrate derivative metabolic process [GO:1901135]	carbohydrate derivative binding [GO:0097367]; orotidine-5'-phosphate decarboxylase activity [GO:0004590]	AAKEHGK	tr|A0A699LGZ2|A0A699LGZ2_TANCI Uridine 5-monophosphate synthase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_711901 PE=4 SV=1	0.92386	1.378	27301	77358	51499	56055	58054	0	0	0	0	0	27301	0	0	0	0	23120	37302	0	0	77358	0	0	0	0	0	0	51499	38935	0	0	0	0	0	0	56055	0	48672	0	49811	0	0	40864	58054	0	0	0	0	0	0	0
A0A699LHS6	A0A699LHS6_TANCI	Uncharacterized protein (Fragment)	Tci_707648	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TNEAYGR	tr|A0A699LHS6|A0A699LHS6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_707648 PE=4 SV=1	0.92323	1.378	0	58466	35731	38058	39854	0	0	0	0	0	0	0	0	0	0	0	58466	54590	0	0	0	0	33205	0	0	35731	0	0	0	0	0	0	0	0	0	0	0	38058	0	0	0	35525	0	39854	0	0	35592	0	0	0
A0A699LI66	A0A699LI66_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_715011	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	NIIYRKK	tr|A0A699LI66|A0A699LI66_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_715011 PE=4 SV=1	0.92198	1.378	0	17606	20642	14000	0	0	0	0	0	0	0	0	0	0	10467	17606	16996	0	0	0	14718	0	0	0	0	0	0	0	0	0	0	20642	0	0	0	0	0	14000	0	0	0	0	0	0	0	0	0	0	0	0
A0A699LL95	A0A699LL95_TANCI	Phospholipase-like protein (Fragment)	Tci_710367	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EFQIQFNDYMHYYLPVK	tr|A0A699LL95|A0A699LL95_TANCI Phospholipase-like protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_710367 PE=4 SV=1	0.94684	1.378	21847	8442.9	6374.4	0	0	0	0	0	21847	0	0	0	0	2533.5	0	0	0	0	0	0	0	8442.9	0	0	0	0	0	0	0	6374.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699LNX1	A0A699LNX1_TANCI	Alpha/beta hydrolase fold protein	Tci_718759	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			hydrolase activity [GO:0016787]	hydrolase activity [GO:0016787]	MMKSQPR	tr|A0A699LNX1|A0A699LNX1_TANCI Alpha/beta hydrolase fold protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_718759 PE=4 SV=1	0.94969	1.378	380050	0	0	0	0	0	0	0	0	0	0	0	380050	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699LPI1	A0A699LPI1_TANCI	Reverse transcriptase domain-containing protein	Tci_714717	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	NMEWDCH	tr|A0A699LPI1|A0A699LPI1_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_714717 PE=4 SV=1	0.94902	1.378	445410	7028.1	2086600	429090	0	0	0	0	0	0	366750	0	445410	411040	0	0	7028.1	0	0	0	0	0	0	0	0	0	0	2086600	0	0	0	0	429090	373400	0	9977.8	0	9287.2	0	0	0	0	0	0	0	0	0	0	0	0
A0A699LRM7	A0A699LRM7_TANCI	gag_pre-integrs domain-containing protein (Fragment)	Tci_723644	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	PLLKHLK	tr|A0A699LRM7|A0A699LRM7_TANCI gag_pre-integrs domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_723644 PE=4 SV=1	0.94836	1.378	0	0	10081	11748	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10081	0	0	8861.7	0	6153.4	0	0	4794.1	0	0	0	11748	0	0	0	0	0	0	0	0	0
A0A699LSY4	A0A699LSY4_TANCI	Uncharacterized protein (Fragment)	Tci_718175	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SFESSEQ	tr|A0A699LSY4|A0A699LSY4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_718175 PE=4 SV=1	0.94704	1.378	0	0	0	24549	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24549	0	0	0	0	0	0	0	0	0	0
A0A699LTB7	A0A699LTB7_TANCI	Uncharacterized protein	Tci_725806	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	HAIFDFK	tr|A0A699LTB7|A0A699LTB7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_725806 PE=4 SV=1	0.94572	1.378	7261.5	7093.2	0	0	0	0	0	0	0	7261.5	0	0	0	0	0	0	0	0	0	0	0	7093.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699LTI1	A0A699LTI1_TANCI	Uncharacterized protein	Tci_726023	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DDIIPPK	tr|A0A699LTI1|A0A699LTI1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_726023 PE=4 SV=1	0.93854	1.378	0	0	0	0	39616	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	39616	0	0	0	0	0	0	0	0
A0A699LV27	A0A699LV27_TANCI	Uncharacterized protein (Fragment)	Tci_720279	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					INLMMHR	tr|A0A699LV27|A0A699LV27_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_720279 PE=4 SV=1	0.93801	1.378	0	0	0	9941.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9941.6	0	0	0	0	0	0	0	0	0	0	0
A0A699LVM9	A0A699LVM9_TANCI	Pentatricopeptide repeat-containing protein At3g02330 (Fragment)	Tci_728740	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LLLLSAK	"tr|A0A699LVM9|A0A699LVM9_TANCI Pentatricopeptide repeat-containing protein At3g02330 (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_728740 PE=4 SV=1;tr|A0A6L2P6S8|A0A6L2P6S8_TANCI Protein kinase-like domain, phloem protein 2-like protein OS=Tanac"	0.78308	1.378	0	13095	11379	22930	16194	0	0	0	0	0	0	0	0	0	8356.3	0	0	0	0	0	13095	0	0	0	0	11379	0	0	0	0	0	0	0	0	0	0	0	0	0	22930	0	16194	0	0	0	0	0	0	0	0
A0A699LXV3	A0A699LXV3_TANCI	Uncharacterized protein	Tci_731168	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	MYQHMKK	tr|A0A699LXV3|A0A699LXV3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_731168 PE=4 SV=1;tr|A0A6L2JVG7|A0A6L2JVG7_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_0125	0.94375	1.378	0	16660	22024	20887	0	0	0	0	0	0	0	0	0	0	0	0	16660	0	0	0	15578	0	0	0	0	18133	22024	0	0	0	0	0	0	0	0	0	0	13956	0	20887	0	0	0	0	0	0	0	0	0	0
A0A699LZU4	A0A699LZU4_TANCI	Peroxidase 64	Tci_727553	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			peroxidase activity [GO:0004601]	peroxidase activity [GO:0004601]	LLGYDYR	tr|A0A699LZU4|A0A699LZU4_TANCI Peroxidase 64 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_727553 PE=4 SV=1	0.94244	1.378	0	0	42171	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42171	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699M264	A0A699M264_TANCI	"Transposase, Ptta/En/Spm, transposase, Tnp1/En/Spm-like protein (Fragment)"	Tci_730118	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LKIKHVS	"tr|A0A699M264|A0A699M264_TANCI Transposase, Ptta/En/Spm, transposase, Tnp1/En/Spm-like protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_730118 PE=4 SV=1"	0.94048	1.378	19406	0	0	0	0	0	0	19406	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699M412	A0A699M412_TANCI	Uncharacterized protein	Tci_731846	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VSSKSEN	tr|A0A699M412|A0A699M412_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_731846 PE=4 SV=1	0.93983	1.378	7321.9	0	0	0	9181.7	7321.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9181.7	0	0
A0A699M509	A0A699M509_TANCI	Uncharacterized protein	Tci_733606	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ENDHGCK	tr|A0A699M509|A0A699M509_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_733606 PE=4 SV=1	0.93918	1.378	0	0	6147	6367.7	8170.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6147	0	0	0	0	0	6367.7	0	0	0	0	0	0	0	0	0	0	8170.6	0	0
A0A699M6F0	A0A699M6F0_TANCI	Uncharacterized protein (Fragment)	Tci_741636	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TKLKPPK	tr|A0A699M6F0|A0A699M6F0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_741636 PE=4 SV=1	0.93405	1.378	0	72757	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	72757	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699M6V9	A0A699M6V9_TANCI	Uncharacterized protein	Tci_738309	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SHLPPRK	tr|A0A699M6V9|A0A699M6V9_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_738309 PE=4 SV=1	0.88882	1.378	0	26596	46959	14153	8095	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26596	0	0	0	2270.1	0	0	46959	0	12931	0	0	0	0	0	0	0	0	14153	10050	0	0	0	8095	0	0	0	0	0	0	0
A0A699M7K9	A0A699M7K9_TANCI	Uncharacterized protein (Fragment)	Tci_741711	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LPKLLTK	tr|A0A699M7K9|A0A699M7K9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_741711 PE=4 SV=1	0.85904	1.378	0	0	0	0	22802	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22802	0	0	0	0	0	0
A0A699M8I7	A0A699M8I7_TANCI	Uncharacterized protein (Fragment)	Tci_740045	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			serine-type peptidase activity [GO:0008236]	serine-type peptidase activity [GO:0008236]	DYNLWVR	tr|A0A699M8I7|A0A699M8I7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_740045 PE=4 SV=1	0.85106	2.1966	21974	31109	22404	29079	16576	20968	16229	21974	0	0	0	0	0	0	0	0	0	31109	0	0	0	0	0	17379	15178	0	0	0	0	22404	0	0	29079	0	0	24296	0	0	0	0	0	0	0	12524	0	12403	0	0	16576	0
A0A699M8P1	A0A699M8P1_TANCI	"Transposase (Putative), gypsy type (Fragment)"	Tci_734003	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ECHDESG	"tr|A0A699M8P1|A0A699M8P1_TANCI Transposase (Putative), gypsy type (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_734003 PE=4 SV=1"	0.85795	1.378	0	52642	0	94388	57710	0	0	0	0	0	0	0	0	0	0	48137	0	52642	0	0	0	43624	0	0	0	0	0	0	0	0	0	0	0	43245	53557	77228	0	0	57530	0	94388	0	0	0	0	0	0	0	57710	43921
A0A699M955	A0A699M955_TANCI	Uncharacterized protein (Fragment)	Tci_743697	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ILKPICIR	tr|A0A699M955|A0A699M955_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_743697 PE=4 SV=1	0.89899	1.514	0	0	0	0	2903.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2903.8	0	0
A0A699M9S4	A0A699M9S4_TANCI	Uncharacterized protein (Fragment)	Tci_743022	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VLLLFIK	tr|A0A699M9S4|A0A699M9S4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_743022 PE=4 SV=1	0.94974	1.378	0	0	0	1097.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1097.3	0	0	0	0	0	0	0	0	0	0
A0A699MAT0	A0A699MAT0_TANCI	Uncharacterized protein (Fragment)	Tci_744116	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RALELVE	tr|A0A699MAT0|A0A699MAT0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_744116 PE=4 SV=1	0.79012	1.378	0	0	0	62309	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	62309	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699MCL6	A0A699MCL6_TANCI	Uncharacterized protein (Fragment)	Tci_738005	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SCVQDQG	tr|A0A699MCL6|A0A699MCL6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_738005 PE=4 SV=1	0.94929	1.378	0	12759	12841	9379.5	0	0	0	0	0	0	0	0	0	0	12759	12287	0	0	0	0	0	0	0	0	4319.2	0	0	0	12841	0	0	0	0	0	0	0	0	0	0	9379.5	0	0	0	0	0	0	0	0	0	0
A0A699MEK8	A0A699MEK8_TANCI	Zinc knuckle CX2CX4HX4C (Fragment)	Tci_748975	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NVKAPPK	tr|A0A699MEK8|A0A699MEK8_TANCI Zinc knuckle CX2CX4HX4C (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_748975 PE=4 SV=1	0.78874	1.378	0	0	0	5043.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5043.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699MFS1	A0A699MFS1_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment)	Tci_750238	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MVMGSSC	tr|A0A699MFS1|A0A699MFS1_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_750238 PE=4 SV=1	0.9248	1.378	0	12172	0	12805	0	0	0	0	0	0	0	0	0	0	12172	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12805	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699MGS8	A0A699MGS8_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_751331	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	DGRQRSK	tr|A0A699MGS8|A0A699MGS8_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_751331 PE=4 SV=1	0.94057	1.378	10859	10712	13346	22554	12392	9069	0	0	0	0	0	0	10859	0	10712	7641.6	5759.1	0	0	0	6702	0	0	13346	0	0	0	0	0	0	0	12720	0	0	0	0	9895.3	10221	8333.5	22554	0	0	0	0	10875	0	12392	0	0	0
A0A699MHV1	A0A699MHV1_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_751307	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	LKPLSHK	tr|A0A699MHV1|A0A699MHV1_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_751307 PE=4 SV=1	0.92225	1.378	5308.3	7382.2	4092.4	0	5778.3	0	0	5308.3	0	0	0	0	0	0	0	0	7382.2	0	0	0	0	0	0	0	4092.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5778.3	0
A0A699MJB6	A0A699MJB6_TANCI	Uncharacterized protein	Tci_754582	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KTIKTGK	tr|A0A699MJB6|A0A699MJB6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_754582 PE=4 SV=1	0.78691	1.378	16467	0	0	0	3441	0	0	0	0	0	16467	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3441	0	0	0	0	0
A0A699MJI9	A0A699MJI9_TANCI	Uncharacterized protein (Fragment)	Tci_752211	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KEDELTV	tr|A0A699MJI9|A0A699MJI9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_752211 PE=4 SV=1	0.93883	1.378	0	253700	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	253700	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699MK14	A0A699MK14_TANCI	"Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic (Fragment)"	Tci_749646	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SPPNSRK	"tr|A0A699MK14|A0A699MK14_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_749646 PE=4 SV=1"	0.9412	1.378	0	0	8044.1	41461	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8044.1	0	0	41461	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699MKE2	A0A699MKE2_TANCI	Uncharacterized protein (Fragment)	Tci_755086	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PAAKPKVLK	tr|A0A699MKE2|A0A699MKE2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_755086 PE=4 SV=1	0.78646	1.378	0	9959.6	15069	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9959.6	0	0	0	0	0	15069	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699MKL3	A0A699MKL3_TANCI	Reverse transcriptase domain-containing protein	Tci_750243	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	VQSWQQK	tr|A0A699MKL3|A0A699MKL3_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_750243 PE=4 SV=1	0.786	1.378	0	0	0	0	17695	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17695	0	0	0	0	0
A0A699MKL4	A0A699MKL4_TANCI	Uncharacterized protein (Fragment)	Tci_752883	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TDGMGYD	tr|A0A699MKL4|A0A699MKL4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_752883 PE=4 SV=1	0.78555	1.378	14584	0	11878	17171	0	0	0	0	0	0	14584	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11878	0	0	0	0	0	0	0	17171	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699MLH3	A0A699MLH3_TANCI	Uncharacterized protein (Fragment)	Tci_751176	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TESSTAS	tr|A0A699MLH3|A0A699MLH3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_751176 PE=4 SV=1	0.9291	1.378	4818.1	0	0	0	0	0	0	0	0	0	0	0	4818.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699MLV0	A0A699MLV0_TANCI	Uncharacterized protein	Tci_757070	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PGQENCR	tr|A0A699MLV0|A0A699MLV0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_757070 PE=4 SV=1	0.7851	1.378	0	0	0	101740	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	101740	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699MLW2	A0A699MLW2_TANCI	CCHC-type domain-containing protein (Fragment)	Tci_747456	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	KLLIGLT	tr|A0A699MLW2|A0A699MLW2_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_747456 PE=4 SV=1	0.92356	1.378	3647.9	36208	15955	19962	17693	3647.9	0	0	0	0	0	0	3103.6	0	0	14092	0	36208	0	22282	15663	0	0	0	0	0	0	0	15955	0	0	0	0	0	0	0	14615	0	13755	19962	0	17534	17693	0	0	0	0	0	0	0
A0A699MNN9	A0A699MNN9_TANCI	Uncharacterized protein	Tci_758484	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KHRFPHR	tr|A0A699MNN9|A0A699MNN9_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_758484 PE=4 SV=1;tr|A0A6L2LR61|A0A6L2LR61_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_034563 PE=4 SV=1	0.83871	2.1365	0	0	0	50312	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	48216	0	0	0	0	50312	0	0	0	0	0	0	0	0	0	0
A0A699MNU9	A0A699MNU9_TANCI	Uncharacterized protein (Fragment)	Tci_757512	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ESRGDPG	tr|A0A699MNU9|A0A699MNU9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_757512 PE=4 SV=1	0.93503	1.378	0	884200	0	436140	1237300	0	0	0	0	0	0	0	0	0	0	0	0	0	835620	884200	0	0	0	0	0	0	0	0	0	0	0	0	186440	159110	0	0	436140	0	0	0	0	0	1237300	0	0	28417	0	196200	131230	0
A0A699MQ58	A0A699MQ58_TANCI	Uncharacterized protein (Fragment)	Tci_750633	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					AFNVYNK	tr|A0A699MQ58|A0A699MQ58_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_750633 PE=4 SV=1;tr|A0A699NE86|A0A699NE86_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_772730 PE=4 SV=	0.9	2.756	886740	875730	598220	957850	693800	842780	886740	232120	26339	25683	8583.1	0	0	0	64092	38800	23186	827610	875730	0	0	0	0	0	14651	161600	11690	0	598220	416860	0	159510	0	0	169400	195900	359700	807450	957850	140010	95458	657530	25236	693800	35906	61894	154870	444770	0	139040
A0A699MRL2	A0A699MRL2_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_757236	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	LKIFFRK	tr|A0A699MRL2|A0A699MRL2_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_757236 PE=4 SV=1;tr|A0A6L2M8K8|A0A6L2M8K8_TANCI DNA-directed DNA polymerase OS=Tanacetum cinerariifolium OX=118510 GN=Tc	0.87452	1.378	0	0	0	641410	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	641410	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699MS76	A0A699MS76_TANCI	Protein DJ-1 homolog D (Fragment)	Tci_752824	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EFAHTGK	tr|A0A699MS76|A0A699MS76_TANCI Protein DJ-1 homolog D (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_752824 PE=3 SV=1	0.78329	1.378	0	0	0	618930	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	618930	0	0	0	0	0	0	0	0	0	0
A0A699MVK3	A0A699MVK3_TANCI	Uncharacterized protein (Fragment)	Tci_760117	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SNESDDD	tr|A0A699MVK3|A0A699MVK3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_760117 PE=4 SV=1	0.78193	1.378	0	0	3817.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3817.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699MVL6	A0A699MVL6_TANCI	Uncharacterized protein	Tci_764536	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					CWIRQTK	tr|A0A699MVL6|A0A699MVL6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_764536 PE=4 SV=1	0.78148	1.378	1588.9	3084.2	0	0	0	1588.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3084.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699MVW1	A0A699MVW1_TANCI	Uncharacterized protein (Fragment)	Tci_766385	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					APSGDCS	tr|A0A699MVW1|A0A699MVW1_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_766385 PE=4 SV=1	0.90402	1.378	19971	9666.5	7630.4	12638	4037.7	0	19971	10281	0	0	0	0	17129	0	0	7562.6	0	0	0	0	9666.5	0	0	1987	0	0	0	0	7630.4	0	0	0	0	0	0	10872	0	0	12638	10144	0	0	0	0	0	0	0	2703.4	4037.7	0
A0A699MZV4	A0A699MZV4_TANCI	"RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein (Fragment)"	Tci_765298	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	VFIKRHK	"tr|A0A699MZV4|A0A699MZV4_TANCI RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_765298 PE=4 SV=1"	0.85633	1.378	0	0	92930	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	92930	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699N171	A0A699N171_TANCI	Uncharacterized protein (Fragment)	Tci_771500	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DDGEVVN	tr|A0A699N171|A0A699N171_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_771500 PE=4 SV=1	0.84772	1.378	0	14120	6686	0	5627.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14120	0	0	0	0	0	0	6686	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5627.5	0	0	0	0	0
A0A699N1X6	A0A699N1X6_TANCI	Putative ribonuclease H-like domain-containing protein (Fragment)	Tci_768712	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	TRRIIHK	tr|A0A699N1X6|A0A699N1X6_TANCI Putative ribonuclease H-like domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_768712 PE=4 SV=1	0.84544	1.378	0	2992.2	0	1079.7	2893.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2992.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1079.7	0	0	0	2893.4	0	0	0	0	0	0	0	0
A0A699N207	A0A699N207_TANCI	Uncharacterized protein (Fragment)	Tci_772236	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TSAVTAV	tr|A0A699N207|A0A699N207_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_772236 PE=4 SV=1	0.79288	1.378	40084	0	0	0	6417.5	0	0	0	0	0	0	40084	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3865.1	0	0	0	0	0	6417.5
A0A699N3H4	A0A699N3H4_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_769533	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RAMYFAK	tr|A0A699N3H4|A0A699N3H4_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_769533 PE=4 SV=1	0.84309	1.378	0	0	46882	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	46882	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699N3M7	A0A699N3M7_TANCI	Uncharacterized protein (Fragment)	Tci_763509	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GAGGKTG	tr|A0A699N3M7|A0A699N3M7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_763509 PE=4 SV=1	0.80367	1.378	58601	0	39923	31695	21095	0	0	0	0	0	58601	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8155.8	34704	39923	30419	0	0	0	0	0	31695	0	0	31352	0	0	0	0	0	0	0	0	21095	0	0	0
A0A699N4J5	A0A699N4J5_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment)	Tci_768679	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NEDGVDL	tr|A0A699N4J5|A0A699N4J5_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_768679 PE=4 SV=1	0.80319	1.378	0	1589900	255020	0	540990	0	0	0	0	0	0	0	0	0	0	0	0	40031	0	0	0	1589900	0	255020	0	0	0	0	15273	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	321260	216750	540990	0	19008	0
A0A699N7I5	A0A699N7I5_TANCI	Putative reverse transcriptase domain-containing protein	Tci_775749	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	ENISAEG	tr|A0A699N7I5|A0A699N7I5_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_775749 PE=4 SV=1	0.80224	1.378	0	0	8391.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8391.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699N917	A0A699N917_TANCI	Uncharacterized protein (Fragment)	Tci_768366	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DNPTPSS	tr|A0A699N917|A0A699N917_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_768366 PE=4 SV=1	0.80177	1.378	912310	0	0	297330	1291800	0	419180	0	0	912310	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17285	297330	0	0	1291800	0	0	0	0	428020	0	0
A0A699N9A2	A0A699N9A2_TANCI	Reverse transcriptase domain-containing protein	Tci_775562	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	FGYHAEK	tr|A0A699N9A2|A0A699N9A2_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_775562 PE=4 SV=1	0.87017	1.378	0	0	34292	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34292	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699N9X0	A0A699N9X0_TANCI	Homeodomain-like protein	Tci_768970	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			DNA binding [GO:0003677]	DNA binding [GO:0003677]	NGSHAGT	tr|A0A699N9X0|A0A699N9X0_TANCI Homeodomain-like protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_768970 PE=4 SV=1	0.80082	1.378	8326.5	0	0	0	7653	0	6629.9	8326.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7653	0	0	0	0	0	0
A0A699NBC3	A0A699NBC3_TANCI	Uncharacterized protein (Fragment)	Tci_776994	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LLLINPK	tr|A0A699NBC3|A0A699NBC3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_776994 PE=4 SV=1;tr|A0A6L2KZN5|A0A6L2KZN5_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_026248 PE=4 SV=1	0.79988	1.378	0	1238000	14888	14244	120690	0	0	0	0	0	0	0	0	0	3603.6	0	0	299460	1238000	0	0	0	0	9877.1	0	0	0	0	14888	0	14465	0	0	0	0	0	0	0	0	14244	0	0	0	0	10934	11755	8260.3	0	0	120690
A0A699NBD8	A0A699NBD8_TANCI	Reverse transcriptase domain-containing protein	Tci_774836	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	RGNVGGT	tr|A0A699NBD8|A0A699NBD8_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_774836 PE=4 SV=1	0.79847	1.378	0	31513	0	0	79172	0	0	0	0	0	0	0	0	0	31513	0	7778.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	79172	0	0	0	0	0	0	0
A0A699NCM9	A0A699NCM9_TANCI	gag_pre-integrs domain-containing protein (Fragment)	Tci_776104	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PNVAGSG	tr|A0A699NCM9|A0A699NCM9_TANCI gag_pre-integrs domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_776104 PE=4 SV=1	0.79754	1.378	0	13017	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13017	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699NDF4	A0A699NDF4_TANCI	Uncharacterized protein (Fragment)	Tci_779047	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TACNDRL	tr|A0A699NDF4|A0A699NDF4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_779047 PE=4 SV=1	0.79707	1.378	19101	38683	0	34451	162510	0	0	0	0	15787	0	0	0	19101	0	0	0	14572	18555	0	0	38683	0	0	0	0	0	0	0	0	0	0	34451	0	0	0	0	0	0	0	0	0	0	7076.4	0	162510	0	0	0	14209
A0A699NDW6	A0A699NDW6_TANCI	Uncharacterized protein	Tci_783647	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RPNMNVR	tr|A0A699NDW6|A0A699NDW6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_783647 PE=4 SV=1;tr|A0A699L1Y0|A0A699L1Y0_TANCI Ribonuclease H-like domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_6915	0.93338	1.378	0	0	0	0	58774	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	58774	0	0
A0A699NDY6	A0A699NDY6_TANCI	Uncharacterized protein	Tci_783695	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VVNPRIK	tr|A0A699NDY6|A0A699NDY6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_783695 PE=4 SV=1	0.7966	1.378	20421	17432	0	16980	0	0	0	0	0	0	0	20421	0	0	0	0	0	0	0	0	0	17432	0	0	0	0	0	0	0	0	0	0	0	16980	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699NEX1	A0A699NEX1_TANCI	Reverse transcriptase domain-containing protein	Tci_780384	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	LLNDDPL	tr|A0A699NEX1|A0A699NEX1_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_780384 PE=4 SV=1	0.79613	1.378	56694	0	22125	0	2314.4	0	0	0	0	0	56694	0	0	0	0	0	0	0	0	0	0	0	0	7609.5	0	0	0	0	0	0	0	22125	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2314.4	0
A0A699NGM6	A0A699NGM6_TANCI	Uncharacterized protein (Fragment)	Tci_781148	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		EGFCWWR	tr|A0A699NGM6|A0A699NGM6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_781148 PE=4 SV=1	0.8253	1.378	0	0	47550	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	47550	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699NGT8	A0A699NGT8_TANCI	Putative ribonuclease H-like domain-containing protein (Fragment)	Tci_775082	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LKLPHGR	tr|A0A699NGT8|A0A699NGT8_TANCI Putative ribonuclease H-like domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_775082 PE=4 SV=1	0.82485	1.378	0	11121	0	0	14992	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11121	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14992	0	0	0	0	0	0	0	0
A0A699NIZ1	A0A699NIZ1_TANCI	CCHC-type domain-containing protein (Fragment)	Tci_784195	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	LLLLLMR	tr|A0A699NIZ1|A0A699NIZ1_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_784195 PE=4 SV=1	0.79474	1.378	7319.4	0	0	0	0	0	0	0	0	0	0	0	7319.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699NJG7	A0A699NJG7_TANCI	"Zinc finger, CCHC-type (Fragment)"	Tci_784920	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					FGGLNSR	"tr|A0A699NJG7|A0A699NJG7_TANCI Zinc finger, CCHC-type (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_784920 PE=4 SV=1"	0.79427	1.378	0	0	6029.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6029.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699NJW6	A0A699NJW6_TANCI	Uncharacterized protein (Fragment)	Tci_785388	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ADDLDAH	tr|A0A699NJW6|A0A699NJW6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_785388 PE=4 SV=1	0.75795	1.378	5540.4	6135	0	25256	0	0	0	0	0	5540.4	0	0	0	0	6135	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6121.9	0	0	0	0	25256	16975	0	0	0	0	0	0	0	0	0
A0A699NL01	A0A699NL01_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_788270	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	LKKLWIY	tr|A0A699NL01|A0A699NL01_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_788270 PE=4 SV=1	0.82577	1.378	40052	8363	16653	0	17275	0	0	0	0	40052	0	0	0	0	0	0	0	0	8363	0	0	0	0	0	0	0	0	0	0	0	16653	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17275	0	0
A0A699NMZ9	A0A699NMZ9_TANCI	UDP-glucuronic acid decarboxylase 6-like (Fragment)	Tci_789823	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	D-xylose metabolic process [GO:0042732]		NAD+ binding [GO:0070403]; UDP-glucuronate decarboxylase activity [GO:0048040]; D-xylose metabolic process [GO:0042732]	NAD+ binding [GO:0070403]; UDP-glucuronate decarboxylase activity [GO:0048040]	VSHGGTK	tr|A0A699NMZ9|A0A699NMZ9_TANCI UDP-glucuronic acid decarboxylase 6-like (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_789823 PE=4 SV=1	0.82467	1.378	5607.1	5450.1	4870	4112.9	3835.4	4707.7	0	5607.1	0	0	0	0	4224.1	0	4738.2	0	5450.1	0	0	0	0	0	0	4870	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4112.9	0	0	0	0	3835.4	0	0	0	0
A0A699NP78	A0A699NP78_TANCI	Uncharacterized protein (Fragment)	Tci_793725	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HGLSGPR	tr|A0A699NP78|A0A699NP78_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_793725 PE=4 SV=1	0.82414	1.378	42222	50725	28616	51022	0	0	0	0	0	0	42222	0	0	0	0	0	0	0	0	0	0	0	50725	0	0	0	0	0	28616	0	0	22181	0	0	42800	0	50234	51022	46650	0	0	0	0	0	0	0	0	0	0	0
A0A699NPB0	A0A699NPB0_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment)	Tci_793811	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DGFHRLR	tr|A0A699NPB0|A0A699NPB0_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_793811 PE=4 SV=1	0.82316	1.378	0	0	10600	17434	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10600	0	0	10438	0	0	0	0	0	0	0	0	0	0	0	17434	0	0	0	0	0	0	0	0	0
A0A699NPJ1	A0A699NPJ1_TANCI	Uncharacterized protein (Fragment)	Tci_791465	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DDAEGDA	tr|A0A699NPJ1|A0A699NPJ1_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_791465 PE=4 SV=1	0.8227	1.378	0	0	5889.5	5315.9	8017.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5889.5	0	0	0	0	0	0	0	0	0	0	0	0	5315.9	0	0	8017.1	0	0	0	0	0	0	0	0
A0A699NQB0	A0A699NQB0_TANCI	Putative reverse transcriptase domain-containing protein	Tci_793939	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	VLQPQLM	tr|A0A699NQB0|A0A699NQB0_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_793939 PE=4 SV=1	0.82164	1.378	7130800	0	0	0	0	0	0	0	0	0	7130800	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699NQS1	A0A699NQS1_TANCI	Uncharacterized protein (Fragment)	Tci_790308	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					THMGRVR	tr|A0A699NQS1|A0A699NQS1_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_790308 PE=4 SV=1	0.77969	1.378	15006	0	0	0	0	0	0	0	0	0	0	0	15006	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699NTE8	A0A699NTE8_TANCI	DUF4218 domain-containing protein (Fragment)	Tci_797569	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KRSWGCK	tr|A0A699NTE8|A0A699NTE8_TANCI DUF4218 domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_797569 PE=4 SV=1	0.83786	1.378	0	0	0	8120.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8120.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699NUA1	A0A699NUA1_TANCI	Uncharacterized protein	Tci_791242	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MLDNTSK	tr|A0A699NUA1|A0A699NUA1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_791242 PE=4 SV=1;tr|A0A699W0G4|A0A699W0G4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_913374 PE=4 SV=1;tr|A0A699	0.78828	1.378	0	5478.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5478.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699NV56	A0A699NV56_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_792005	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	VCITYQK	tr|A0A699NV56|A0A699NV56_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_792005 PE=4 SV=1	0.7678	1.378	0	0	0	6680.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6680.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699NVU8	A0A699NVU8_TANCI	Uncharacterized protein (Fragment)	Tci_799704	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					THVSTIK	tr|A0A699NVU8|A0A699NVU8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_799704 PE=4 SV=1	0.83601	1.378	0	0	0	0	4668.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4668.5	0	0	0	0	0	0	0	0
A0A699NW03	A0A699NW03_TANCI	Uncharacterized protein	Tci_798457	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					CCMACNK	tr|A0A699NW03|A0A699NW03_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_798457 PE=4 SV=1	0.8403	1.378	9124.4	0	0	0	0	0	0	0	0	0	0	9124.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699NXS8	A0A699NXS8_TANCI	CCHC-type domain-containing protein (Fragment)	Tci_798746	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	EQKSLAH	tr|A0A699NXS8|A0A699NXS8_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_798746 PE=4 SV=1	0.84066	1.378	0	17615	0	18509	0	0	0	0	0	0	0	0	0	0	12195	12029	17615	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15641	0	13350	18509	0	0	0	0	0	0	0	0	0	0
A0A699NYB5	A0A699NYB5_TANCI	Reverse transcriptase domain-containing protein	Tci_797098	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	LLDEPPK	tr|A0A699NYB5|A0A699NYB5_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_797098 PE=4 SV=1	0.76607	1.378	9637.1	9908.4	7144	10271	5520.1	0	0	0	9637.1	9039.2	0	0	0	7991.2	0	0	0	9332.6	9908.4	0	0	0	0	0	5934.9	0	0	0	0	7144	0	0	10271	0	0	0	0	0	0	0	0	0	0	5520.1	0	0	0	0	0	0
A0A699NYK2	A0A699NYK2_TANCI	Caffeoylshikimate esterase-like (Fragment)	Tci_796203	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					YFNTAEM	tr|A0A699NYK2|A0A699NYK2_TANCI Caffeoylshikimate esterase-like (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_796203 PE=4 SV=1	0.84021	1.378	8600.9	0	4689.4	0	0	0	0	0	0	0	0	8600.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4689.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699NZU3	A0A699NZU3_TANCI	Retrotransposable element Tf2 (Fragment)	Tci_800559	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QSGCSYR	tr|A0A699NZU3|A0A699NZU3_TANCI Retrotransposable element Tf2 (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_800559 PE=4 SV=1	0.82953	1.378	0	7310.4	0	8852.8	0	0	0	0	0	0	0	0	0	0	0	0	0	7310.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8852.8	0	0	0	0	0	0	0	0	0	0
A0A699P2U9	A0A699P2U9_TANCI	Uncharacterized protein	Tci_803084	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PKLLNNM	tr|A0A699P2U9|A0A699P2U9_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_803084 PE=4 SV=1	0.83452	1.378	40830	43813	65893	59806	84687	0	0	0	0	0	40830	0	0	0	0	43813	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	65893	0	0	59806	0	0	0	0	0	42461	0	0	84687	0	0	0	0	0	0
A0A699P2Z0	A0A699P2Z0_TANCI	Uncharacterized protein	Tci_804017	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GVVYRLK	tr|A0A699P2Z0|A0A699P2Z0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_804017 PE=4 SV=1	0.76563	1.378	16087	27630	13460	11006	0	0	0	0	0	0	0	16087	0	7506.9	0	0	0	0	27630	0	0	14494	0	0	0	0	0	0	0	13460	0	0	11006	7976.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699P559	A0A699P559_TANCI	Uncharacterized protein (Fragment)	Tci_806021	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EKDSTED	tr|A0A699P559|A0A699P559_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_806021 PE=4 SV=1	0.90198	1.378	0	113530	0	0	52471	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	113530	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	52471	0
A0A699P8T0	A0A699P8T0_TANCI	Uncharacterized protein (Fragment)	Tci_805621	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VTAAYAK	tr|A0A699P8T0|A0A699P8T0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_805621 PE=4 SV=1	0.76477	1.378	0	68449	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	68449	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699PAM4	A0A699PAM4_TANCI	T2SSE_N domain-containing protein (Fragment)	Tci_806498	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TRLRVFK	tr|A0A699PAM4|A0A699PAM4_TANCI T2SSE_N domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_806498 PE=4 SV=1	0.90176	1.378	0	0	0	0	25266	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25266	0	0	0	0	0	0	0
A0A699PAW6	A0A699PAW6_TANCI	Uncharacterized protein	Tci_800991	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VTAAAPP	tr|A0A699PAW6|A0A699PAW6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_800991 PE=4 SV=1	0.76434	1.378	0	0	4162.6	4180.4	17344	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4162.6	0	0	0	0	0	0	0	0	0	0	4180.4	0	0	17344	0	0	0	0	0	0
A0A699PAZ7	A0A699PAZ7_TANCI	Reverse transcriptase domain-containing protein	Tci_807577	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	SCGGHSA	tr|A0A699PAZ7|A0A699PAZ7_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_807577 PE=4 SV=1	0.76391	1.378	0	0	0	0	1344.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1344.8
A0A699PB27	A0A699PB27_TANCI	Uncharacterized protein (Fragment)	Tci_807660	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GFLPRVK	tr|A0A699PB27|A0A699PB27_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_807660 PE=4 SV=1	0.76348	1.378	0	7305	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7305	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699PBU7	A0A699PBU7_TANCI	"Zinc finger, CCHC-type, retrotransposon Gag domain protein (Fragment)"	Tci_811001	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PGGLLHM	"tr|A0A699PBU7|A0A699PBU7_TANCI Zinc finger, CCHC-type, retrotransposon Gag domain protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_811001 PE=4 SV=1;tr|A0A699WRP9|A0A699WRP9_TANCI Zinc finger, CCHC-type, retrotransposon Gag domain protein (F"	0.89345	1.378	0	74609	39954	0	11201	0	0	0	0	0	0	0	0	0	0	0	7911.1	0	0	74609	0	0	0	9952.2	0	18481	0	0	0	0	0	39954	0	0	0	0	0	0	0	0	0	0	0	0	0	8562.6	11201	0	0	0
A0A699PBV8	A0A699PBV8_TANCI	Uncharacterized protein (Fragment)	Tci_813686	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HSEQSDS	tr|A0A699PBV8|A0A699PBV8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_813686 PE=4 SV=1	0.76263	1.378	0	6014.3	0	151530	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6014.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	151530	0	3862.3	6305.6	0	0	0	0	0	0	0	0	0	0	0
A0A699PDL9	A0A699PDL9_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_811641	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	SSGSDCD	tr|A0A699PDL9|A0A699PDL9_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_811641 PE=4 SV=1	0.89658	1.378	17571	0	10144	10545	11624	0	10227	17571	0	0	0	0	16406	0	0	0	0	0	0	0	0	0	0	0	7289.2	0	0	0	9771.9	0	6748.1	10144	0	0	0	10545	0	0	0	0	5976	0	0	0	0	7228.2	0	11624	0	0
A0A699PEC2	A0A699PEC2_TANCI	Uncharacterized protein (Fragment)	Tci_813196	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MMGDNSK	tr|A0A699PEC2|A0A699PEC2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_813196 PE=4 SV=1;tr|A0A699HPE2|A0A699HPE2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_425707 PE=4 SV=1;tr|A0A699	0.86395	1.378	0	0	0	19036	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19036	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699PEN0	A0A699PEN0_TANCI	Ribonuclease H-like domain-containing protein	Tci_809130	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QLLKYKK	tr|A0A699PEN0|A0A699PEN0_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_809130 PE=4 SV=1;tr|A0A6L2M9L3|A0A6L2M9L3_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 	0.91705	1.378	0	2379.4	7530.9	12283	18175	0	0	0	0	0	0	0	0	0	0	2379.4	0	0	0	0	0	0	0	7530.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12283	10835	0	0	0	0	0	0	0	18175	0
A0A699PFD4	A0A699PFD4_TANCI	Uncharacterized protein (Fragment)	Tci_809658	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TSEAVTK	tr|A0A699PFD4|A0A699PFD4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_809658 PE=4 SV=1	0.91496	1.378	46606	0	23436	0	30786	14473	46606	0	0	0	0	0	24384	0	0	0	0	0	0	0	0	0	0	4640.1	0	0	0	0	0	0	10817	23436	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12602	0	30786	0
A0A699PG25	A0A699PG25_TANCI	Uncharacterized protein	Tci_814584	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SNHASAM	tr|A0A699PG25|A0A699PG25_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_814584 PE=4 SV=1	0.9141	1.378	41029	7765.7	47917	16904	693800	0	0	0	0	0	41029	0	0	0	0	0	7765.7	0	0	0	0	0	0	0	0	6070.1	14887	47917	0	0	0	0	0	0	16904	0	0	0	0	0	0	0	14900	693800	15760	0	17253	0	0	0
A0A699PG94	A0A699PG94_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_817054	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	TSQTVPP	tr|A0A699PG94|A0A699PG94_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_817054 PE=4 SV=1	0.91406	1.378	0	17620	10883	8097.2	0	0	0	0	0	0	0	0	0	0	6457.3	0	0	0	0	17620	0	0	0	0	0	0	0	0	10883	0	0	0	0	0	0	0	8097.2	6951.6	0	0	0	0	0	0	0	0	0	0	0	0
A0A699PGM9	A0A699PGM9_TANCI	DNA-directed DNA polymerase (Fragment)	Tci_815035	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			DNA-directed DNA polymerase activity [GO:0003887]	DNA-directed DNA polymerase activity [GO:0003887]	RALNWEK	tr|A0A699PGM9|A0A699PGM9_TANCI DNA-directed DNA polymerase (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_815035 PE=4 SV=1	0.76177	1.378	0	0	0	687290	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	687290	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699PGP1	A0A699PGP1_TANCI	Uncharacterized mitochondrial protein AtMg00810-like (Fragment)	Tci_815055	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QSTSGSV	tr|A0A699PGP1|A0A699PGP1_TANCI Uncharacterized mitochondrial protein AtMg00810-like (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_815055 PE=4 SV=1	0.76134	1.378	0	21561	11827	14207	12459	0	0	0	0	0	0	0	0	0	9424.7	0	0	0	0	20893	21561	0	0	0	0	0	0	0	0	0	11827	0	0	0	0	0	0	12593	0	0	14207	0	0	0	12459	9640.6	0	0	0	0
A0A699PGP2	A0A699PGP2_TANCI	Uncharacterized protein (Fragment)	Tci_812201	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VLKRVFK	tr|A0A699PGP2|A0A699PGP2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_812201 PE=4 SV=1	0.91747	1.378	12449	0	0	24272	0	0	0	0	0	12449	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24272	0	0	0	0	0	0	0	0	0	0
A0A699PHN4	A0A699PHN4_TANCI	Uncharacterized protein (Fragment)	Tci_813013	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LRAWLFK	tr|A0A699PHN4|A0A699PHN4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_813013 PE=4 SV=1;tr|A0A699IV73|A0A699IV73_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_560745 PE=4 SV	0.86341	1.378	0	0	0	0	4790.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4790.1
A0A699PI38	A0A699PI38_TANCI	Uncharacterized protein (Fragment)	Tci_813735	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EQETHKK	tr|A0A699PI38|A0A699PI38_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_813735 PE=4 SV=1;tr|A0A699UJ95|A0A699UJ95_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_893297 PE=4 SV=	0.76049	1.378	0	12456	10481	10182	9501.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12456	8186.3	0	0	0	0	6246.9	0	0	10481	0	0	0	0	0	0	0	0	8242.4	8392.8	10182	0	9501.7	0	0	0	0	6220	0	0	0
A0A699PIE5	A0A699PIE5_TANCI	Uncharacterized protein (Fragment)	Tci_816129	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VVVVAAR	tr|A0A699PIE5|A0A699PIE5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_816129 PE=4 SV=1	0.76007	1.378	11939	4567	0	7854.8	30272	0	11939	0	0	0	0	0	0	0	4567	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7854.8	0	0	0	0	0	0	0	0	0	30272	0	0	0	0	0	0
A0A699PIE7	A0A699PIE7_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_812768	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	NLEKNMM	tr|A0A699PIE7|A0A699PIE7_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_812768 PE=4 SV=1	0.921	1.378	31919	47467	44927	34406	20271	31919	6182.6	19794	0	0	26826	0	0	0	31829	25596	44440	0	0	27874	47467	0	0	44927	0	22860	0	0	36819	0	0	0	0	0	0	0	22099	0	21962	34406	19044	0	0	0	18330	0	20271	0	0	0
A0A699PJ21	A0A699PJ21_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_812845	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	CGYIGHK	tr|A0A699PJ21|A0A699PJ21_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_812845 PE=4 SV=1	0.75964	1.378	6715.4	5933.3	0	6833.4	0	0	0	0	0	0	6715.4	0	0	0	0	0	0	0	0	5933.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6833.4	0	0	4794.1	0	0	0	0	0	0	0	0	0	0	0	0
A0A699PJX7	A0A699PJX7_TANCI	Reverse transcriptase domain-containing protein	Tci_820013	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	VFKTLKR	tr|A0A699PJX7|A0A699PJX7_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_820013 PE=4 SV=1	0.75879	1.378	0	0	17019	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17019	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699PKR7	A0A699PKR7_TANCI	Uncharacterized protein	Tci_814635	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NSKEYAS	tr|A0A699PKR7|A0A699PKR7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_814635 PE=4 SV=1;tr|A0A699QNF5|A0A699QNF5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_845233 PE=4 SV=1	0.75837	1.378	8939.9	0	0	0	0	0	0	0	8939.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699PL03	A0A699PL03_TANCI	Reverse transcriptase domain-containing protein	Tci_815598	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	LWRKLLP	tr|A0A699PL03|A0A699PL03_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_815598 PE=4 SV=1;tr|A0A699MHS8|A0A699MHS8_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118	0.78737	1.378	3371.5	0	0	0	0	0	0	0	0	0	3371.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699PL28	A0A699PL28_TANCI	Uncharacterized protein (Fragment)	Tci_815656	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DAEVLTR	tr|A0A699PL28|A0A699PL28_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_815656 PE=4 SV=1	0.76823	1.378	13844	0	0	0	6156.1	0	13844	9034.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6156.1	0	0
A0A699PLB1	A0A699PLB1_TANCI	Reverse transcriptase domain-containing protein	Tci_818776	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	NISVQHK	tr|A0A699PLB1|A0A699PLB1_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_818776 PE=4 SV=1	0.90791	1.378	10680	10480	0	0	6421.3	0	0	0	10680	0	0	0	0	3583	0	0	0	0	10480	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6421.3	0	0	0	0	0	0
A0A699PLF0	A0A699PLF0_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_810013	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	LPKLNLI	tr|A0A699PLF0|A0A699PLF0_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_810013 PE=4 SV=1;tr|A0A699MWK3|A0A699MWK3_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum 	0.85406	1.378	208180	2857200	1541400	3063000	4651900	19473	22270	36150	20506	0	208180	0	20021	0	1127000	1405200	1385600	1256300	2857200	65759	25924	0	0	117210	292120	40514	0	31603	669820	1541400	0	0	0	0	0	3063000	2293800	2185700	682320	707960	0	4651900	119600	784190	12814	15529	6707.1	0	9081.1	0
A0A699PM00	A0A699PM00_TANCI	Uncharacterized protein (Fragment)	Tci_819235	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PPIILLR	tr|A0A699PM00|A0A699PM00_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_819235 PE=4 SV=1	0.90749	1.378	9465	10284	13005	0	0	0	0	0	9465	0	0	0	0	5014.9	0	0	0	10284	0	0	0	0	6656.4	0	0	0	0	0	0	13005	5351	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699PNW8	A0A699PNW8_TANCI	Uncharacterized protein (Fragment)	Tci_817757	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PAPHPHR	tr|A0A699PNW8|A0A699PNW8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_817757 PE=4 SV=1	0.76867	1.378	8613.3	10399	10599	8648.6	6601.2	8613.3	0	8527.3	0	0	0	0	7355.8	0	6918.9	0	8083.8	0	0	0	0	0	10399	4717	6934.4	0	0	0	0	0	0	10599	0	0	0	0	0	0	0	0	8648.6	0	0	0	0	6400.4	0	6601.2	0	0
A0A699PP46	A0A699PP46_TANCI	"Retrotransposon protein, putative, Ty1-copia subclass (Fragment)"	Tci_814624	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	PKIIISR	"tr|A0A699PP46|A0A699PP46_TANCI Retrotransposon protein, putative, Ty1-copia subclass (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_814624 PE=4 SV=1;tr|A0A699HTF3|A0A699HTF3_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerar"	0.90299	1.378	5210.5	11287	0	0	0	3870.1	5210.5	0	0	0	0	0	0	0	0	0	11287	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699PPV8	A0A699PPV8_TANCI	Uncharacterized protein (Fragment)	Tci_821575	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QQAKPDK	tr|A0A699PPV8|A0A699PPV8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_821575 PE=4 SV=1	0.91148	1.378	0	16916	32343	22716	37904	0	0	0	0	0	0	0	0	0	16916	0	0	0	0	0	0	0	0	0	18072	0	0	0	32343	0	0	0	0	6782.3	0	22716	0	0	0	0	0	0	0	0	0	0	0	37904	0	0
A0A699PQX4	A0A699PQX4_TANCI	Uncharacterized protein	Tci_821734	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SPKKYLS	tr|A0A699PQX4|A0A699PQX4_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_821734 PE=4 SV=1	0.7691	1.378	0	0	3688.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3688.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699PRS2	A0A699PRS2_TANCI	Uncharacterized protein (Fragment)	Tci_823053	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NHSEIKK	tr|A0A699PRS2|A0A699PRS2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_823053 PE=4 SV=1	0.7788	1.378	0	0	0	0	10261	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10261	0	0	0	0	0	0
A0A699PTT1	A0A699PTT1_TANCI	Uncharacterized protein (Fragment)	Tci_818324	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					YAKIPPK	tr|A0A699PTT1|A0A699PTT1_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_818324 PE=4 SV=1	0.90886	1.378	43067	0	38646	82138	53796	0	0	0	0	0	43067	0	0	0	0	0	0	0	0	0	0	0	0	17296	0	0	0	0	0	0	0	38646	0	0	0	0	0	0	0	82138	41767	0	0	53796	0	0	0	0	0	0
A0A699PU05	A0A699PU05_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_816166	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	LKENTLL	tr|A0A699PU05|A0A699PU05_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_816166 PE=4 SV=1	0.90844	1.378	0	0	0	201910	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	201910	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699PUE4	A0A699PUE4_TANCI	Uncharacterized protein (Fragment)	Tci_816467	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GGVSSST	tr|A0A699PUE4|A0A699PUE4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_816467 PE=4 SV=1	0.7779	1.378	4219.6	0	0	9149.7	0	0	0	0	0	0	4219.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9149.7	0	0	0	0	0	0	0	0	0
A0A699PUP8	A0A699PUP8_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment)	Tci_827463	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	PTLEYFK	tr|A0A699PUP8|A0A699PUP8_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_827463 PE=4 SV=1	0.77746	1.378	15609	15978	16687	0	28451	0	0	0	0	0	0	0	0	15609	0	0	0	13279	11217	0	0	15978	0	0	0	0	0	0	0	13154	11778	16687	0	0	0	0	0	0	0	0	0	0	0	0	0	19767	21600	16647	0	28451
A0A699PUU7	A0A699PUU7_TANCI	Uncharacterized protein (Fragment)	Tci_823332	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GFDETER	tr|A0A699PUU7|A0A699PUU7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_823332 PE=4 SV=1	0.77702	1.378	21557	0	29926	19437	0	0	0	0	0	0	21557	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29926	0	0	0	0	0	0	0	19437	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699PUY7	A0A699PUY7_TANCI	Hybrid signal transduction histidine kinase M (Fragment)	Tci_822441	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			kinase activity [GO:0016301]	kinase activity [GO:0016301]	VEAIPPM	tr|A0A699PUY7|A0A699PUY7_TANCI Hybrid signal transduction histidine kinase M (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_822441 PE=4 SV=1	0.87974	1.378	0	27466	43653	16556	42513	0	0	0	0	0	0	0	0	0	0	0	27466	0	0	0	23081	0	0	16830	0	0	43653	0	0	0	0	0	0	0	14028	0	16556	0	0	0	0	42513	32171	0	0	0	0	0	0	0
A0A699PW48	A0A699PW48_TANCI	Pentatricopeptide repeat-containing protein (Fragment)	Tci_822671	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GCPKVPK	tr|A0A699PW48|A0A699PW48_TANCI Pentatricopeptide repeat-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_822671 PE=4 SV=1	0.87883	1.378	0	0	0	19322	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19322	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699PWB1	A0A699PWB1_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_828709	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	GFATHNK	"tr|A0A699PWB1|A0A699PWB1_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_828709 PE=4 SV=1;tr|A0A699MJV7|A0A699MJV7_TANCI Putative zinc finger, CCHC-type, retrotransposon Gag domain pro"	0.84722	2.0678	16451	0	0	0	0	0	0	0	0	0	16451	0	0	7126.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699PXY6	A0A699PXY6_TANCI	Uncharacterized protein	Tci_824174	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ELNAYEA	tr|A0A699PXY6|A0A699PXY6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_824174 PE=4 SV=1	0.77613	1.378	26493	0	0	0	76112	0	0	0	0	0	0	26493	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	76112	0	0	0	0	0	0	0	13727
A0A699Q0C7	A0A699Q0C7_TANCI	Uncharacterized protein	Tci_829706	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DYGCANC	tr|A0A699Q0C7|A0A699Q0C7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_829706 PE=4 SV=1	0.77436	1.378	13827	14949	14409	14468	1323.9	0	0	13827	0	0	0	0	0	0	0	0	14949	0	0	0	0	0	0	0	9648.9	0	0	0	0	0	0	14409	0	0	0	0	0	0	0	0	14468	0	0	0	0	0	0	0	0	1323.9
A0A699Q1F6	A0A699Q1F6_TANCI	(S)-ureidoglycine aminohydrolase (Fragment)	Tci_824359	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	purine nucleobase metabolic process [GO:0006144]		ureidoglycine aminohydrolase activity [GO:0071522]; purine nucleobase metabolic process [GO:0006144]	ureidoglycine aminohydrolase activity [GO:0071522]	LLVHVRR	tr|A0A699Q1F6|A0A699Q1F6_TANCI (S)-ureidoglycine aminohydrolase (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_824359 PE=4 SV=1	0.87175	1.378	0	0	0	25152	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25152	0	0	0	0	0	0	0	0	0	0
A0A699Q1J4	A0A699Q1J4_TANCI	Uncharacterized protein (Fragment)	Tci_827559	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NSTSDGT	tr|A0A699Q1J4|A0A699Q1J4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_827559 PE=4 SV=1	0.76954	1.378	0	8748.7	0	3653.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8748.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3653.6	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699Q1M9	A0A699Q1M9_TANCI	Uncharacterized protein (Fragment)	Tci_829607	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DNGDDNT	tr|A0A699Q1M9|A0A699Q1M9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_829607 PE=4 SV=1	0.77392	1.378	4047	7173.8	3119	6760	0	4047	0	0	0	0	0	0	0	0	0	0	0	0	7173.8	0	0	0	0	3119	0	0	0	0	0	0	0	0	0	0	0	6760	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699Q212	A0A699Q212_TANCI	Uncharacterized protein (Fragment)	Tci_824876	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RLAIPVR	tr|A0A699Q212|A0A699Q212_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_824876 PE=4 SV=1	0.87045	1.378	0	0	0	0	19133	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19133
A0A699Q280	A0A699Q280_TANCI	Uncharacterized protein (Fragment)	Tci_833195	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VLLKSSK	tr|A0A699Q280|A0A699Q280_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_833195 PE=4 SV=1;tr|A0A2U1KL94|A0A2U1KL94_ARTAN ATPase_AAA_core domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA589340 PE=4 SV=	0.88293	1.378	0	9059.8	17902	7777	0	0	0	0	0	0	0	0	0	0	0	4573.5	0	0	0	9059.8	4262	0	0	992.55	0	4019.4	17902	0	4369.7	0	0	0	0	0	7777	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699Q2R9	A0A699Q2R9_TANCI	Retrotrans_gag domain-containing protein	Tci_829397	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TKKIFER	tr|A0A699Q2R9|A0A699Q2R9_TANCI Retrotrans_gag domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_829397 PE=4 SV=1	0.87002	1.378	0	91087	31383	133950	0	0	0	0	0	0	0	0	0	0	75661	91087	0	0	0	0	0	0	0	0	20593	31383	0	0	0	0	0	0	0	0	0	0	0	0	95783	112290	133950	0	0	0	0	0	0	0	0	0
A0A699Q483	A0A699Q483_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_827702	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	SDGYSCK	tr|A0A699Q483|A0A699Q483_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_827702 PE=4 SV=1	0.77348	1.378	14173	21275	0	0	0	0	0	0	0	0	0	0	14173	4282.4	21275	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699Q6P1	A0A699Q6P1_TANCI	Uncharacterized protein (Fragment)	Tci_828322	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	ADPDANV	tr|A0A699Q6P1|A0A699Q6P1_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_828322 PE=4 SV=1	0.77216	1.378	7062.2	13295	0	0	0	0	0	0	5913.3	7062.2	0	0	0	0	0	0	13295	12008	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699Q6Q0	A0A699Q6Q0_TANCI	Uncharacterized protein (Fragment)	Tci_831663	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TAVAYYK	tr|A0A699Q6Q0|A0A699Q6Q0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_831663 PE=4 SV=1;tr|A0A699NSF6|A0A699NSF6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_796669 PE=4 SV=	0.82825	1.378	0	8571.4	0	10213	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8571.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10213	0	0	0	0	0	0	0	0	0
A0A699QCM5	A0A699QCM5_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_833014	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	VIFKFLK	tr|A0A699QCM5|A0A699QCM5_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_833014 PE=4 SV=1	0.77128	1.378	0	0	0	1337.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1337.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QCR8	A0A699QCR8_TANCI	Uncharacterized protein (Fragment)	Tci_838693	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DSDDDDE	tr|A0A699QCR8|A0A699QCR8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_838693 PE=4 SV=1	0.89035	1.378	4300	0	0	0	0	0	0	0	0	0	0	4300	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QCX3	A0A699QCX3_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_835216	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	DSEFDIK	tr|A0A699QCX3|A0A699QCX3_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_835216 PE=4 SV=1	0.77085	1.378	0	0	0	52838	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	52838	0	0	0	0	0	0	0	0	0	0
A0A699QD47	A0A699QD47_TANCI	Uncharacterized protein (Fragment)	Tci_837636	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PLDGDTG	tr|A0A699QD47|A0A699QD47_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_837636 PE=4 SV=1	0.76997	1.378	59032	84526	12490	17888	26116	22081	0	0	0	44091	0	49538	59032	23511	0	0	0	0	84526	0	0	0	59229	0	12490	0	0	0	0	0	0	5390.3	17888	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26116	0	0
A0A699QES8	A0A699QES8_TANCI	Uncharacterized protein (Fragment)	Tci_838753	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SSLSEGS	tr|A0A699QES8|A0A699QES8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_838753 PE=4 SV=1	0.80414	1.378	0	3584.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3584.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QG24	A0A699QG24_TANCI	Uncharacterized protein (Fragment)	Tci_836782	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PTCNNED	tr|A0A699QG24|A0A699QG24_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_836782 PE=4 SV=1	0.88551	1.378	12146	0	9405.5	0	0	0	0	0	12146	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9405.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QJ58	A0A699QJ58_TANCI	Uncharacterized protein (Fragment)	Tci_845494	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VPSSSGK	tr|A0A699QJ58|A0A699QJ58_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_845494 PE=4 SV=1	0.80462	1.378	9141.5	80290	58022	74453	75821	9141.5	5825.5	5203.3	0	0	0	0	0	0	13324	21404	76555	0	0	80290	72156	0	0	17472	0	53474	58022	0	55352	0	18410	0	0	0	0	0	70014	68572	74453	58571	0	75335	73563	0	0	25888	75821	0	0	0
A0A699QJX3	A0A699QJX3_TANCI	Uncharacterized protein (Fragment)	Tci_843211	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NLLPIPS	tr|A0A699QJX3|A0A699QJX3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_843211 PE=4 SV=1	0.84358	1.378	0	0	2376	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2376	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QKE6	A0A699QKE6_TANCI	Uncharacterized protein	Tci_846358	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TESSEEK	tr|A0A699QKE6|A0A699QKE6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_846358 PE=4 SV=1;tr|A0A6L2MKL3|A0A6L2MKL3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_046461 PE=4 SV=1;tr|A0A6L2K6U9|A0A6L2	0.90479	1.378	0	0	0	29458	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29458	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QKR6	A0A699QKR6_TANCI	Uncharacterized protein (Fragment)	Tci_844470	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					AMHDDIC	tr|A0A699QKR6|A0A699QKR6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_844470 PE=4 SV=1	0.84305	1.378	0	8904	5772.3	0	8742.2	0	0	0	0	0	0	0	0	0	0	0	8904	0	0	0	0	0	0	0	0	5772.3	3697.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8742.2	0	0	0	0	0	0	0
A0A699QL26	A0A699QL26_TANCI	Uncharacterized protein (Fragment)	Tci_843218	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PSKDCAR	tr|A0A699QL26|A0A699QL26_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_843218 PE=4 SV=1	0.84253	1.378	0	6586.1	1854.4	10351	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6586.1	0	0	0	1854.4	0	0	0	0	0	0	0	0	0	0	10351	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QL35	A0A699QL35_TANCI	Ubiquitin hydrolase (Fragment)	Tci_843235	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			hydrolase activity [GO:0016787]; nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	hydrolase activity [GO:0016787]; nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	PADNMNK	tr|A0A699QL35|A0A699QL35_TANCI Ubiquitin hydrolase (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_843235 PE=4 SV=1	0.88623	1.378	0	0	11541	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11541	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QL66	A0A699QL66_TANCI	Uncharacterized protein (Fragment)	Tci_839327	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NYSGSNN	tr|A0A699QL66|A0A699QL66_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_839327 PE=4 SV=1	0.84201	1.378	0	0	0	0	4834.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4834.8	0
A0A699QLA5	A0A699QLA5_TANCI	Uncharacterized protein (Fragment)	Tci_843402	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GGSETDE	tr|A0A699QLA5|A0A699QLA5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_843402 PE=4 SV=1	0.8858	1.378	0	0	8147	5417.6	5023.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8147	0	0	0	0	0	0	0	0	5417.6	0	3493.4	0	0	0	0	0	0	0	5023.7	0	0	0	0	0
A0A699QLN0	A0A699QLN0_TANCI	Uncharacterized protein (Fragment)	Tci_847284	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QVLNDTR	tr|A0A699QLN0|A0A699QLN0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_847284 PE=4 SV=1	0.84149	1.378	0	12677	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12677	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QLV5	A0A699QLV5_TANCI	Transducin/WD40 repeat-like superfamily protein (Fragment)	Tci_841993	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VEEVDDD	tr|A0A699QLV5|A0A699QLV5_TANCI Transducin/WD40 repeat-like superfamily protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_841993 PE=4 SV=1	0.88951	1.378	0	0	9948.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9948.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QNP7	A0A699QNP7_TANCI	Uncharacterized protein (Fragment)	Tci_841127	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GFSPMPR	tr|A0A699QNP7|A0A699QNP7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_841127 PE=4 SV=1	0.88119	1.378	315510	128240	66012	212910	60059	0	203670	0	183580	0	154400	315510	0	103990	0	0	0	66345	0	0	0	0	128240	0	66012	0	0	0	0	0	0	0	120800	212910	212280	0	0	0	0	0	0	0	0	0	0	55965	0	0	0	60059
A0A699QNY8	A0A699QNY8_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_846699	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	PNLIKQI	tr|A0A699QNY8|A0A699QNY8_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_846699 PE=4 SV=1	0.88205	1.378	21765	0	26116	0	0	0	21765	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26116	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QP44	A0A699QP44_TANCI	Uncharacterized protein (Fragment)	Tci_845689	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HGGREQK	tr|A0A699QP44|A0A699QP44_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_845689 PE=4 SV=1	0.88248	1.378	17964	12149	6678.4	10181	9103.1	0	0	0	0	0	17964	0	0	0	0	0	0	0	0	12149	10431	0	0	0	0	6678.4	0	0	0	0	0	0	0	0	0	0	0	9012.7	0	10181	0	8123.5	0	0	0	0	9103.1	0	0	0
A0A699QPE0	A0A699QPE0_TANCI	Putative RNA-directed DNA polymerase	Tci_841642	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	MAPPRQR	tr|A0A699QPE0|A0A699QPE0_TANCI Putative RNA-directed DNA polymerase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_841642 PE=4 SV=1	0.88296	1.378	3908100	3240500	2747700	12616	3407000	11495	9225	11639	0	0	0	3393500	3908100	3333400	0	0	0	0	0	0	3240500	0	0	6880.3	0	0	2747700	0	0	2481300	0	15746	0	0	0	0	12616	0	0	0	0	0	0	3407000	0	9780.4	0	0	11331	0
A0A699QPL0	A0A699QPL0_TANCI	Uncharacterized protein (Fragment)	Tci_845792	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	bacillithiol biosynthetic process [GO:0071793]		deacetylase activity [GO:0019213]; bacillithiol biosynthetic process [GO:0071793]	deacetylase activity [GO:0019213]	NADPTAP	tr|A0A699QPL0|A0A699QPL0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_845792 PE=4 SV=1	0.84045	1.378	0	9149.1	0	0	0	0	0	0	0	0	0	0	0	0	5822.4	0	9149.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QPT9	A0A699QPT9_TANCI	Uncharacterized protein (Fragment)	Tci_845422	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PNLYDGS	tr|A0A699QPT9|A0A699QPT9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_845422 PE=4 SV=1	0.83993	1.378	0	0	10763	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10763	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QPU7	A0A699QPU7_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_845995	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HSKTAFR	tr|A0A699QPU7|A0A699QPU7_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_845995 PE=4 SV=1;tr|A0A699LUT0|A0A699LUT0_TANCI RT_RNaseH_2 domain-containing protein (Fragment) OS=Tanacetum cinerariif	0.94506	1.378	0	0	5322.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5322.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QR48	A0A699QR48_TANCI	Uncharacterized protein (Fragment)	Tci_840628	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DVLIPSP	tr|A0A699QR48|A0A699QR48_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_840628 PE=4 SV=1;tr|A0A699UGI9|A0A699UGI9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_892435 PE=4 SV=	0.90494	1.378	49901	53161	49628	32419	35166	26400	0	24886	0	49901	0	0	0	0	35650	0	0	52611	0	0	0	53161	29150	28861	0	0	0	0	0	49628	26286	0	32419	23592	0	31439	0	0	0	0	0	0	0	24766	0	19863	0	0	35166	0
A0A699QR71	A0A699QR71_TANCI	Uncharacterized protein (Fragment)	Tci_843042	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TTTGCGT	tr|A0A699QR71|A0A699QR71_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_843042 PE=4 SV=1	0.89798	1.378	0	11320	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11320	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QRK3	A0A699QRK3_TANCI	Uncharacterized protein	Tci_847915	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					YGLHGSN	tr|A0A699QRK3|A0A699QRK3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_847915 PE=4 SV=1	0.83941	1.378	0	146210	94712	151990	11238	0	0	0	0	0	0	0	0	0	0	0	146210	0	0	0	0	0	0	94712	0	0	0	0	0	0	0	0	0	0	0	0	0	151990	0	0	0	0	0	0	0	0	0	0	11238	0
A0A699QS72	A0A699QS72_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_848416	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	MDHLGCA	tr|A0A699QS72|A0A699QS72_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_848416 PE=4 SV=1	0.83889	1.378	0	0	8108	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8108	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QT23	A0A699QT23_TANCI	Uncharacterized protein (Fragment)	Tci_848387	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GGAPCCR	tr|A0A699QT23|A0A699QT23_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_848387 PE=4 SV=1	0.89387	1.378	207020	0	17754	28289	31940	0	0	26515	42367	207020	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17754	12457	24995	0	0	28289	0	0	0	0	0	0	0	0	0	31940	15274	0	0	0
A0A699QT65	A0A699QT65_TANCI	"Pyruvate, phosphate dikinase regulatory protein, chloroplastic (Fragment)"	Tci_844753	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LLLRKYK	"tr|A0A699QT65|A0A699QT65_TANCI Pyruvate, phosphate dikinase regulatory protein, chloroplastic (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_844753 PE=4 SV=1"	0.89434	1.378	31047	19378	11102	25326	29209	31047	0	0	0	0	0	0	26617	0	0	0	0	19378	0	0	0	14612	0	0	0	0	0	0	0	0	11102	0	25326	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29209
A0A699QVZ2	A0A699QVZ2_TANCI	Uncharacterized protein (Fragment)	Tci_846599	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EEESEGD	tr|A0A699QVZ2|A0A699QVZ2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_846599 PE=4 SV=1	0.82774	1.378	24300	0	22930	24065	26088	0	0	0	0	0	24300	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13149	22930	0	0	0	0	0	0	0	20318	0	0	22851	23570	24065	0	26088	0	0	0	0	0	0	0	0
A0A699QW18	A0A699QW18_TANCI	Uncharacterized protein (Fragment)	Tci_845769	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					AGGHEDG	tr|A0A699QW18|A0A699QW18_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_845769 PE=4 SV=1	0.83785	1.378	13500	10407	8316.6	10208	10855	0	0	0	8877.7	0	13500	4668.3	0	0	0	0	0	0	10407	0	0	0	8785.5	0	0	0	0	0	0	8316.6	0	0	9049.1	0	10208	8009	0	0	0	0	0	0	0	10855	0	0	0	3305.3	0	0
A0A699QWH4	A0A699QWH4_TANCI	Uncharacterized protein (Fragment)	Tci_846059	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DDSTPPN	tr|A0A699QWH4|A0A699QWH4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_846059 PE=4 SV=1	0.84053	1.378	0	0	0	37757	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37757	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QWJ1	A0A699QWJ1_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_850283	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	VESLCAS	tr|A0A699QWJ1|A0A699QWJ1_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_850283 PE=4 SV=1	0.83734	1.378	0	0	0	0	112850	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	112850	0	0	0	0	0	0	0
A0A699QXN5	A0A699QXN5_TANCI	Uncharacterized protein (Fragment)	Tci_850018	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SDRGSNR	tr|A0A699QXN5|A0A699QXN5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_850018 PE=4 SV=1	0.83682	1.378	0	0	0	0	9222.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9222.3	0	0	0	0	0	0
A0A699QXT8	A0A699QXT8_TANCI	Uncharacterized protein (Fragment)	Tci_846034	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DDESEDG	tr|A0A699QXT8|A0A699QXT8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_846034 PE=4 SV=1;tr|A0A6L2JZ93|A0A6L2JZ93_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_013845 PE=4 SV=1	0.83631	1.378	10015	20110	9750.4	16562	13037	8894.3	10015	0	0	0	0	0	0	0	20110	0	15713	0	0	11757	19592	0	0	0	0	0	0	0	9750.4	0	0	0	0	0	0	15667	7517.9	0	0	0	16562	13037	12834	0	0	0	0	3395.2	0	0
A0A699QXX7	A0A699QXX7_TANCI	Uncharacterized protein (Fragment)	Tci_852019	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DGQEDDL	tr|A0A699QXX7|A0A699QXX7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_852019 PE=4 SV=1	0.83579	1.378	0	12713	0	10941	0	0	0	0	0	0	0	0	0	0	0	12713	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10941	0	0	0	0	0	0	0	0	0
A0A699QY02	A0A699QY02_TANCI	Uncharacterized protein (Fragment)	Tci_849527	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DDDDDRD	tr|A0A699QY02|A0A699QY02_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_849527 PE=4 SV=1	0.81802	1.378	12359	0	0	0	0	0	0	0	0	0	0	12359	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QZM6	A0A699QZM6_TANCI	Uncharacterized protein (Fragment)	Tci_852559	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DEALFED	tr|A0A699QZM6|A0A699QZM6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_852559 PE=4 SV=1	0.82603	1.378	0	19792	13148	11690	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19792	0	0	0	0	0	0	0	0	0	0	13148	0	0	0	0	0	11690	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699QZT3	A0A699QZT3_TANCI	"Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic (Fragment)"	Tci_851350	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LIIVVLS	"tr|A0A699QZT3|A0A699QZT3_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_851350 PE=4 SV=1"	0.82575	1.378	21795	168000	65496	29227	26106	0	21795	0	0	0	0	0	0	0	0	0	0	168000	0	0	0	0	0	25744	0	0	0	0	0	65496	15587	19135	23549	24457	0	29227	0	0	0	0	22199	0	0	0	0	0	0	22758	26106	0
A0A699R0N4	A0A699R0N4_TANCI	Uncharacterized protein (Fragment)	Tci_849352	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MFGWCCR	tr|A0A699R0N4|A0A699R0N4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_849352 PE=4 SV=1	0.83528	1.378	0	0	16714	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16714	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699R0R2	A0A699R0R2_TANCI	"Zinc finger, CCHC-type, retrotransposon Gag domain protein (Fragment)"	Tci_848222	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VGADDDR	"tr|A0A699R0R2|A0A699R0R2_TANCI Zinc finger, CCHC-type, retrotransposon Gag domain protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_848222 PE=4 SV=1"	0.86015	1.378	0	22092	20736	28887	12573	0	0	0	0	0	0	0	0	0	13300	17797	0	0	0	0	22092	0	0	0	0	0	0	0	20736	0	0	0	0	0	0	0	0	0	28887	0	0	0	0	0	0	0	12573	0	0	0
A0A699R0Y3	A0A699R0Y3_TANCI	Uncharacterized protein (Fragment)	Tci_853009	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MMMSQHR	tr|A0A699R0Y3|A0A699R0Y3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_853009 PE=4 SV=1	0.86059	1.378	0	260910	133810	0	0	0	0	0	0	0	0	0	0	0	0	174450	0	0	0	260910	0	0	0	0	0	133810	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699R270	A0A699R270_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_849922	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	GPLALIP	tr|A0A699R270|A0A699R270_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_849922 PE=4 SV=1	0.86777	1.378	0	21506	19917	26575	25680	0	0	0	0	0	0	0	0	0	0	0	21506	0	0	0	20809	0	0	18480	0	19917	0	0	0	0	0	0	0	0	0	0	26484	19677	19265	26575	0	25680	0	0	0	0	0	0	0	0
A0A699R401	A0A699R401_TANCI	Uncharacterized protein (Fragment)	Tci_849631	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GGTADDD	tr|A0A699R401|A0A699R401_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_849631 PE=4 SV=1	0.83477	1.378	34701	35150	20102	57123	0	0	26030	34701	0	0	0	0	0	0	35150	0	6893.7	0	0	0	0	0	0	0	0	0	0	0	0	0	20102	0	0	56215	0	51284	31560	0	0	57123	0	0	0	0	0	0	0	0	0	0
A0A699R4L3	A0A699R4L3_TANCI	Uncharacterized protein (Fragment)	Tci_852743	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					IKTKLTT	tr|A0A699R4L3|A0A699R4L3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_852743 PE=4 SV=1	0.83425	1.378	6887.7	22930	0	0	9875.3	0	0	0	6887.7	0	0	0	0	0	0	0	0	0	20675	0	0	20373	22930	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9875.3	0	0	0	0	0	0
A0A699R9F3	A0A699R9F3_TANCI	Uncharacterized protein (Fragment)	Tci_854375	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KKSVLLR	tr|A0A699R9F3|A0A699R9F3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_854375 PE=4 SV=1;tr|A0A6L2N1P2|A0A6L2N1P2_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=1185	0.83323	1.378	8991.9	0	0	0	5371.4	0	0	0	0	0	0	0	8991.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5371.4	0	0	0	0
A0A699RBE5	A0A699RBE5_TANCI	Uncharacterized protein (Fragment)	Tci_856479	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HYFPKAH	tr|A0A699RBE5|A0A699RBE5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_856479 PE=4 SV=1	0.83272	1.378	0	13332	9135.8	8466.9	10449	0	0	0	0	0	0	0	0	0	0	9158.3	0	0	0	13332	0	0	0	0	0	5917	0	0	9135.8	0	0	0	0	0	0	0	0	8466.9	0	0	0	10449	9780	0	6929.3	0	6799.1	0	0	0
A0A699RBM1	A0A699RBM1_TANCI	Uncharacterized protein	Tci_855830	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GPGGSPG	tr|A0A699RBM1|A0A699RBM1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_855830 PE=4 SV=1	0.83221	1.378	0	12166	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12166	0	0	5936.9	9101.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699RBS6	A0A699RBS6_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_854798	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	MGCQLLR	tr|A0A699RBS6|A0A699RBS6_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_854798 PE=4 SV=1	0.845	1.378	0	0	0	0	372220	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	372220	0	0	87403	0	105630	0	0	0
A0A699RBT1	A0A699RBT1_TANCI	PG_binding_3 domain-containing protein (Fragment)	Tci_855910	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	chitin catabolic process [GO:0006032]		chitin catabolic process [GO:0006032]		KTSGASS	tr|A0A699RBT1|A0A699RBT1_TANCI PG_binding_3 domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_855910 PE=4 SV=1	0.84462	1.378	0	0	0	9143.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9143.7	0	0	0	0	0	0	0	0	0	0	0
A0A699RBW4	A0A699RBW4_TANCI	Retrotransposon-related protein	Tci_852001	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					AMHKFLM	tr|A0A699RBW4|A0A699RBW4_TANCI Retrotransposon-related protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_852001 PE=4 SV=1	0.84683	1.378	0	0	127870	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	127870	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699RF42	A0A699RF42_TANCI	Uncharacterized protein (Fragment)	Tci_856316	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DNEEEEE	tr|A0A699RF42|A0A699RF42_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_856316 PE=4 SV=1	0.90306	1.378	30581	30332	0	0	0	0	0	0	0	0	0	30581	0	22514	0	0	0	0	30332	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699RF63	A0A699RF63_TANCI	Dehydrodolichyl diphosphate synthase 2 (Fragment)	Tci_857899	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			"transferase activity, transferring alkyl or aryl (other than methyl) groups [GO:0016765]"	"transferase activity, transferring alkyl or aryl (other than methyl) groups [GO:0016765]"	SPPARGR	tr|A0A699RF63|A0A699RF63_TANCI Dehydrodolichyl diphosphate synthase 2 (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_857899 PE=4 SV=1	0.84515	1.378	0	55263	37655	34226	23237	0	0	0	0	0	0	0	0	0	0	0	0	55263	32604	0	0	22540	20668	0	0	0	0	0	0	0	31019	37655	0	24660	0	0	32868	0	0	0	34226	0	0	23237	0	23124	0	0	0	0
A0A699RF79	A0A699RF79_TANCI	CCHC-type domain-containing protein	Tci_856595	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	GAGHMAK	tr|A0A699RF79|A0A699RF79_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_856595 PE=4 SV=1	0.85204	1.378	0	0	5619.6	4530	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5619.6	0	0	0	0	0	0	0	4530	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699RFU6	A0A699RFU6_TANCI	Uncharacterized protein (Fragment)	Tci_854852	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NSTDQTN	tr|A0A699RFU6|A0A699RFU6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_854852 PE=4 SV=1	0.93361	1.378	0	69145	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	69145	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699RI44	A0A699RI44_TANCI	Uncharacterized protein (Fragment)	Tci_855602	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DGGGCCR	tr|A0A699RI44|A0A699RI44_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_855602 PE=4 SV=1	0.85633	1.378	0	0	5023.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5023.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699RIG7	A0A699RIG7_TANCI	Uncharacterized protein (Fragment)	Tci_857523	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PKIPAAK	tr|A0A699RIG7|A0A699RIG7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_857523 PE=4 SV=1;tr|A0A6L2P5F7|A0A6L2P5F7_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein OS=Tanacetum cinerariifolium OX=1	0.85579	1.378	7452.2	7818	3861.4	10844	15207	0	0	5794.2	0	0	0	0	7452.2	0	5065.9	0	7818	0	0	0	0	0	0	3861.4	0	0	0	0	0	0	0	0	0	0	0	0	8484.3	10844	9270.9	0	0	15207	0	0	0	0	3504.3	0	0	0
A0A699RJN9	A0A699RJN9_TANCI	Uncharacterized protein (Fragment)	Tci_854811	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PDMIVVK	tr|A0A699RJN9|A0A699RJN9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_854811 PE=4 SV=1	0.93711	1.378	0	0	0	9670.2	4911.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9670.2	0	0	0	0	0	0	0	4911.2	0	0	0
A0A699RKA7	A0A699RKA7_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_855011	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	KLVREDMIEVQEEVFQK	tr|A0A699RKA7|A0A699RKA7_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_855011 PE=4 SV=1	0.89071	1.378	0	0	0	0	12452	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12452	0	0	0
A0A699RKH1	A0A699RKH1_TANCI	Uncharacterized protein	Tci_858233	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DSPPAGM	tr|A0A699RKH1|A0A699RKH1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_858233 PE=4 SV=1	0.94374	1.378	0	0	12046	5428.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12046	0	0	0	4137.5	0	0	0	0	0	0	0	5428.7	0	0	0	0	0	0	0	0	0
A0A699RL80	A0A699RL80_TANCI	Uncharacterized protein (Fragment)	Tci_860149	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VKMAFKV	tr|A0A699RL80|A0A699RL80_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_860149 PE=4 SV=1	0.89744	1.378	0	0	8297.8	0	11290	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8297.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11290	0	0	0	0
A0A699RLL8	A0A699RLL8_TANCI	Uncharacterized protein (Fragment)	Tci_860309	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GFTATAY	tr|A0A699RLL8|A0A699RLL8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_860309 PE=4 SV=1	0.85525	1.378	8604.2	19830	18133	53446	0	0	0	0	0	0	0	0	8604.2	0	0	0	0	19830	0	0	0	18213	0	0	10433	0	0	0	0	17755	18133	0	0	0	0	20432	0	0	0	53446	0	0	0	0	0	0	0	0	0	0
A0A699RM79	A0A699RM79_TANCI	Uncharacterized protein (Fragment)	Tci_860529	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LVAAIPP	tr|A0A699RM79|A0A699RM79_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_860529 PE=4 SV=1	0.85418	1.378	50103	55726	37681	28495	30718	50103	29983	34330	0	0	0	0	37480	0	0	17212	41073	21387	0	2932.8	22794	19067	55726	17570	37681	0	3177.4	0	22761	0	0	0	0	0	0	0	20785	28495	0	23562	0	20857	0	0	0	30718	0	0	18799	0
A0A699RMC1	A0A699RMC1_TANCI	Ribonuclease H-like domain-containing protein (Fragment)	Tci_859560	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	KLLQNLP	tr|A0A699RMC1|A0A699RMC1_TANCI Ribonuclease H-like domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_859560 PE=4 SV=1	0.85364	1.378	28790	31915	0	26982	21688	0	15162	28790	0	0	0	0	0	0	21414	17721	0	0	31915	0	0	17284	0	0	0	0	0	0	0	0	0	0	0	18067	0	26982	0	0	0	0	0	21688	0	0	0	16349	0	19618	17419	0
A0A699RMI1	A0A699RMI1_TANCI	Putative reverse transcriptase domain-containing protein	Tci_855791	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	RPFKILK	tr|A0A699RMI1|A0A699RMI1_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_855791 PE=4 SV=1	0.85311	1.378	0	10440	4853	3506.1	4651	0	0	0	0	0	0	0	0	0	0	0	0	3921.4	0	0	0	0	10440	0	0	0	0	0	0	4853	0	0	3506.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4651	0	0
A0A699RP20	A0A699RP20_TANCI	Uncharacterized protein (Fragment)	Tci_859503	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QGPGGNS	tr|A0A699RP20|A0A699RP20_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_859503 PE=4 SV=1	0.85257	1.378	3684.1	15188	0	7828.7	12368	0	3684.1	0	2365.2	0	0	2430.6	0	0	3045.6	11623	0	0	0	0	0	0	15188	0	0	0	0	0	0	0	0	0	0	0	7828.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12368
A0A699RPL4	A0A699RPL4_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_859753	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	TTKPRVR	tr|A0A699RPL4|A0A699RPL4_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_859753 PE=4 SV=1	0.89637	1.378	0	0	31155	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31155	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699RPT9	A0A699RPT9_TANCI	Uncharacterized protein (Fragment)	Tci_858022	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LPAAVVT	tr|A0A699RPT9|A0A699RPT9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_858022 PE=4 SV=1	0.93968	1.378	10175	10626	11306	11888	8405.8	10175	7989.7	0	0	0	0	0	0	0	0	0	10626	0	0	0	0	0	0	0	5956.4	0	0	0	0	0	0	11306	0	0	0	11888	0	0	0	0	0	0	0	0	0	0	0	8405.8	0	0
A0A699RPZ3	A0A699RPZ3_TANCI	Uncharacterized protein (Fragment)	Tci_860085	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					WVDMGGG	tr|A0A699RPZ3|A0A699RPZ3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_860085 PE=4 SV=1	0.9367	1.378	0	14186	8415.1	16259	53176	0	0	0	0	0	0	0	0	0	0	14186	0	0	0	0	0	0	0	8415.1	0	0	0	0	0	0	0	0	0	0	0	0	16259	0	11673	0	0	0	53176	0	0	0	0	0	16313	0
A0A699RPZ9	A0A699RPZ9_TANCI	Uncharacterized protein (Fragment)	Tci_859177	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NRSGMMK	tr|A0A699RPZ9|A0A699RPZ9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_859177 PE=4 SV=1	0.89474	1.378	0	0	0	0	6819.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6819.6	0	0	0	0	0	0
A0A699RRN3	A0A699RRN3_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_859608	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	GRYNCGC	tr|A0A699RRN3|A0A699RRN3_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_859608 PE=4 SV=1	0.8515	1.378	0	0	0	25695	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25695	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699RRU3	A0A699RRU3_TANCI	"Zinc finger, CCHC-type, retrotransposon Gag domain protein (Fragment)"	Tci_861310	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DSNPSAI	"tr|A0A699RRU3|A0A699RRU3_TANCI Zinc finger, CCHC-type, retrotransposon Gag domain protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_861310 PE=4 SV=1"	0.90278	1.378	172030	151990	122320	86286	102540	0	0	37904	0	0	0	172030	0	0	0	0	0	0	151990	0	0	0	51707	0	0	0	122320	0	0	0	0	0	0	29701	0	29316	86286	0	81635	0	0	0	0	0	8285.5	9154.7	0	0	102540	37941
A0A699RS89	A0A699RS89_TANCI	Uncharacterized protein (Fragment)	Tci_859847	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PPIKYAE	tr|A0A699RS89|A0A699RS89_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_859847 PE=4 SV=1	0.84568	1.378	0	0	0	0	12693	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4933.3	0	0	12693	0
A0A699RSL7	A0A699RSL7_TANCI	Uncharacterized protein (Fragment)	Tci_861115	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TDDDDVM	tr|A0A699RSL7|A0A699RSL7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_861115 PE=4 SV=1;tr|A0A699N0Z1|A0A699N0Z1_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_760970 PE=4 SV	0.85809	1.378	20034	31362	13544	16066	7417.5	0	10319	0	12755	20034	0	0	0	7485.1	0	0	0	0	31362	0	0	10399	12924	0	0	0	0	0	0	13544	10952	0	16066	8481.8	0	12095	0	0	0	0	0	0	0	5261.6	0	0	0	0	7417.5	0
A0A699RUG5	A0A699RUG5_TANCI	Uncharacterized protein (Fragment)	Tci_859832	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RPRCLCR	tr|A0A699RUG5|A0A699RUG5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_859832 PE=4 SV=1	0.84938	1.378	0	1409.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1409.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699RUU8	A0A699RUU8_TANCI	Uncharacterized protein (Fragment)	Tci_861048	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VQIILLK	tr|A0A699RUU8|A0A699RUU8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_861048 PE=4 SV=1;tr|A0A699PRK4|A0A699PRK4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_825169 PE=4 SV=	0.77924	1.378	0	4047.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4047.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699RW51	A0A699RW51_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_860957	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	KSKILFR	tr|A0A699RW51|A0A699RW51_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_860957 PE=4 SV=1	0.84551	1.378	16610	15585	23066	18727	9786.8	0	0	8507.3	0	0	16610	0	15576	0	15585	0	0	0	0	7064	0	0	0	13275	0	0	19896	0	23066	0	0	0	0	0	0	0	0	18727	18135	0	0	0	0	0	0	0	0	0	9786.8	0
A0A699RWX8	A0A699RWX8_TANCI	Uncharacterized protein (Fragment)	Tci_859751	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VPIRTTK	tr|A0A699RWX8|A0A699RWX8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_859751 PE=4 SV=1	0.82422	1.378	0	7941.9	0	0	0	0	0	0	0	0	0	0	0	0	7941.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699RY18	A0A699RY18_TANCI	Uncharacterized protein (Fragment)	Tci_861882	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	carbohydrate metabolic process [GO:0005975]		carbohydrate metabolic process [GO:0005975]		AAWPKMR	tr|A0A699RY18|A0A699RY18_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_861882 PE=4 SV=1	0.83088	1.378	0	11315	9920.4	0	0	0	0	0	0	0	0	0	0	0	0	11315	0	0	0	0	0	0	0	0	0	9920.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699RYC1	A0A699RYC1_TANCI	"Zinc finger, CCHC-type (Fragment)"	Tci_862447	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		ILNERYK	"tr|A0A699RYC1|A0A699RYC1_TANCI Zinc finger, CCHC-type (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_862447 PE=4 SV=1"	0.84884	1.378	16068	25864	0	34937	27573	7661.9	0	0	0	0	0	0	16068	0	0	0	14630	0	0	0	0	25864	0	0	0	0	0	0	0	0	0	0	0	0	0	34937	22548	0	0	0	0	0	0	0	0	0	0	0	27573	0
A0A699RYR8	A0A699RYR8_TANCI	Putative ribonuclease H-like domain-containing protein (Fragment)	Tci_861511	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					CEACQDK	tr|A0A699RYR8|A0A699RYR8_TANCI Putative ribonuclease H-like domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_861511 PE=4 SV=1	0.88636	1.378	11039	0	0	0	0	0	0	0	0	0	0	0	0	11039	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699RYU6	A0A699RYU6_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_861074	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			aspartic-type endopeptidase activity [GO:0004190]; RNA-directed DNA polymerase activity [GO:0003964]	aspartic-type endopeptidase activity [GO:0004190]; RNA-directed DNA polymerase activity [GO:0003964]	DFHGPDG	tr|A0A699RYU6|A0A699RYU6_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_861074 PE=4 SV=1	0.89177	1.378	99381	161890	0	92340	10811	0	0	0	11845	0	0	0	0	99381	0	0	0	10713	0	0	0	0	161890	0	0	0	0	0	0	0	0	0	6936.4	92340	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10811
A0A699RZV1	A0A699RZV1_TANCI	Uncharacterized protein (Fragment)	Tci_862625	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SAGNESG	tr|A0A699RZV1|A0A699RZV1_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_862625 PE=4 SV=1	0.84831	1.378	25742	34641	0	24567	0	0	0	0	0	0	0	0	0	25742	0	0	0	0	34641	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24567	0	0	0	0	0	0	0	0	0	0	0	0
A0A699S001	A0A699S001_TANCI	Uncharacterized protein (Fragment)	Tci_862679	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SSNTTHA	tr|A0A699S001|A0A699S001_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_862679 PE=4 SV=1	0.84779	1.378	1695500	884200	2123300	0	870610	842780	886740	0	881890	912310	0	1387400	1695500	0	0	0	0	0	0	884200	0	206050	618470	0	0	0	1142400	2123300	381220	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	870610	0
A0A699S005	A0A699S005_TANCI	Ribose-phosphate pyrophosphokinase 4-like	Tci_862637	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			kinase activity [GO:0016301]	kinase activity [GO:0016301]	ILVVFLM	tr|A0A699S005|A0A699S005_TANCI Ribose-phosphate pyrophosphokinase 4-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_862637 PE=4 SV=1	0.88955	1.378	19415	0	15443	16896	0	0	19415	9165.5	0	0	0	0	19234	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15443	0	0	0	16896	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699S0J1	A0A699S0J1_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_862832	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	KCYSDDP	tr|A0A699S0J1|A0A699S0J1_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_862832 PE=4 SV=1;tr|A0A699T4S3|A0A699T4S3_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=T	0.84726	1.378	0	0	0	4074.1	8345.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4074.1	0	0	0	0	0	0	0	0	0	0	0	0	8345.4	0
A0A699S1A2	A0A699S1A2_TANCI	Uncharacterized protein	Tci_863132	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SMMMTMM	tr|A0A699S1A2|A0A699S1A2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_863132 PE=4 SV=1	0.87354	1.378	32656	0	0	22692	28188	32656	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22692	0	0	0	0	0	0	0	0	0	28188	0	0	0	0	0	0
A0A699S1E8	A0A699S1E8_TANCI	Uncharacterized protein	Tci_863204	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GNVVPGM	tr|A0A699S1E8|A0A699S1E8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_863204 PE=4 SV=1	0.88291	1.378	0	0	0	4609.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4609.8	0	0	0	0	0	0	0	0	0	0	0	0
A0A699S1Z6	A0A699S1Z6_TANCI	Uncharacterized protein (Fragment)	Tci_863347	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DDTDDEP	tr|A0A699S1Z6|A0A699S1Z6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_863347 PE=4 SV=1	0.84673	1.378	10811	0	12530	0	0	0	0	0	0	0	10811	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12530	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699S473	A0A699S473_TANCI	"Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic (Fragment)"	Tci_864087	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HSCGSDV	"tr|A0A699S473|A0A699S473_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_864087 PE=4 SV=1;tr|A0A699U7X5|A0A699U7X5_TANCI Integrase, catalytic region, zinc fin"	0.91057	1.378	0	6590.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6590.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699S571	A0A699S571_TANCI	Uncharacterized protein (Fragment)	Tci_864531	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PPAKPSD	tr|A0A699S571|A0A699S571_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_864531 PE=4 SV=1	0.8462	1.378	0	12682	14352	22357	4861.5	0	0	0	0	0	0	0	0	0	12682	0	0	0	0	0	0	0	0	0	10625	0	0	0	14352	0	0	10775	0	0	0	0	0	0	0	22357	0	0	0	0	0	0	4861.5	0	0	0
A0A699S5S3	A0A699S5S3_TANCI	CCHC-type domain-containing protein (Fragment)	Tci_864398	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	TKKLLAK	tr|A0A699S5S3|A0A699S5S3_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_864398 PE=4 SV=1;tr|A0A699U6U5|A0A699U6U5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_889	0.80557	1.378	248200	13566	0	0	0	0	0	0	248200	0	0	0	0	0	0	13566	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699S6F9	A0A699S6F9_TANCI	Uncharacterized protein (Fragment)	Tci_864857	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ESSEFCT	tr|A0A699S6F9|A0A699S6F9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_864857 PE=4 SV=1	0.83018	1.378	0	45986	0	9175.9	13404	0	0	0	0	0	0	0	0	0	0	0	9908.5	0	0	45986	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9175.9	0	0	0	0	0	0	0	0	0	13404	0	0	0
A0A699S6K3	A0A699S6K3_TANCI	CCHC-type domain-containing protein	Tci_865129	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	RPEGTGM	tr|A0A699S6K3|A0A699S6K3_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_865129 PE=4 SV=1	0.89391	1.378	0	0	0	12161	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12161	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699S765	A0A699S765_TANCI	Copia protein (Fragment)	Tci_865271	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NLVKWTG	tr|A0A699S765|A0A699S765_TANCI Copia protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_865271 PE=4 SV=1	0.90319	1.378	38842	0	0	0	0	0	0	0	0	0	0	0	38842	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699S866	A0A699S866_TANCI	Uncharacterized protein (Fragment)	Tci_865611	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ESDSVWD	tr|A0A699S866|A0A699S866_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_865611 PE=4 SV=1	0.90282	1.378	0	0	62108	68622	66987	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	36670	0	0	62108	0	0	0	0	0	0	0	0	0	68622	0	0	0	0	0	0	45730	0	0	0	0	66987	0
A0A699S8F9	A0A699S8F9_TANCI	Uncharacterized protein (Fragment)	Tci_865388	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ECSDYEE	tr|A0A699S8F9|A0A699S8F9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_865388 PE=4 SV=1	0.90139	1.378	0	0	0	0	13311	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13311
A0A699S9I8	A0A699S9I8_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_865897	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	CTTSSSS	tr|A0A699S9I8|A0A699S9I8_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_865897 PE=4 SV=1	0.84075	1.378	7430.8	35388	26811	35451	49879	0	0	7430.8	0	0	0	0	0	0	7389.4	35388	0	0	0	0	31536	0	0	0	20138	0	26811	0	0	0	0	0	0	0	0	0	31934	12292	35451	0	6786.1	49879	0	0	0	0	24242	7591.9	5577.4	0
A0A699S9J4	A0A699S9J4_TANCI	Uncharacterized protein (Fragment)	Tci_866219	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DPGSENV	tr|A0A699S9J4|A0A699S9J4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_866219 PE=4 SV=1	0.81671	1.378	1300800	827610	340620	19857	86769	0	412910	0	0	1300800	0	0	0	0	0	0	17789	827610	0	447560	13671	414640	0	195630	0	340620	0	0	15005	0	0	0	0	0	0	0	19857	0	0	0	0	27623	0	0	0	86769	13720	0	0	0
A0A699SAU7	A0A699SAU7_TANCI	Uncharacterized protein (Fragment)	Tci_866377	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					YGNFKAK	tr|A0A699SAU7|A0A699SAU7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_866377 PE=4 SV=1;tr|A0A699M960|A0A699M960_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_738534 PE=4 SV=1	0.79104	1.378	4829.8	3878.1	0	5654	0	0	0	4829.8	0	0	0	0	0	0	0	0	3878.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5654	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699SAV9	A0A699SAV9_TANCI	Uncharacterized protein (Fragment)	Tci_866654	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					FFLSATK	tr|A0A699SAV9|A0A699SAV9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_866654 PE=4 SV=1	0.84124	1.378	0	401690	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	401690	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699SBH8	A0A699SBH8_TANCI	Uncharacterized protein (Fragment)	Tci_866398	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ARIGHIM	tr|A0A699SBH8|A0A699SBH8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_866398 PE=4 SV=1	0.81332	1.378	0	35272	14242	0	0	0	0	0	0	0	0	0	0	0	35272	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14242	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699SCJ8	A0A699SCJ8_TANCI	Uncharacterized protein (Fragment)	Tci_867221	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TKILLLL	tr|A0A699SCJ8|A0A699SCJ8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_867221 PE=4 SV=1	0.81573	1.378	49675	6334.2	0	1694.4	0	0	0	0	1363.5	2343.1	0	49675	0	0	0	0	0	2563.7	5072.3	0	0	0	6334.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1694.4	0	0	0	0	0	0	0	0	0	0	0
A0A699SDC0	A0A699SDC0_TANCI	Uncharacterized protein (Fragment)	Tci_867586	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MNSGQPQ	tr|A0A699SDC0|A0A699SDC0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_867586 PE=4 SV=1	0.82361	1.378	0	0	955960	1491200	737470	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	955960	0	0	0	0	0	1491200	0	0	907360	0	0	737470	0	0	0	0	0	0	0	0
A0A699SDE7	A0A699SDE7_TANCI	Uncharacterized protein (Fragment)	Tci_867163	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ELEFDGR	tr|A0A699SDE7|A0A699SDE7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_867163 PE=4 SV=1	0.81524	1.378	0	13237	0	0	0	0	0	0	0	0	0	0	0	0	0	13237	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699SDH3	A0A699SDH3_TANCI	Uncharacterized protein (Fragment)	Tci_866985	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NLLMGMR	tr|A0A699SDH3|A0A699SDH3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_866985 PE=4 SV=1;tr|A0A103YL54|A0A103YL54_CYNCS BolA protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_010547 PE=4 SV=1	0.82879	1.378	21093	15350	10426	9434.5	0	0	7511	0	0	0	0	0	0	21093	0	0	0	0	0	0	0	15350	0	0	10426	0	0	0	0	0	0	0	0	7135.7	0	9434.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699SG08	A0A699SG08_TANCI	Uncharacterized protein (Fragment)	Tci_868561	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LALLPLVYLTAKMMAAR	tr|A0A699SG08|A0A699SG08_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_868561 PE=4 SV=1	0.89189	1.378	0	0	0	0	8924.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8924.5
A0A699SGC7	A0A699SGC7_TANCI	Uncharacterized protein (Fragment)	Tci_868203	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QWGWHSV	tr|A0A699SGC7|A0A699SGC7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_868203 PE=4 SV=1	0.86047	1.378	0	0	6163.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6163.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699SGS3	A0A699SGS3_TANCI	Uncharacterized protein (Fragment)	Tci_868439	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HALRVPK	tr|A0A699SGS3|A0A699SGS3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_868439 PE=4 SV=1	0.81475	1.378	11210	0	0	62771	0	0	0	0	0	0	11210	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	62771	0	0	0	0	0	0	0	0	0	0
A0A699SHU2	A0A699SHU2_TANCI	"Retrotransposon protein, putative, Ty1-copia subclass (Fragment)"	Tci_868849	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HVHAECG	"tr|A0A699SHU2|A0A699SHU2_TANCI Retrotransposon protein, putative, Ty1-copia subclass (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_868849 PE=4 SV=1"	0.8682	1.378	0	0	0	32282	8198.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32282	0	0	0	0	0	0	0	0	0	8198.6	0	0	0	0	0
A0A699SJB2	A0A699SJB2_TANCI	Uncharacterized protein (Fragment)	Tci_869377	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PRVSGHG	tr|A0A699SJB2|A0A699SJB2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_869377 PE=4 SV=1	0.81426	1.378	0	29154	20344	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29154	0	0	0	0	0	0	0	0	20344	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699SJD4	A0A699SJD4_TANCI	"Retrotransposon protein, putative, Ty1-copia subclass (Fragment)"	Tci_869791	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TSKAPNR	"tr|A0A699SJD4|A0A699SJD4_TANCI Retrotransposon protein, putative, Ty1-copia subclass (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_869791 PE=4 SV=1;tr|A0A699TIB7|A0A699TIB7_TANCI Retrotransposon protein, putative, Ty1-copia subclass (Fragment) O"	0.81377	1.378	0	0	0	0	42676	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42676	0	0	0	0	0	0
A0A699SJS6	A0A699SJS6_TANCI	Uncharacterized protein (Fragment)	Tci_869906	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NDEVADD	tr|A0A699SJS6|A0A699SJS6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_869906 PE=4 SV=1	0.81329	1.378	0	0	0	0	6685	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6685	0	0	0	0
A0A699SKA4	A0A699SKA4_TANCI	Uncharacterized protein	Tci_870131	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QMQIRNK	tr|A0A699SKA4|A0A699SKA4_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_870131 PE=4 SV=1	0.8128	1.378	0	482070	0	0	0	0	0	0	0	0	0	0	0	0	0	0	482070	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699SKU8	A0A699SKU8_TANCI	Uncharacterized protein (Fragment)	Tci_869908	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SSSDLIK	tr|A0A699SKU8|A0A699SKU8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_869908 PE=4 SV=1	0.81231	1.378	10989	32474	23164	27698	22035	0	0	0	0	0	0	0	10989	0	0	0	32474	20112	0	0	26478	0	0	0	0	0	0	0	23164	0	0	21314	0	0	0	25624	0	27698	0	26704	18967	0	22035	0	0	0	0	0	0	0
A0A699SNW9	A0A699SNW9_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_871139	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	GGGCDTP	tr|A0A699SNW9|A0A699SNW9_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_871139 PE=4 SV=1	0.81183	1.378	14474	0	5902.7	0	0	0	0	0	0	0	14474	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5902.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699SNY1	A0A699SNY1_TANCI	"Zinc finger, CCHC-type, retrotransposon Gag domain protein (Fragment)"	Tci_870938	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DNNHGHR	"tr|A0A699SNY1|A0A699SNY1_TANCI Zinc finger, CCHC-type, retrotransposon Gag domain protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_870938 PE=4 SV=1;tr|A0A699NJD6|A0A699NJD6_TANCI Retrotrans_gag domain-containing protein (Fragment) OS=Tanace"	0.93842	1.378	25593	25885	95756	35839	30488	19489	15927	25593	0	0	0	0	23490	0	15606	25441	0	0	0	0	25885	0	0	0	0	0	0	95756	0	11902	0	31824	0	0	0	35839	0	0	0	0	16213	0	30488	0	9763.9	0	9035.5	9773.3	0	0
A0A699SPA6	A0A699SPA6_TANCI	Uncharacterized protein (Fragment)	Tci_870603	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SSDTYGG	tr|A0A699SPA6|A0A699SPA6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_870603 PE=4 SV=1	0.84728	1.378	5398.1	4060.5	15489	4593.9	8079.9	5398.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4060.5	0	0	0	0	0	0	0	15489	0	0	0	0	0	4593.9	0	0	0	0	0	0	8079.9	0	0	0	1334.9	0	0	0	0
A0A699SQ83	A0A699SQ83_TANCI	Uncharacterized protein (Fragment)	Tci_870933	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VVAILTK	tr|A0A699SQ83|A0A699SQ83_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_870933 PE=4 SV=1	0.81134	1.378	0	0	0	11626	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11626	0	0	0	0	0	0	0	0	0	0	0
A0A699SRI8	A0A699SRI8_TANCI	Uncharacterized protein (Fragment)	Tci_871478	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NFQWGPC	tr|A0A699SRI8|A0A699SRI8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_871478 PE=4 SV=1	0.81086	1.378	0	0	0	69980	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	69980	0	0	0	0	0	0	0	0	0	0	0
A0A699SS79	A0A699SS79_TANCI	Uncharacterized protein (Fragment)	Tci_871633	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GASAMPM	tr|A0A699SS79|A0A699SS79_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_871633 PE=4 SV=1	0.84448	1.378	8450.9	8847.7	10538	0	0	0	0	8450.9	0	0	0	0	0	0	6393.9	0	8847.7	0	0	0	0	0	0	0	7560.7	0	0	0	10538	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699SSH3	A0A699SSH3_TANCI	Uncharacterized protein	Tci_872961	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KESHVQK	tr|A0A699SSH3|A0A699SSH3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_872961 PE=4 SV=1	0.84493	1.378	0	0	0	0	25855	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25855	0	0	0	0	0	0
A0A699SU98	A0A699SU98_TANCI	Uncharacterized protein (Fragment)	Tci_873476	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DKGKCIM	tr|A0A699SU98|A0A699SU98_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_873476 PE=4 SV=1	0.80893	1.378	0	0	0	0	8485	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8485	0	0	0	0	0	0	0	0
A0A699SUG1	A0A699SUG1_TANCI	Uncharacterized protein (Fragment)	Tci_872882	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VFRLRTK	tr|A0A699SUG1|A0A699SUG1_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_872882 PE=4 SV=1	0.85009	1.378	0	13589	0	12177	9793.5	0	0	0	0	0	0	0	0	0	0	13589	0	0	0	10523	7676.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12177	10180	0	0	0	0	0	0	9793.5	0	0	0	0
A0A699SUK7	A0A699SUK7_TANCI	Uncharacterized protein (Fragment)	Tci_873279	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			"hydrolase activity, acting on ester bonds [GO:0016788]"	"hydrolase activity, acting on ester bonds [GO:0016788]"	IIQCHGK	tr|A0A699SUK7|A0A699SUK7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_873279 PE=4 SV=1	0.80845	1.378	0	3223100	13954	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3223100	0	0	0	0	0	13954	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699SVG1	A0A699SVG1_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_873242	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	NGARSQD	tr|A0A699SVG1|A0A699SVG1_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_873242 PE=4 SV=1	0.91342	1.378	0	0	0	169500	10297	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	131080	169500	0	0	0	10297	0	0	0	0	0	0
A0A699SVW5	A0A699SVW5_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_873137	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	DPEKGRK	tr|A0A699SVW5|A0A699SVW5_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_873137 PE=4 SV=1	0.80797	1.378	0	0	0	0	435780	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	435780	0	0	0	0	0	0	0
A0A699SWV2	A0A699SWV2_TANCI	Uncharacterized protein (Fragment)	Tci_873722	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GGIGAAE	tr|A0A699SWV2|A0A699SWV2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_873722 PE=4 SV=1	0.93234	1.378	5770	0	5941.3	0	9020.9	0	0	0	0	0	5770	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5941.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9020.9	0	0	0	0	0	0	0	0
A0A699SXK4	A0A699SXK4_TANCI	Uncharacterized protein (Fragment)	Tci_873355	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DASCIMM	tr|A0A699SXK4|A0A699SXK4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_873355 PE=4 SV=1	0.93629	1.378	12131	16526	10765	11784	8817.1	10745	0	12131	0	0	0	0	0	0	10694	0	0	0	0	0	16526	0	0	0	0	7649.2	0	0	10765	0	5177.5	0	0	0	0	0	11784	0	0	0	10326	0	0	0	6531.2	0	0	0	8817.1	0
A0A699SXP5	A0A699SXP5_TANCI	CCHC-type domain-containing protein (Fragment)	Tci_874771	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	TVVLALP	tr|A0A699SXP5|A0A699SXP5_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_874771 PE=4 SV=1	0.94415	1.378	6019	0	0	0	5534.5	0	0	0	0	6019	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5220.7	0	0	0	0	5534.5	0
A0A699SXQ5	A0A699SXQ5_TANCI	Uncharacterized protein (Fragment)	Tci_874299	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TTVSSTK	tr|A0A699SXQ5|A0A699SXQ5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_874299 PE=4 SV=1;tr|A0A699PGA3|A0A699PGA3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_810400 PE=4 SV=	0.91322	1.378	104290	37241	53732	78681	37220	40114	36627	0	0	0	0	104290	0	30731	0	0	0	15847	31389	0	0	29668	37241	0	18320	0	0	0	0	35488	53732	21036	32012	78681	0	26279	0	0	0	0	0	0	0	0	0	0	0	37220	20709	0
A0A699SXY9	A0A699SXY9_TANCI	DNA repair protein RadA (Fragment)	Tci_873563	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	SDDQHTE	tr|A0A699SXY9|A0A699SXY9_TANCI DNA repair protein RadA (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_873563 PE=4 SV=1	0.94537	1.378	0	11318	0	0	0	0	0	0	0	0	0	0	0	0	0	11318	0	0	0	0	10429	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699SY48	A0A699SY48_TANCI	Uncharacterized protein (Fragment)	Tci_873908	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VVPAAPT	tr|A0A699SY48|A0A699SY48_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_873908 PE=4 SV=1	0.80701	1.378	0	0	0	9640.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9640.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699T1M8	A0A699T1M8_TANCI	Uncharacterized protein (Fragment)	Tci_875237	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ADAPGPS	tr|A0A699T1M8|A0A699T1M8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_875237 PE=4 SV=1	0.80605	1.378	0	0	4816.4	6887.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4816.4	0	0	0	0	0	0	0	0	6887.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699T1Q2	A0A699T1Q2_TANCI	"Putative reverse transcriptase domain, aspartic peptidase domain protein (Fragment)"	Tci_875288	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	CLCTGAR	"tr|A0A699T1Q2|A0A699T1Q2_TANCI Putative reverse transcriptase domain, aspartic peptidase domain protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_875288 PE=4 SV=1;tr|A0A699MHT1|A0A699MHT1_TANCI Zinc finger, CCHC-type, retrotransposon Gag dom"	0.94303	1.378	13969	0	0	0	0	10707	0	0	0	0	0	0	13969	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699T274	A0A699T274_TANCI	Uncharacterized protein (Fragment)	Tci_875447	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VRSKLAK	tr|A0A699T274|A0A699T274_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_875447 PE=4 SV=1	0.8172	1.378	0	0	0	2742.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2742.4	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699T2S2	A0A699T2S2_TANCI	Uncharacterized protein (Fragment)	Tci_876681	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PKLPECR	tr|A0A699T2S2|A0A699T2S2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_876681 PE=4 SV=1	0.81769	1.378	0	11405	0	816140	42272	0	0	0	0	0	0	0	0	0	0	0	8410.8	0	0	11405	8980.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7764.3	816140	33776	9723.9	42272	0	0	0	29859	0	0	0
A0A699T3X4	A0A699T3X4_TANCI	Uncharacterized protein (Fragment)	Tci_876886	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GFAFWRK	tr|A0A699T3X4|A0A699T3X4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_876886 PE=4 SV=1	0.94011	1.378	18735	9514.1	20039	12265	45782	7216.3	18735	0	3240.8	0	0	0	0	9164.8	0	0	0	0	6698.1	0	0	9514.1	0	0	0	0	0	0	0	0	20039	14115	0	8913.6	0	0	12265	0	0	8186.3	0	0	0	0	0	0	45782	22849	6803.6	0
A0A699T4W1	A0A699T4W1_TANCI	Uncharacterized protein (Fragment)	Tci_875955	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					YPLWRSR	tr|A0A699T4W1|A0A699T4W1_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_875955 PE=4 SV=1	0.81818	1.378	8972.4	5220.5	12970	7952.8	12459	0	0	0	0	0	8972.4	0	0	0	0	5220.5	0	0	0	0	0	0	0	0	0	0	12970	0	0	0	0	0	0	0	0	0	0	7952.8	0	0	0	7585.4	12459	0	0	0	0	0	0	0
A0A699T4W6	A0A699T4W6_TANCI	Uncharacterized protein (Fragment)	Tci_875913	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			serine-type peptidase activity [GO:0008236]	serine-type peptidase activity [GO:0008236]	AGPKACG	tr|A0A699T4W6|A0A699T4W6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_875913 PE=3 SV=1	0.82464	1.378	14139	12067	7234.9	5510.2	0	0	0	0	14139	7309.8	0	0	0	0	0	0	0	0	12067	0	0	7011.7	0	0	0	0	0	0	0	0	7234.9	0	5510.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699T5L5	A0A699T5L5_TANCI	Uncharacterized protein (Fragment)	Tci_876163	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MDNENAR	tr|A0A699T5L5|A0A699T5L5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_876163 PE=4 SV=1;tr|A0A2U1QIY6|A0A2U1QIY6_ARTAN Pentatricopeptide repeat-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA024270 PE=3 S	0.84412	1.378	0	0	0	12323	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12323	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699T6N0	A0A699T6N0_TANCI	Uncharacterized protein (Fragment)	Tci_877038	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KVVLPPK	tr|A0A699T6N0|A0A699T6N0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_877038 PE=4 SV=1;tr|A0A699N5B6|A0A699N5B6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_771172 PE=4 SV=	0.84907	1.378	98817	14481	111100	261400	75846	0	0	0	0	14929	98817	0	0	0	0	0	8565.6	0	0	0	0	4284.6	14481	0	0	97384	111100	0	105520	8858.8	0	0	6980.7	0	96004	0	0	121030	127570	261400	0	0	0	0	0	0	75846	0	0	0
A0A699T8N2	A0A699T8N2_TANCI	Uncharacterized protein (Fragment)	Tci_877688	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PRVILGR	tr|A0A699T8N2|A0A699T8N2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_877688 PE=4 SV=1	0.82866	1.378	0	0	0	0	36429	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	36429	0	0	0	0	0	0	0	0
A0A699TA19	A0A699TA19_TANCI	Uncharacterized protein (Fragment)	Tci_879006	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SITIMYK	tr|A0A699TA19|A0A699TA19_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_879006 PE=4 SV=1	0.82815	1.378	0	0	0	0	13718	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13718	0	0
A0A699TB64	A0A699TB64_TANCI	Uncharacterized protein (Fragment)	Tci_878448	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SSNDEDD	tr|A0A699TB64|A0A699TB64_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_878448 PE=4 SV=1	0.82765	1.378	0	0	0	2400.4	2626	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2400.4	0	0	0	0	0	0	0	0	2626	0	0	0	0	0	0	0
A0A699TEU6	A0A699TEU6_TANCI	Uncharacterized protein	Tci_879023	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HEVGDHR	tr|A0A699TEU6|A0A699TEU6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_879023 PE=4 SV=1	0.94161	1.378	15710	14815	0	9265.1	0	0	0	0	0	0	0	15710	0	11458	0	0	0	0	14815	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9265.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699TF38	A0A699TF38_TANCI	Uncharacterized protein (Fragment)	Tci_881131	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PAAGIRT	tr|A0A699TF38|A0A699TF38_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_881131 PE=4 SV=1	0.92978	1.378	15045	0	0	13143	0	0	0	0	0	15045	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13143	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699TG43	A0A699TG43_TANCI	Uncharacterized protein (Fragment)	Tci_880015	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					AKSYGAS	tr|A0A699TG43|A0A699TG43_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_880015 PE=4 SV=1	0.82715	1.378	4162.2	2528.1	0	0	0	0	0	0	0	0	4162.2	0	0	0	0	0	2528.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699THS1	A0A699THS1_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_880860	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	WFRVKNK	tr|A0A699THS1|A0A699THS1_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_880860 PE=4 SV=1	0.94564	1.378	21946	23576	24923	33649	28746	18973	19742	18561	0	0	0	0	21946	0	21593	0	23576	0	0	0	0	0	20348	16732	16032	0	0	0	22224	0	17957	24923	24619	33649	0	22254	20921	0	0	0	0	0	28746	0	0	0	0	0	0	0
A0A699TI23	A0A699TI23_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_880695	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	FGLDGKL	tr|A0A699TI23|A0A699TI23_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_880695 PE=4 SV=1	0.94598	1.378	37825	0	0	0	0	0	0	0	0	0	0	37825	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699TIQ2	A0A699TIQ2_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_881057	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	NVGHQTR	tr|A0A699TIQ2|A0A699TIQ2_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_881057 PE=4 SV=1	0.82614	1.378	0	28912	19120	36282	38823	0	0	0	0	0	0	0	0	0	0	22662	23204	0	0	28912	20499	0	0	0	0	19120	0	0	0	0	0	0	0	0	36282	0	0	0	22295	21438	24743	35899	38823	0	14287	0	14257	0	0	0
A0A699TJB0	A0A699TJB0_TANCI	Uncharacterized protein (Fragment)	Tci_881338	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VVWFLIR	tr|A0A699TJB0|A0A699TJB0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_881338 PE=4 SV=1	0.9397	1.378	0	0	4167.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4167.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699TJR6	A0A699TJR6_TANCI	"RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein (Fragment)"	Tci_881942	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	FGIQFFK	"tr|A0A699TJR6|A0A699TJR6_TANCI RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_881942 PE=4 SV=1;tr|A0A699NT11|A0A699NT11_TANCI Reverse transcriptase domain-c"	0.83875	1.378	15879	0	39722	19850	0	0	0	0	0	15688	0	0	15879	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	39722	0	0	19850	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699TJZ7	A0A699TJZ7_TANCI	Uncharacterized protein (Fragment)	Tci_881365	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EEHDEEY	tr|A0A699TJZ7|A0A699TJZ7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_881365 PE=4 SV=1	0.82514	1.378	4883.4	0	4762.3	0	1939.9	0	0	0	0	0	4883.4	0	0	0	0	0	0	0	0	0	0	0	0	0	4762.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1939.9	0
A0A699TKA7	A0A699TKA7_TANCI	DNA helicase (Fragment)	Tci_883114	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			helicase activity [GO:0004386]	helicase activity [GO:0004386]	LNACQRR	tr|A0A699TKA7|A0A699TKA7_TANCI DNA helicase (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_883114 PE=4 SV=1	0.81867	1.378	13749	15180	10150	0	24646	0	0	0	0	0	13749	0	0	0	0	0	0	0	0	0	15180	0	0	0	0	0	10150	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24646	0	0	9416.4	0	0	0	0	0
A0A699TKD2	A0A699TKD2_TANCI	Uncharacterized protein (Fragment)	Tci_882182	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PALVIVI	tr|A0A699TKD2|A0A699TKD2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_882182 PE=4 SV=1	0.82364	1.378	32248	36746	29377	26595	7683.8	0	0	0	27160	0	0	32248	0	25716	0	0	0	21997	27571	0	0	0	36746	0	0	0	0	0	0	29377	20458	0	26595	0	0	11063	0	0	0	0	0	0	0	7683.8	0	0	0	7452.2	0	0
A0A699TL16	A0A699TL16_TANCI	Uncharacterized protein	Tci_883384	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PQEGGDS	tr|A0A699TL16|A0A699TL16_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_883384 PE=4 SV=1	0.82314	1.378	21887	26629	0	0	3833.2	0	0	0	0	0	0	21887	0	15721	0	0	0	0	26629	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3833.2	0	0	0	0
A0A699TMD4	A0A699TMD4_TANCI	Uncharacterized protein (Fragment)	Tci_883871	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GFFWDNR	tr|A0A699TMD4|A0A699TMD4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_883871 PE=4 SV=1	0.82214	1.378	11417	12186	9431.6	9098.1	0	0	11417	0	0	0	0	0	0	0	0	0	0	12186	0	0	0	5591.4	0	0	0	0	0	0	0	0	0	9431.6	0	0	0	9098.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699TME5	A0A699TME5_TANCI	Uncharacterized protein (Fragment)	Tci_882408	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LLLPPFM	tr|A0A699TME5|A0A699TME5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_882408 PE=4 SV=1	0.94074	1.378	0	649800	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	649800	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699TN64	A0A699TN64_TANCI	RT_RNaseH_2 domain-containing protein (Fragment)	Tci_882565	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					FWIPKVK	tr|A0A699TN64|A0A699TN64_TANCI RT_RNaseH_2 domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_882565 PE=4 SV=1;tr|A0A699K6E3|A0A699K6E3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_646475 PE=4 	0.87004	1.378	26227	0	0	16043	0	0	0	0	0	0	26227	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16043	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699TNC0	A0A699TNC0_TANCI	Reverse transcriptase	Tci_884194	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	LNLEWYDICM	tr|A0A699TNC0|A0A699TNC0_TANCI Reverse transcriptase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_884194 PE=4 SV=1;tr|A0A699QTN8|A0A699QTN8_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN	0.89971	1.378	176010	23373	113590	0	0	0	0	176010	0	0	0	0	0	0	23373	0	0	0	0	0	0	0	0	0	113590	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699TNS2	A0A699TNS2_TANCI	Uncharacterized protein (Fragment)	Tci_882787	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GHNDSGG	tr|A0A699TNS2|A0A699TNS2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_882787 PE=4 SV=1	0.94202	1.378	4763.8	0	6545	0	0	0	0	0	0	0	0	0	0	4763.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6545	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699TP86	A0A699TP86_TANCI	Uncharacterized protein	Tci_882957	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RDVVRTE	tr|A0A699TP86|A0A699TP86_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_882957 PE=4 SV=1	0.82164	1.378	0	0	0	0	49020	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	49020	0	0
A0A699TQS3	A0A699TQS3_TANCI	Uncharacterized protein (Fragment)	Tci_883790	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SDSDDEE	tr|A0A699TQS3|A0A699TQS3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_883790 PE=4 SV=1	0.82115	1.378	0	0	0	0	2121.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2121.3	0	0	0	0
A0A699TUC8	A0A699TUC8_TANCI	Uncharacterized protein (Fragment)	Tci_886444	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NGNGGMK	tr|A0A699TUC8|A0A699TUC8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_886444 PE=4 SV=1	0.81966	1.378	0	0	128990	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	128990	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699TUJ2	A0A699TUJ2_TANCI	Uncharacterized protein	Tci_884705	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PRAVMHG	tr|A0A699TUJ2|A0A699TUJ2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_884705 PE=4 SV=1	0.81917	1.378	5866.2	5115.7	6161.1	4678	5620.4	0	5866.2	0	0	0	0	0	5688.5	0	5115.7	0	0	0	0	0	0	0	0	0	0	0	0	0	6161.1	0	0	0	0	0	0	0	0	0	0	4556	4678	0	0	0	5620.4	0	0	0	0	0
A0A699TVK8	A0A699TVK8_TANCI	Uncharacterized protein (Fragment)	Tci_885859	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					AKGGQYS	tr|A0A699TVK8|A0A699TVK8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_885859 PE=4 SV=1	0.80509	1.378	0	0	0	23627	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5694.3	0	0	0	0	0	0	23627	13102	0	0	0	0	0	0	0	0	0
A0A699TWI1	A0A699TWI1_TANCI	LysR_substrate domain-containing protein	Tci_885368	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ARLLPVR	tr|A0A699TWI1|A0A699TWI1_TANCI LysR_substrate domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_885368 PE=4 SV=1	0.94546	1.378	39733	0	3840	4210.6	0	0	0	0	0	0	0	39733	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3840	0	0	0	0	4210.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699TXE2	A0A699TXE2_TANCI	CCHC-type domain-containing protein (Fragment)	Tci_887551	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	GGGDHCR	tr|A0A699TXE2|A0A699TXE2_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_887551 PE=4 SV=1;tr|A0A699VYZ8|A0A699VYZ8_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=11851	0.92905	1.378	6628.3	0	0	3481.6	0	0	0	0	0	0	0	0	0	6628.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3481.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699U2C0	A0A699U2C0_TANCI	Uncharacterized protein (Fragment)	Tci_889334	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KAMVVLK	tr|A0A699U2C0|A0A699U2C0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_889334 PE=4 SV=1;tr|A0A699T276|A0A699T276_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_875005 PE=4 SV=	0.93187	1.378	1358	0	0	0	0	0	0	0	0	0	0	0	0	1358	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699U2F9	A0A699U2F9_TANCI	Uncharacterized protein (Fragment)	Tci_889374	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DAYHWFM	tr|A0A699U2F9|A0A699U2F9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_889374 PE=4 SV=1	0.94521	1.378	23219	11771	17796	10763	0	0	0	0	0	0	23219	0	0	0	0	0	0	0	0	0	0	11771	0	0	0	0	0	17796	0	0	0	0	0	10763	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699U372	A0A699U372_TANCI	Couple_hipA domain-containing protein (Fragment)	Tci_888630	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QFFPFLD	tr|A0A699U372|A0A699U372_TANCI Couple_hipA domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_888630 PE=4 SV=1	0.93064	1.378	0	5681.3	0	7445.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5681.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7445.6	0	0	0	0	0	0	0	0	0	0
A0A699U3T1	A0A699U3T1_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_887965	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	TLIIIPK	tr|A0A699U3T1|A0A699U3T1_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_887965 PE=4 SV=1	0.92439	1.378	0	35272	0	39974	0	0	0	0	0	0	0	0	0	0	0	0	35272	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	39974	0	0	0	0	0	0	0	0	0	0	0
A0A699U5U9	A0A699U5U9_TANCI	Putative ribonuclease H-like domain-containing protein (Fragment)	Tci_889736	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					AGYDSDS	tr|A0A699U5U9|A0A699U5U9_TANCI Putative ribonuclease H-like domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_889736 PE=4 SV=1	0.94587	1.378	0	8885.1	0	0	6707.6	0	0	0	0	0	0	0	0	0	0	0	0	8885.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6707.6	0	0
A0A699U642	A0A699U642_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_888795	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	NGQNGHN	tr|A0A699U642|A0A699U642_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_888795 PE=4 SV=1	0.94139	1.378	0	0	0	0	4503.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4503.8	0	0	0	0	0	0	0
A0A699U695	A0A699U695_TANCI	Uncharacterized protein (Fragment)	Tci_890391	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RAAAGHR	tr|A0A699U695|A0A699U695_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_890391 PE=4 SV=1;tr|A0A699GEG7|A0A699GEG7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_000261 PE=4 SV=1	0.81038	1.378	0	19254	6729.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19254	0	0	6080.5	6568.3	0	0	0	0	0	0	6729.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699U6B9	A0A699U6B9_TANCI	Uncharacterized protein (Fragment)	Tci_889946	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PETADDR	tr|A0A699U6B9|A0A699U6B9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_889946 PE=4 SV=1	0.94221	1.378	9864.3	10652	0	0	8504.2	0	0	0	0	9864.3	0	0	0	0	0	0	0	0	10652	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8504.2	0	0	0	0	0	0
A0A699U8B6	A0A699U8B6_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_889608	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	CIEFDYD	tr|A0A699U8B6|A0A699U8B6_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_889608 PE=4 SV=1	0.85632	1.378	0	0	0	0	6758.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6758.9	0	0
A0A699U8Y5	A0A699U8Y5_TANCI	Uncharacterized protein (Fragment)	Tci_888193	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PLTALLP	tr|A0A699U8Y5|A0A699U8Y5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_888193 PE=4 SV=1	0.89634	1.378	0	11340	0	0	11980	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11340	10030	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11980	0	0	2694.7	0	2971.8	0	0	0
A0A699U9P5	A0A699U9P5_TANCI	Uncharacterized protein (Fragment)	Tci_891099	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					IHKDHPT	tr|A0A699U9P5|A0A699U9P5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_891099 PE=4 SV=1;tr|A0A699VLB6|A0A699VLB6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_904523 PE=4 SV=	0.77172	1.378	0	0	4067.5	3517	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4067.5	0	0	0	0	0	0	0	0	0	0	0	3517	0	0	0	0	0	0	0	0	0	0	0	0
A0A699U9Q5	A0A699U9Q5_TANCI	Uncharacterized protein (Fragment)	Tci_891109	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GFLRLFL	tr|A0A699U9Q5|A0A699U9Q5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_891109 PE=4 SV=1	0.93837	1.378	0	14895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699UCM6	A0A699UCM6_TANCI	Uncharacterized protein (Fragment)	Tci_892711	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GPPDDCR	tr|A0A699UCM6|A0A699UCM6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_892711 PE=4 SV=1	0.94888	1.378	0	0	91902	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	91902	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699UCW0	A0A699UCW0_TANCI	Uncharacterized protein	Tci_892984	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LKTKLVL	tr|A0A699UCW0|A0A699UCW0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_892984 PE=4 SV=1;tr|A0A699GYC9|A0A699GYC9_TANCI Zf-CCHC domain-containing protein/UBN2 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=	0.94638	1.378	6402.6	4428	0	0	0	0	0	0	5489.2	6402.6	0	5472.4	0	0	0	0	0	0	0	0	0	4428	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699UHG1	A0A699UHG1_TANCI	Receptor-like protein kinase FERONIA (Fragment)	Tci_893110	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	DAAGNPM	tr|A0A699UHG1|A0A699UHG1_TANCI Receptor-like protein kinase FERONIA (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_893110 PE=4 SV=1	0.94848	1.378	0	7299.1	110890	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7299.1	0	0	0	0	0	0	0	0	0	0	110890	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699ULC0	A0A699ULC0_TANCI	Uncharacterized protein (Fragment)	Tci_895901	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LIHFFGR	tr|A0A699ULC0|A0A699ULC0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_895901 PE=4 SV=1	0.92141	1.378	0	31033	66364	25448	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31033	0	0	0	0	0	0	0	66364	0	0	0	0	0	0	0	0	0	0	25448	0	0	0	0	0	0	0	0	0	0
A0A699UMS3	A0A699UMS3_TANCI	Uncharacterized protein (Fragment)	Tci_895392	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DNEDDEE	tr|A0A699UMS3|A0A699UMS3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_895392 PE=4 SV=1	0.85053	1.378	0	23106	37367	0	13273	0	0	0	0	0	0	0	0	0	0	0	23106	0	0	0	0	0	0	0	0	37367	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13273	0
A0A699UP79	A0A699UP79_TANCI	Uncharacterized protein (Fragment)	Tci_897081	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KLQVVQC	tr|A0A699UP79|A0A699UP79_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_897081 PE=4 SV=1	0.84965	1.378	0	55294	0	0	44036	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	55294	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	44036	0	0	0
A0A699UUP7	A0A699UUP7_TANCI	Uncharacterized protein (Fragment)	Tci_898129	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PGPGDRR	tr|A0A699UUP7|A0A699UUP7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_898129 PE=4 SV=1	0.84863	1.378	93089	57666	19019	21750	37947	9203.5	93089	20119	55983	57188	0	64415	0	0	51386	0	0	57666	53601	0	0	0	0	0	0	0	0	0	0	0	19019	17560	0	0	0	21750	0	0	0	0	0	0	0	25596	0	0	0	0	37947	0
A0A699V1F3	A0A699V1F3_TANCI	Clavaminate synthase-like protein At3g21360	Tci_899567	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			oxidoreductase activity [GO:0016491]	oxidoreductase activity [GO:0016491]	PLLKPPR	tr|A0A699V1F3|A0A699V1F3_TANCI Clavaminate synthase-like protein At3g21360 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_899567 PE=4 SV=1;tr|A0A6S7MX46|A0A6S7MX46_LACSI TauD domain-containing protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS20797 PE=4 SV=1	0.88772	1.378	30550	28843	36997	35073	16013	0	0	4038	0	30550	0	0	0	0	20989	0	0	0	23921	0	28843	0	0	0	0	0	0	0	0	22249	0	36997	0	0	0	0	0	0	0	35073	0	0	0	0	16013	11194	0	0	0	0
A0A699V1Q8	A0A699V1Q8_TANCI	Uncharacterized protein (Fragment)	Tci_899667	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DPESESA	tr|A0A699V1Q8|A0A699V1Q8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_899667 PE=4 SV=1	0.85859	1.378	10637	0	0	0	0	7851.3	0	0	0	0	0	0	10637	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699V1Z7	A0A699V1Z7_TANCI	Uncharacterized protein (Fragment)	Tci_899757	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GDYDDES	tr|A0A699V1Z7|A0A699V1Z7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_899757 PE=4 SV=1	0.86742	1.378	64364	45322	33024	31924	9216.6	0	0	0	0	64364	0	0	0	0	0	45322	0	0	0	0	0	0	29717	0	33024	0	0	0	0	0	17162	0	0	31924	0	0	0	0	0	0	0	0	0	0	0	0	0	9216.6	0	0
A0A699V2C2	A0A699V2C2_TANCI	Uncharacterized protein (Fragment)	Tci_900010	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VGADHLR	tr|A0A699V2C2|A0A699V2C2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_900010 PE=4 SV=1	0.86731	1.378	0	0	0	1108700	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1108700	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699V2D9	A0A699V2D9_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_900849	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	ANGQNGN	tr|A0A699V2D9|A0A699V2D9_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_900849 PE=4 SV=1	0.86763	1.378	24487	15792	121000	0	13006	24487	0	13114	0	0	0	0	0	0	15792	0	0	0	0	0	0	0	0	12147	0	4645.8	0	121000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4467.8	4028.1	0	13006	0	0
A0A699V3U8	A0A699V3U8_TANCI	CCHC-type domain-containing protein (Fragment)	Tci_900417	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	DSTEDDE	tr|A0A699V3U8|A0A699V3U8_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_900417 PE=4 SV=1	0.86719	1.378	8225	16500	18625	0	15475	0	8225	0	0	0	0	0	0	0	16500	0	0	0	0	0	0	0	0	3969.1	6947.6	0	0	0	0	0	0	18625	0	0	0	0	0	0	0	0	0	0	15475	0	0	1681.2	0	0	6219.5	0
A0A699V676	A0A699V676_TANCI	Uncharacterized protein (Fragment)	Tci_902526	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KTKLQCR	tr|A0A699V676|A0A699V676_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_902526 PE=4 SV=1;tr|A0A699RTJ8|A0A699RTJ8_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_859	0.93796	1.378	408830	313190	42728	339430	286880	28340	408830	35191	151520	0	0	154950	18522	0	313190	0	0	0	0	124590	0	0	16075	0	42728	0	0	0	18282	0	0	20250	0	17404	0	30447	0	339430	0	91636	0	286880	0	140880	0	155730	0	0	0	0
A0A699V6H6	A0A699V6H6_TANCI	Uncharacterized protein (Fragment)	Tci_900935	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QSDMATM	tr|A0A699V6H6|A0A699V6H6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_900935 PE=4 SV=1	0.8619	1.378	0	22286	0	0	12662	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22286	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12662	0	0	0	0	0	0
A0A699V7E6	A0A699V7E6_TANCI	Uncharacterized protein (Fragment)	Tci_901235	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DSNPDGG	tr|A0A699V7E6|A0A699V7E6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_901235 PE=4 SV=1	0.86322	1.378	0	0	2565.3	4285.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2565.3	0	0	0	0	0	0	0	0	0	0	4285.5	0	0	0	0	0	0	0	0	0	0	0
A0A699V7T5	A0A699V7T5_TANCI	Uncharacterized protein (Fragment)	Tci_900143	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TPEGSED	tr|A0A699V7T5|A0A699V7T5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_900143 PE=4 SV=1;tr|A0A699TSY0|A0A699TSY0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_884660 PE=4 SV=	0.82065	1.378	9678.3	0	10247	28580	6580.4	0	0	0	0	0	0	0	9678.3	0	0	0	0	0	0	0	0	0	0	0	10247	0	0	0	0	0	0	0	0	4778.4	0	0	28580	0	0	0	0	0	0	0	0	0	0	4919.7	6580.4	0
A0A699V9X8	A0A699V9X8_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_902892	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	DQNLPPK	tr|A0A699V9X8|A0A699V9X8_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_902892 PE=4 SV=1	0.86366	1.378	0	0	1890500	2354600	2585000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1890500	0	0	0	0	2354600	0	0	0	0	0	2149800	39575	0	2585000	0	1479000	0	0	0	1610200
A0A699VC77	A0A699VC77_TANCI	Uncharacterized protein (Fragment)	Tci_903140	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VGHVGGA	tr|A0A699VC77|A0A699VC77_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_903140 PE=4 SV=1	0.86527	1.378	0	0	0	9115.4	11501	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9115.4	0	0	0	0	0	0	0	11501	0	0	0	0	0	0	0
A0A699VCT0	A0A699VCT0_TANCI	Uncharacterized protein (Fragment)	Tci_903972	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HGVARVR	tr|A0A699VCT0|A0A699VCT0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_903972 PE=4 SV=1	0.86483	1.378	8022.1	0	0	22021	0	0	8022.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22021	0	0	0	0	0	0	0	0	0
A0A699VF78	A0A699VF78_TANCI	Uncharacterized protein (Fragment)	Tci_905129	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EESDEPT	tr|A0A699VF78|A0A699VF78_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_905129 PE=4 SV=1;tr|A0A699XVL2|A0A699XVL2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_934017 PE=4 SV=	0.8634	1.378	14235	0	0	0	12448	0	0	14235	0	12127	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12448	0	12159	0	0
A0A699VFH9	A0A699VFH9_TANCI	Uncharacterized protein (Fragment)	Tci_906261	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			oxidoreductase activity [GO:0016491]	oxidoreductase activity [GO:0016491]	GRCTAGC	tr|A0A699VFH9|A0A699VFH9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_906261 PE=4 SV=1	0.8422	1.378	117620	0	56629	0	68630	0	0	0	0	117620	0	0	0	0	0	0	0	0	0	0	0	0	0	56629	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	68630	66337	0	0	0	0	0	0
A0A699VHH1	A0A699VHH1_TANCI	Putative reverse transcriptase domain-containing protein	Tci_906954	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	CAEKIVR	tr|A0A699VHH1|A0A699VHH1_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_906954 PE=4 SV=1;tr|A0A699TJH8|A0A699TJH8_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tan	0.82564	1.378	0	11041	13062	0	9343.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11041	0	0	0	0	0	0	13062	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9343.1	0	0	0	0	0	0	0	0
A0A699VIP2	A0A699VIP2_TANCI	Gag-Pol polyprotein (Fragment)	Tci_906319	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	SGQECGD	tr|A0A699VIP2|A0A699VIP2_TANCI Gag-Pol polyprotein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_906319 PE=4 SV=1	0.82583	1.378	0	0	0	3770.5	2009.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3770.5	0	0	0	0	0	0	0	0	0	2009.7	0	0	0	0	0
A0A699VMB9	A0A699VMB9_TANCI	Uncharacterized protein (Fragment)	Tci_908326	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ILLKPAR	tr|A0A699VMB9|A0A699VMB9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_908326 PE=4 SV=1	0.84746	1.378	3557800	4617700	2373200	1755100	1553400	1020800	2052200	3557800	1690700	1197700	534200	104690	2028400	2261200	0	1348500	661380	299460	2199100	2901700	1437500	2103100	4617700	265140	509530	0	2373200	1839800	1373100	877490	26978	0	385540	1029900	0	1755100	1281100	1081100	0	0	0	0	1553400	0	25315	54990	492880	458080	664020	174680
A0A699VNT0	A0A699VNT0_TANCI	Uncharacterized protein (Fragment)	Tci_906680	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LEDGDCL	tr|A0A699VNT0|A0A699VNT0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_906680 PE=4 SV=1	0.82558	1.378	0	0	208030	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	111760	0	0	0	0	208030	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699VQ07	A0A699VQ07_TANCI	Uncharacterized protein (Fragment)	Tci_907405	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NRIQMRR	tr|A0A699VQ07|A0A699VQ07_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_907405 PE=4 SV=1	0.81703	1.378	9331.6	0	0	0	0	0	9331.6	0	0	8827.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699VQ42	A0A699VQ42_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_905903	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	VGKVALV	tr|A0A699VQ42|A0A699VQ42_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_905903 PE=4 SV=1	0.81892	1.378	962.07	0	0	1476.2	0	0	0	962.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1476.2	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699VQB6	A0A699VQB6_TANCI	Uncharacterized protein (Fragment)	Tci_908559	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RAEDPRR	tr|A0A699VQB6|A0A699VQB6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_908559 PE=4 SV=1	0.82135	1.378	0	0	8752	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8752	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699VQS4	A0A699VQS4_TANCI	CCHC-type domain-containing protein (Fragment)	Tci_908712	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	GNGCFEC	tr|A0A699VQS4|A0A699VQS4_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_908712 PE=4 SV=1;tr|A0A699S7F7|A0A699S7F7_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_86	0.76305	1.378	7147.7	15700	5491.7	7794.1	0	0	0	0	0	0	0	0	0	7147.7	0	0	0	0	15700	0	0	11077	0	0	0	0	0	0	0	0	5491.7	0	0	7794.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699VR88	A0A699VR88_TANCI	"Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic (Fragment)"	Tci_908798	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MDVNEGD	"tr|A0A699VR88|A0A699VR88_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_908798 PE=4 SV=1"	0.82622	1.378	0	0	0	1753.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1753.9	0	0	0	0	0	0	0	0	0	0
A0A699VS04	A0A699VS04_TANCI	Uncharacterized protein (Fragment)	Tci_907800	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DKSDNDGNDDDGDNDDND	tr|A0A699VS04|A0A699VS04_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_907800 PE=4 SV=1	0	3.0429	0	8447	9381.8	11072	15414	0	0	0	0	0	0	0	0	0	8447	0	0	7707.2	0	0	0	0	0	0	0	0	0	0	0	0	0	9381.8	11072	0	0	2083.1	0	0	0	0	0	0	0	0	0	12242	15414	0	2931.2	0
A0A699VV66	A0A699VV66_TANCI	Uncharacterized protein (Fragment)	Tci_911421	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QVLIMMM	tr|A0A699VV66|A0A699VV66_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_911421 PE=4 SV=1;tr|A0A699UCF4|A0A699UCF4_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_890857 PE=4 SV=1	0.94933	1.378	0	8453.8	0	0	0	0	0	0	0	0	0	0	0	0	0	8453.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699VV83	A0A699VV83_TANCI	Uncharacterized protein (Fragment)	Tci_911431	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PPTALLL	tr|A0A699VV83|A0A699VV83_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_911431 PE=4 SV=1	0.84009	1.378	0	0	12139	8341.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10342	12139	3541	0	0	0	0	0	8341.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699VV93	A0A699VV93_TANCI	Uncharacterized protein (Fragment)	Tci_911454	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					CGGGDGESCSDGDG	tr|A0A699VV93|A0A699VV93_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_911454 PE=4 SV=1	0	4.718	8358.8	25565	52925	14341	26424	4447.5	6418	8358.8	0	0	0	0	0	0	25565	8554.4	0	0	0	14244	0	9927.9	0	25139	34523	20890	12031	52925	0	6864.7	42309	0	0	0	0	7792	0	14341	0	0	8695.8	0	0	0	7167.7	10908	26424	0	14487	0
A0A699VVN6	A0A699VVN6_TANCI	Uncharacterized protein (Fragment)	Tci_910418	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EGSAEAE	tr|A0A699VVN6|A0A699VVN6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_910418 PE=4 SV=1	0.83964	1.378	6545.1	8258.8	0	0	0	0	0	0	0	0	0	6545.1	0	0	5346.2	0	0	0	8258.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699VVU1	A0A699VVU1_TANCI	Uncharacterized protein (Fragment)	Tci_911654	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QKVPIPK	tr|A0A699VVU1|A0A699VVU1_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_911654 PE=4 SV=1;tr|A0A699GQB1|A0A699GQB1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_162259 PE=4 SV=1;tr|A0A6L2	0.798	1.378	25935	9478.5	0	0	0	0	0	0	0	0	25935	0	0	0	0	9478.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699VW12	A0A699VW12_TANCI	Ribonuclease H-like domain-containing protein (Fragment)	Tci_911721	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					IPLTAGN	tr|A0A699VW12|A0A699VW12_TANCI Ribonuclease H-like domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_911721 PE=4 SV=1	0.83742	1.378	8519.3	17308	11250	18640	6634.1	8519.3	0	0	0	0	0	0	7931.1	0	0	0	17308	0	0	0	0	0	0	6062.6	11250	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18640	14946	0	0	0	0	6634.1	0	0	0	0
A0A699VZ59	A0A699VZ59_TANCI	Uncharacterized protein (Fragment)	Tci_911682	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KPGAPGR	tr|A0A699VZ59|A0A699VZ59_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_911682 PE=4 SV=1;tr|A0A699RJU4|A0A699RJU4_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_858	0.78103	1.378	14643	15807	12050	0	0	0	0	0	0	4199	0	6424.8	0	14643	0	0	0	0	15807	0	0	0	11415	0	0	0	0	0	0	12050	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699VZ72	A0A699VZ72_TANCI	Uncharacterized protein (Fragment)	Tci_909233	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					AVTEDSDDDSGERDDDMK	tr|A0A699VZ72|A0A699VZ72_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_909233 PE=4 SV=1	0.84615	2.3659	13240	9545.6	17013	66185	17887	13152	9724.5	0	0	0	0	0	13240	0	9545.6	0	0	0	0	0	0	0	0	0	10681	0	0	0	0	0	0	17013	0	12077	0	0	0	3700	46557	66185	13970	0	17887	9743.7	0	4392.7	8156.6	10809	0	0
A0A699VZH9	A0A699VZH9_TANCI	Uncharacterized protein (Fragment)	Tci_910765	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DNDGGDM	tr|A0A699VZH9|A0A699VZH9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_910765 PE=4 SV=1	0.84169	1.378	6305.1	0	0	10599	0	0	0	6305.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10599	0	0	0	0	0	0	0	0	0	0
A0A699W3V8	A0A699W3V8_TANCI	Uncharacterized protein (Fragment)	Tci_913219	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HVDSSNM	tr|A0A699W3V8|A0A699W3V8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_913219 PE=4 SV=1;tr|A0A699S1S3|A0A699S1S3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_863325 PE=4 SV=	0.78059	1.378	420820	427480	305510	187270	221790	340100	317780	260020	339280	324840	0	420820	0	0	0	0	0	0	368180	0	0	427480	342550	215400	0	0	305510	0	0	0	0	0	6111.4	187270	0	0	0	0	0	0	0	0	0	0	118660	0	0	67336	221790	8979.6
A0A699W4K7	A0A699W4K7_TANCI	Gag-Pol polyprotein (Fragment)	Tci_914814	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MDHNEGD	tr|A0A699W4K7|A0A699W4K7_TANCI Gag-Pol polyprotein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_914814 PE=4 SV=1	0.82908	1.378	22375	0	0	19151	0	0	0	0	0	0	0	0	22375	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19151	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699W5D4	A0A699W5D4_TANCI	Uncharacterized protein (Fragment)	Tci_913878	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KAQEDLR	tr|A0A699W5D4|A0A699W5D4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_913878 PE=4 SV=1	0.82819	1.378	0	12408	9508	0	0	0	0	0	0	0	0	0	0	0	0	0	12408	0	0	0	0	0	0	7778.5	7787.4	0	0	0	0	0	0	9508	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699W9X0	A0A699W9X0_TANCI	Uncharacterized protein (Fragment)	Tci_916056	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DFWAARK	tr|A0A699W9X0|A0A699W9X0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_916056 PE=4 SV=1;tr|A0A699WTY2|A0A699WTY2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_922926 PE=4 SV=	0.83028	1.378	12168	0	0	14191	0	0	0	0	0	0	0	0	12168	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14191	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699WCA8	A0A699WCA8_TANCI	CCHC-type domain-containing protein (Fragment)	Tci_915327	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	DVFYGKK	tr|A0A699WCA8|A0A699WCA8_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_915327 PE=4 SV=1;tr|A0A699V5T3|A0A699V5T3_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=11851	0.87023	1.378	0	0	0	10041	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10041	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699WCZ9	A0A699WCZ9_TANCI	Uncharacterized protein (Fragment)	Tci_916772	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RARPPTR	tr|A0A699WCZ9|A0A699WCZ9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_916772 PE=4 SV=1	0.83311	1.378	7034.1	6590.5	6626.2	9586	5745.8	7034.1	0	0	0	0	0	0	0	0	6590.5	0	0	0	0	0	0	0	0	0	0	0	0	0	6626.2	0	0	0	0	0	0	0	4878.8	9586	0	6539.3	0	0	0	0	0	0	5745.8	0	0	0
A0A699WDA6	A0A699WDA6_TANCI	Uncharacterized protein (Fragment)	Tci_916862	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SYDSSTM	tr|A0A699WDA6|A0A699WDA6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_916862 PE=4 SV=1	0.83073	1.378	3268.1	5509.1	5855.8	0	0	0	0	0	0	3268.1	0	0	0	0	0	0	0	0	5509.1	0	0	0	0	0	0	0	0	0	0	0	0	5855.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699WF41	A0A699WF41_TANCI	"RNA-directed DNA polymerase, eukaryota (Fragment)"	Tci_917502	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	IIVRPRR	"tr|A0A699WF41|A0A699WF41_TANCI RNA-directed DNA polymerase, eukaryota (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_917502 PE=4 SV=1"	0.87072	1.378	0	4177.3	0	0	0	0	0	0	0	0	0	0	0	0	4177.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699WG09	A0A699WG09_TANCI	Uncharacterized protein (Fragment)	Tci_915710	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DDDDDDD	tr|A0A699WG09|A0A699WG09_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_915710 PE=4 SV=1;tr|A0A699UJM8|A0A699UJM8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_894739 PE=4 SV=	0.82967	1.378	0	1917.3	0	2172.4	5729.7	0	0	0	0	0	0	0	0	0	0	0	0	0	1917.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2172.4	0	0	5729.7	0	0	0	0	0	0	0
A0A699WM64	A0A699WM64_TANCI	Uncharacterized protein (Fragment)	Tci_920674	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VRVAHNK	tr|A0A699WM64|A0A699WM64_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_920674 PE=4 SV=1	0.8984	1.378	0	0	0	3741.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3741.9	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699WUC1	A0A699WUC1_TANCI	Uncharacterized protein (Fragment)	Tci_920063	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MMMRIQR	tr|A0A699WUC1|A0A699WUC1_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_920063 PE=4 SV=1;tr|A0A699W135|A0A699W135_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_912976 PE=4 SV=	0.72414	2.756	245970	165300	0	173490	191190	0	0	0	0	193570	0	196350	245970	0	0	0	0	0	0	0	0	165300	0	0	0	0	0	0	0	0	0	0	153960	0	0	173490	153800	0	0	0	0	191190	0	0	0	0	0	0	0	0
A0A699WWD8	A0A699WWD8_TANCI	Uncharacterized protein (Fragment)	Tci_920843	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SDDDNDG	tr|A0A699WWD8|A0A699WWD8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_920843 PE=4 SV=1	0.89607	1.378	16118	2280.2	17135	10399	14400	0	0	0	0	16118	0	0	0	0	0	0	0	0	0	0	0	0	2280.2	17135	0	0	0	3745.9	0	0	0	0	0	10399	0	0	0	0	0	0	0	0	0	0	0	14400	0	0	0	0
A0A699WWY9	A0A699WWY9_TANCI	Uncharacterized protein (Fragment)	Tci_921053	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HGDFAAD	tr|A0A699WWY9|A0A699WWY9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_921053 PE=4 SV=1	0.90486	1.378	0	0	0	0	9500.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9500.5
A0A699WY43	A0A699WY43_TANCI	Uncharacterized protein (Fragment)	Tci_921453	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DDDNDDD	tr|A0A699WY43|A0A699WY43_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_921453 PE=4 SV=1	0.91538	1.378	0	0	0	9999.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9999.3	0	0	0	0	0	0	0	0	0	0	0	0
A0A699WYH5	A0A699WYH5_TANCI	Uncharacterized protein (Fragment)	Tci_924506	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LLALVVA	tr|A0A699WYH5|A0A699WYH5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_924506 PE=4 SV=1	0.91281	1.378	23674	0	0	0	0	23674	0	0	0	0	0	0	7447.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699WZ23	A0A699WZ23_TANCI	Uncharacterized protein (Fragment)	Tci_922815	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					FLLHHYA	tr|A0A699WZ23|A0A699WZ23_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_922815 PE=4 SV=1	0.9175	1.378	0	0	0	0	20085	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20085	0	0	0
A0A699WZA2	A0A699WZA2_TANCI	"Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic (Fragment)"	Tci_924796	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VLCEFED	"tr|A0A699WZA2|A0A699WZA2_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_924796 PE=4 SV=1"	0.91792	1.378	0	59181	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	59181	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699WZM9	A0A699WZM9_TANCI	Uncharacterized protein (Fragment)	Tci_925231	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TWETPLS	tr|A0A699WZM9|A0A699WZM9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_925231 PE=4 SV=1	0.92007	1.378	0	11748	22767	17772	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11748	5625.5	0	0	0	0	13230	22767	19107	0	0	0	0	0	0	0	0	0	17772	9949.3	0	0	0	0	0	0	0	0	0	0	0
A0A699X209	A0A699X209_TANCI	Uncharacterized protein (Fragment)	Tci_925508	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RPCQLGP	tr|A0A699X209|A0A699X209_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_925508 PE=4 SV=1	0.91882	1.378	0	0	0	4421.9	3106.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4421.9	0	0	0	0	0	0	3106.9	0	0	0	0	0
A0A699X263	A0A699X263_TANCI	Uncharacterized protein (Fragment)	Tci_923140	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KTTPCAR	tr|A0A699X263|A0A699X263_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_923140 PE=4 SV=1	0.91795	1.378	24413	0	27225	0	0	0	0	0	0	0	0	0	0	24413	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27225	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699X3X6	A0A699X3X6_TANCI	Uncharacterized protein (Fragment)	Tci_926416	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QADEEDE	tr|A0A699X3X6|A0A699X3X6_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_926416 PE=4 SV=1	0.89399	1.378	0	0	0	11278	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11278	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699X525	A0A699X525_TANCI	CCHC-type domain-containing protein (Fragment)	Tci_923703	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	ACEVPRR	tr|A0A699X525|A0A699X525_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_923703 PE=4 SV=1	0.90833	1.378	3706	144900	30577	23364	21749	3706	0	0	0	0	0	0	0	0	17942	144900	0	0	0	0	0	0	0	0	0	0	30577	22637	0	0	0	0	0	0	0	0	0	23364	0	0	3050.5	21749	0	0	0	0	0	0	0	0
A0A699X5G3	A0A699X5G3_TANCI	Uncharacterized protein (Fragment)	Tci_923853	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					AGDGEGV	tr|A0A699X5G3|A0A699X5G3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_923853 PE=4 SV=1	0.90528	1.378	4003.4	0	0	0	0	0	0	0	0	0	0	0	4003.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699X612	A0A699X612_TANCI	ATPase_AAA_core domain-containing protein (Fragment)	Tci_924560	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			ATP binding [GO:0005524]	ATP binding [GO:0005524]	SGSGNPG	tr|A0A699X612|A0A699X612_TANCI ATPase_AAA_core domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_924560 PE=4 SV=1	0.90799	1.378	22641	17136	12911	23662	0	11663	0	0	0	17733	0	22641	0	0	0	15246	17136	0	0	0	0	0	0	0	0	0	0	0	0	12911	0	0	10508	8764.9	0	0	0	0	0	23662	0	0	0	0	0	0	0	0	0	0
A0A699X6B2	A0A699X6B2_TANCI	Uncharacterized protein (Fragment)	Tci_927611	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					AGGGCGS	tr|A0A699X6B2|A0A699X6B2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_927611 PE=4 SV=1	0.91141	1.378	10757	15511	0	0	0	0	0	0	10757	0	0	0	0	0	0	0	0	15511	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699X799	A0A699X799_TANCI	Uncharacterized protein (Fragment)	Tci_927378	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ARSDSGE	tr|A0A699X799|A0A699X799_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_927378 PE=4 SV=1	0.879	1.378	38312	22567	0	17675	9385.1	0	0	0	38198	38312	0	0	0	15077	0	0	0	0	0	0	0	17269	22567	0	0	0	0	0	0	0	0	0	17675	10846	0	0	0	0	0	0	0	0	0	0	0	0	0	6579.9	9385.1	0
A0A699X846	A0A699X846_TANCI	Uncharacterized protein (Fragment)	Tci_926067	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GVACDCR	tr|A0A699X846|A0A699X846_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_926067 PE=4 SV=1	0.87979	1.378	145630	134630	67566	83921	47388	81159	145630	44315	80827	0	0	81708	0	75777	32104	76746	0	0	47355	0	0	48017	134630	29269	21515	67566	0	0	36962	39653	0	0	0	28753	0	83921	37181	33733	31038	26730	24737	47388	39272	15464	0	0	0	0	16683	0
A0A699X8F0	A0A699X8F0_TANCI	Uncharacterized protein (Fragment)	Tci_925070	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GDGARQD	tr|A0A699X8F0|A0A699X8F0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_925070 PE=4 SV=1	0.87931	1.378	378310	0	0	0	0	0	0	0	0	0	0	0	0	378310	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699XA20	A0A699XA20_TANCI	Uncharacterized protein (Fragment)	Tci_928961	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NLIPPLK	tr|A0A699XA20|A0A699XA20_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_928961 PE=4 SV=1	0.87888	1.378	0	8886.9	0	0	7239.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8886.9	7005.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7239.1	0	0	0	0	0	0	0	0
A0A699XA71	A0A699XA71_TANCI	Uncharacterized protein (Fragment)	Tci_926695	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HHGGLPR	tr|A0A699XA71|A0A699XA71_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_926695 PE=4 SV=1	0.87834	1.378	0	31799	0	26045	0	0	0	0	0	0	0	0	0	0	0	0	31799	0	0	0	0	0	19940	0	0	0	0	0	0	0	0	0	0	0	26045	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699XBJ9	A0A699XBJ9_TANCI	Uncharacterized protein (Fragment)	Tci_929008	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					IGDSQRN	tr|A0A699XBJ9|A0A699XBJ9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_929008 PE=4 SV=1	0.88268	1.378	0	612220	0	0	290780	0	0	0	0	0	0	0	0	0	0	0	0	0	612220	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	290780	0	0	0
A0A699XBY3	A0A699XBY3_TANCI	Uncharacterized protein (Fragment)	Tci_928652	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GESAPGV	tr|A0A699XBY3|A0A699XBY3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_928652 PE=4 SV=1	0.87737	1.378	0	9779.7	2764.7	14573	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9779.7	0	0	2764.7	0	0	0	0	0	0	0	14573	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699XC32	A0A699XC32_TANCI	Uncharacterized protein (Fragment)	Tci_927517	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GEEHAQR	tr|A0A699XC32|A0A699XC32_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_927517 PE=4 SV=1	0.87132	1.378	0	0	0	0	38997	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38997	0	0	0	0	0	0	0
A0A699XCR9	A0A699XCR9_TANCI	Uncharacterized protein (Fragment)	Tci_928179	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					CANAAAP	tr|A0A699XCR9|A0A699XCR9_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_928179 PE=4 SV=1	0.87088	1.378	7191	6568.4	0	0	0	0	0	0	7191	0	0	7043.8	0	0	0	0	0	0	0	6568.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699XD61	A0A699XD61_TANCI	Uncharacterized protein (Fragment)	Tci_926453	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SHGSRRR	tr|A0A699XD61|A0A699XD61_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_926453 PE=4 SV=1	0.87489	1.378	0	0	0	15394	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15394	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699XDW7	A0A699XDW7_TANCI	Uncharacterized protein (Fragment)	Tci_930064	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QQNKGHK	tr|A0A699XDW7|A0A699XDW7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_930064 PE=4 SV=1;tr|A0A699TKS9|A0A699TKS9_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=11851	0.9366	1.378	0	0	15840	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15840	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699XE28	A0A699XE28_TANCI	"Imidazole glycerol phosphate synthase hisHF, chloroplastic (Fragment)"	Tci_929928	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			catalytic activity [GO:0003824]	catalytic activity [GO:0003824]	EFHDANG	"tr|A0A699XE28|A0A699XE28_TANCI Imidazole glycerol phosphate synthase hisHF, chloroplastic (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_929928 PE=4 SV=1"	0.87495	1.378	224550	175520	0	0	37195	0	0	0	0	146460	0	0	224550	0	0	0	0	0	175520	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37195	0	0	0	0
A0A699XE55	A0A699XE55_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_929906	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	VETENSI	tr|A0A699XE55|A0A699XE55_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_929906 PE=4 SV=1	0.89055	1.378	0	0	452020	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	452020	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699XFE2	A0A699XFE2_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_929109	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	PSSSPWG	tr|A0A699XFE2|A0A699XFE2_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_929109 PE=4 SV=1;tr|A0A699X0I8|A0A699X0I8_TANCI Putative reverse transcriptase domain-containing protein (Fragm	0.88189	1.378	3757100	291680	1416700	472010	332770	24241	0	520980	21811	0	95593	563480	3757100	8619.6	0	0	0	0	0	0	0	233780	291680	127070	118540	151740	0	1416700	214490	0	164160	0	206280	148330	0	215390	0	0	472010	101920	91030	332770	11045	0	59235	28820	0	178540	0	0
A0A699XG96	A0A699XG96_TANCI	Uncharacterized protein (Fragment)	Tci_931061	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PGGDGDR	tr|A0A699XG96|A0A699XG96_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_931061 PE=4 SV=1	0.89313	1.378	244000	203100	925930	215670	27875	0	0	117910	38770	160590	0	71457	244000	40764	0	0	0	37838	90502	0	146090	0	203100	0	0	0	0	925930	222500	43924	33769	155340	20151	41001	17689	0	0	215670	0	0	0	0	0	0	0	0	0	27875	26764	21726
A0A699XGF0	A0A699XGF0_TANCI	Uncharacterized protein (Fragment)	Tci_931121	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SQGAYYL	tr|A0A699XGF0|A0A699XGF0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_931121 PE=4 SV=1	0.89134	1.378	5160.5	0	0	0	0	0	0	0	0	0	5160.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699XH21	A0A699XH21_TANCI	Uncharacterized protein (Fragment)	Tci_931018	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ARGVGGG	tr|A0A699XH21|A0A699XH21_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_931018 PE=4 SV=1	0.89092	1.378	64817	449930	106030	50846	67397	26278	64817	57973	33742	23932	0	0	21081	0	21472	64967	40104	449930	45610	122500	37035	86729	0	36701	81804	0	0	0	44007	63518	106030	15347	29503	20216	0	50846	0	0	0	37080	38871	0	0	12903	36773	5483.6	66248	67397	55459	0
A0A699XI76	A0A699XI76_TANCI	Uncharacterized protein (Fragment)	Tci_929667	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HADSTGS	tr|A0A699XI76|A0A699XI76_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_929667 PE=4 SV=1	0.88503	1.378	0	0	0	10364	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10364	0	0	0	0	0	0	0	0	0	0	0
A0A699XJC5	A0A699XJC5_TANCI	Uncharacterized protein (Fragment)	Tci_931262	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QMPSGGT	tr|A0A699XJC5|A0A699XJC5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_931262 PE=4 SV=1	0.88803	1.378	0	0	118000	116970	113000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	113130	118000	0	0	0	0	0	0	0	0	0	70392	70966	0	116970	113000	86455	0	0	0	0	0	0	0
A0A699XLF8	A0A699XLF8_TANCI	Uncharacterized protein (Fragment)	Tci_932042	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					WTATSAS	tr|A0A699XLF8|A0A699XLF8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_932042 PE=4 SV=1	0.87446	1.378	0	0	0	49378	31857	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18056	0	0	0	0	0	49378	0	0	0	0	0	0	0	0	0	31857	0
A0A699XLW4	A0A699XLW4_TANCI	Uncharacterized protein (Fragment)	Tci_929423	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GGGGGEG	tr|A0A699XLW4|A0A699XLW4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_929423 PE=4 SV=1	0.87877	1.378	0	0	0	0	3279.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3279.6	0	0	0	0	0	0	0
A0A699XMK4	A0A699XMK4_TANCI	Dammarenediol II synthase-like (Fragment)	Tci_932442	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LNILFQR	tr|A0A699XMK4|A0A699XMK4_TANCI Dammarenediol II synthase-like (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_932442 PE=4 SV=1;tr|A0A699QE19|A0A699QE19_TANCI Ribonuclease H OS=Tanacetum cinerariifolium OX=118510 GN=Tci_838234 PE=4 SV=1;tr|A0A6L2LA	0.80148	1.378	0	0	0	0	2132.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2132.4	0	0	0	0	0	0	0
A0A699XMK8	A0A699XMK8_TANCI	Uncharacterized protein (Fragment)	Tci_932886	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TYTDSWE	tr|A0A699XMK8|A0A699XMK8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_932886 PE=4 SV=1	0.9097	1.378	0	0	0	0	6814.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6814.8	0	0	0	0	0
A0A699XN15	A0A699XN15_TANCI	Uncharacterized protein (Fragment)	Tci_931215	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DEENDDG	tr|A0A699XN15|A0A699XN15_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_931215 PE=4 SV=1	0.90578	1.378	0	0	27302	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27302	0	0	0	0	0	0	17641	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699XNB3	A0A699XNB3_TANCI	Uncharacterized protein (Fragment)	Tci_933258	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RALEPRR	tr|A0A699XNB3|A0A699XNB3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_933258 PE=4 SV=1	0.89662	1.378	0	6812.6	0	0	7602.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6812.6	5981.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7602.7	0	0	0	0	0	0	0
A0A699XNP1	A0A699XNP1_TANCI	Uncharacterized protein (Fragment)	Tci_931849	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					AGGGCQA	tr|A0A699XNP1|A0A699XNP1_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_931849 PE=4 SV=1	0.89747	1.378	0	0	5095.5	61798	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5095.5	0	0	0	0	0	0	7920	0	0	61798	0	0	0	0	0	0	0	0	0	0	0
A0A699XPI3	A0A699XPI3_TANCI	Uncharacterized protein (Fragment)	Tci_933688	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PGVPDVP	tr|A0A699XPI3|A0A699XPI3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_933688 PE=4 SV=1;tr|A0A699V5X8|A0A699V5X8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_901230 PE=4 SV=	0.76092	1.378	12489	31986	41558	33694	11121	0	7274.7	9698.9	0	0	0	0	12489	0	31986	22887	26398	0	0	0	0	0	0	27789	9082.1	12097	0	0	14400	0	0	41558	0	0	0	13722	11040	13143	10904	33694	13526	0	0	0	0	6320.2	6911.9	11121	8021.3	0
A0A699XQH4	A0A699XQH4_TANCI	Uncharacterized protein (Fragment)	Tci_933532	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GCNSDES	tr|A0A699XQH4|A0A699XQH4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_933532 PE=4 SV=1;tr|A0A699VLK4|A0A699VLK4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_908461 PE=4 SV=	0.82667	1.378	0	0	2589.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2589.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699XRT0	A0A699XRT0_TANCI	Uncharacterized protein (Fragment)	Tci_933039	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DEASKDD	tr|A0A699XRT0|A0A699XRT0_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_933039 PE=4 SV=1	0.82073	1.378	0	0	0	0	42169	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42169	0	0	0	0	0
A0A699XUJ7	A0A699XUJ7_TANCI	Uncharacterized protein (Fragment)	Tci_934992	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GHAANTS	tr|A0A699XUJ7|A0A699XUJ7_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_934992 PE=4 SV=1;tr|A0A699WJ07|A0A699WJ07_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_916353 PE=4 SV=	0.7652	1.378	0	0	18397	11921	8643.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18397	17045	0	0	0	0	0	0	11921	0	0	0	0	0	0	8643.9	0	0	1235.5	0	0	0	0	0
A0A699XV00	A0A699XV00_TANCI	Uncharacterized protein (Fragment)	Tci_931783	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VGAGAAA	tr|A0A699XV00|A0A699XV00_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_931783 PE=4 SV=1	0.81522	1.378	88619	256820	28754	68937	62736	0	0	0	88619	40008	0	27874	0	0	27703	0	0	0	0	256820	0	54561	39869	0	0	0	0	0	0	0	0	28754	10842	0	0	0	68937	0	21887	0	17221	0	62736	0	0	0	0	2367.7	0	0
A0A699XVM2	A0A699XVM2_TANCI	Uncharacterized protein (Fragment)	Tci_934419	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NDGEDQV	tr|A0A699XVM2|A0A699XVM2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_934419 PE=4 SV=1	0.82648	1.378	0	0	24320	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24320	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699XWN2	A0A699XWN2_TANCI	Uncharacterized protein (Fragment)	Tci_935692	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SGEEHGG	tr|A0A699XWN2|A0A699XWN2_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_935692 PE=4 SV=1	0.86439	1.378	50881	37038	7401.5	31918	27238	38511	35411	22266	0	0	0	0	50881	0	37038	0	12044	0	0	0	0	0	0	0	4394.9	0	0	0	0	0	0	7401.5	0	27256	0	31918	0	0	0	0	0	0	0	0	0	10424	0	27238	21262	0
A0A699XY00	A0A699XY00_TANCI	Uncharacterized protein (Fragment)	Tci_933700	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					AEGNAAG	tr|A0A699XY00|A0A699XY00_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_933700 PE=4 SV=1;tr|A0A699V4F4|A0A699V4F4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_900750 PE=4 SV=	0.9006	1.378	16696	12300	13653	12966	0	0	0	10248	0	0	0	0	16696	0	0	0	0	0	0	0	12300	10733	0	0	6438.2	0	0	0	0	13653	0	0	0	0	0	12966	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699XY12	A0A699XY12_TANCI	Uncharacterized protein (Fragment)	Tci_934665	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ESDDDSGERDDDDSEDK	tr|A0A699XY12|A0A699XY12_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_934665 PE=4 SV=1	0.87636	1.378	31213	20878	67535	32275	0	0	0	0	0	0	31213	0	0	0	0	0	0	0	0	20878	0	0	0	0	0	0	0	67535	0	0	0	0	0	0	32275	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699XY64	A0A699XY64_TANCI	Uncharacterized protein (Fragment)	Tci_932673	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GAIGESM	tr|A0A699XY64|A0A699XY64_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_932673 PE=4 SV=1	0.87273	1.378	0	0	0	0	9581.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9581.2	0
A0A699XZC1	A0A699XZC1_TANCI	"Zinc finger, CCHC-type, retrotransposon Gag domain protein (Fragment)"	Tci_934090	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EIWPLMA	"tr|A0A699XZC1|A0A699XZC1_TANCI Zinc finger, CCHC-type, retrotransposon Gag domain protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_934090 PE=4 SV=1"	0.85739	1.378	8137.3	0	6245.1	0	0	8137.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6245.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A699XZZ4	A0A699XZZ4_TANCI	Uncharacterized protein (Fragment)	Tci_935659	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EGGEQAS	tr|A0A699XZZ4|A0A699XZZ4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_935659 PE=4 SV=1;tr|A0A699XRR3|A0A699XRR3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_934518 PE=4 SV=	0.78783	1.378	0	0	0	4708.1	4383.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4708.1	0	0	0	0	0	0	0	0	4383.6	0	0	0	0	0	0
A0A699YAN1	A0A699YAN1_TANCI	Uncharacterized protein (Fragment)	Tci_935583	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LGDVADN	tr|A0A699YAN1|A0A699YAN1_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_935583 PE=4 SV=1	0.92875	1.378	0	66635	62736	0	0	0	0	0	0	0	0	0	0	0	54780	0	66635	0	0	0	0	0	0	34486	26789	62736	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2J1Y4	A0A6L2J1Y4_TANCI	Uncharacterized protein	Tci_003001	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VKPVMKR	tr|A0A6L2J1Y4|A0A6L2J1Y4_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_003001 PE=4 SV=1	0.83653	1.378	0	0	4878.7	1890	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4878.7	0	0	0	0	0	0	1890	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2J4N6	A0A6L2J4N6_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_003690	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	ARLVVKR	tr|A0A6L2J4N6|A0A6L2J4N6_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_003690 PE=4 SV=1;tr|A0A699GW69|A0A699GW69_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118	0.83077	2.1255	0	20379	0	18232	23985	0	0	0	0	0	0	0	0	0	0	0	20379	0	0	0	16309	0	0	0	0	0	0	0	0	0	0	0	0	0	18232	0	0	0	0	15634	0	0	23985	0	0	0	13650	0	0	0
A0A6L2J5G6	A0A6L2J5G6_TANCI	Reverse transcriptase domain-containing protein	Tci_003765	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	DPGEAAM	tr|A0A6L2J5G6|A0A6L2J5G6_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_003765 PE=4 SV=1	0.93924	1.378	24824	11792	18836	0	3298.6	0	0	0	16491	17121	0	24824	0	9263.9	0	0	11792	0	0	0	0	0	0	0	0	0	0	0	0	18836	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3298.6
A0A6L2J668	A0A6L2J668_TANCI	Probable linoleate 9S-lipoxygenase 5	Tci_004170	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KTGVNGM	tr|A0A6L2J668|A0A6L2J668_TANCI Probable linoleate 9S-lipoxygenase 5 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_004170 PE=4 SV=1	0.94367	1.378	16361	117010	10871	8703.3	47030	0	0	0	0	12037	0	0	16361	0	9960.4	0	0	0	0	0	0	117010	56544	0	0	0	0	0	0	10871	0	0	0	0	0	8703.3	0	0	0	0	0	0	0	43852	0	0	0	47030	0	42607
A0A6L2J6D6	A0A6L2J6D6_TANCI	Reverse transcriptase domain-containing protein	Tci_004429	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	AKGRLSLTK	tr|A0A6L2J6D6|A0A6L2J6D6_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_004429 PE=4 SV=1	0.92808	1.378	0	33203	0	17049	0	0	0	0	0	0	0	0	0	0	0	0	33203	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14508	11653	17049	0	0	0	0	0	0	0	0	0	0
A0A6L2J6M9	A0A6L2J6M9_TANCI	Reverse transcriptase domain-containing protein	Tci_003623	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	FGYNLCM	tr|A0A6L2J6M9|A0A6L2J6M9_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_003623 PE=4 SV=1	0.92819	1.378	64852	0	0	0	71756	0	64852	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	71756	0	0	0
A0A6L2J6W3	A0A6L2J6W3_TANCI	Zf-CCHC domain-containing protein/DUF4219 domain-containing protein/UBN2 domain-containing protein	Tci_004390	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GFLKIFK	tr|A0A6L2J6W3|A0A6L2J6W3_TANCI Zf-CCHC domain-containing protein/DUF4219 domain-containing protein/UBN2 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_004390 PE=4 SV=1	0.92777	1.378	19845	0	19778	0	0	0	0	0	0	0	19845	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19778	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2J723	A0A6L2J723_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_004786	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	FTDNDRK	tr|A0A6L2J723|A0A6L2J723_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_004786 PE=4 SV=1	0.92605	1.378	27743	0	0	0	36631	0	0	20965	27743	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27316	36631	36027
A0A6L2J7R6	A0A6L2J7R6_TANCI	Ribonuclease H-like domain-containing protein	Tci_005036	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TASMCQR	tr|A0A6L2J7R6|A0A6L2J7R6_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_005036 PE=4 SV=1	0.93498	1.378	0	0	67702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	67702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JA39	A0A6L2JA39_TANCI	Putative reverse transcriptase domain-containing protein	Tci_005345	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	DDDDCDK	tr|A0A6L2JA39|A0A6L2JA39_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_005345 PE=4 SV=1	0.9418	1.378	27349	0	38262	10945	30981	19283	0	0	0	0	0	0	27349	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38262	0	10945	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30981	0
A0A6L2JAI0	A0A6L2JAI0_TANCI	Ribonuclease H-like domain-containing protein	Tci_004963	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MMNWLDK	tr|A0A6L2JAI0|A0A6L2JAI0_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_004963 PE=4 SV=1	0.92646	1.378	0	292930	0	16451	197940	0	0	0	0	0	0	0	0	0	292930	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16451	0	0	0	0	0	0	0	0	0	197940	0	0	0	0	0	0
A0A6L2JD15	A0A6L2JD15_TANCI	Uncharacterized protein	Tci_006425	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	protein glycosylation [GO:0006486]		glycosyltransferase activity [GO:0016757]; protein glycosylation [GO:0006486]	glycosyltransferase activity [GO:0016757]	VQICFSR	tr|A0A6L2JD15|A0A6L2JD15_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_006425 PE=4 SV=1	0.92688	1.378	4074.1	0	0	0	0	0	0	0	0	0	4074.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JE34	A0A6L2JE34_TANCI	Uncharacterized protein	Tci_007219	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PKPLIAR	tr|A0A6L2JE34|A0A6L2JE34_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_007219 PE=4 SV=1	0.94673	1.378	20680	39361	18217	0	29256	0	20680	0	0	0	0	0	0	0	39361	0	0	0	0	20417	0	0	0	0	0	18217	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7126.3	29256	0	0	0	0
A0A6L2JE89	A0A6L2JE89_TANCI	Copia protein	Tci_007028	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	YSSRSKK	tr|A0A6L2JE89|A0A6L2JE89_TANCI Copia protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_007028 PE=4 SV=1	0.94243	1.378	50819	20599	0	2896700	18720	0	0	0	50819	11400	0	0	0	0	0	0	0	0	20599	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2896700	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18720
A0A6L2JFN3	A0A6L2JFN3_TANCI	Vacuolar iron transporter homolog 4-like	Tci_007779	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	cellular manganese ion homeostasis [GO:0030026]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; manganese ion transmembrane transporter activity [GO:0005384]; cellular manganese ion homeostasis [GO:0030026]	manganese ion transmembrane transporter activity [GO:0005384]	SLLHLVK	tr|A0A6L2JFN3|A0A6L2JFN3_TANCI Vacuolar iron transporter homolog 4-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_007779 PE=3 SV=1	0.9441	1.378	0	0	20307	18859	24713	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20307	0	0	0	0	0	0	0	0	0	0	0	18859	0	0	0	24713	0	0	0	14864	0	0	0
A0A6L2JG41	A0A6L2JG41_TANCI	CCHC-type domain-containing protein	Tci_007909	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	GSHSSDK	tr|A0A6L2JG41|A0A6L2JG41_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_007909 PE=4 SV=1	0.94501	1.378	53292	20811	38566	7348.3	14636	53292	16289	0	11272	15467	0	0	0	0	0	0	0	0	0	0	0	20811	0	0	0	0	0	0	0	20595	38566	0	7348.3	0	0	0	0	0	0	0	0	14636	0	8426.2	0	0	0	0	0	0
A0A6L2JGN4	A0A6L2JGN4_TANCI	Integrase catalytic domain-containing protein	Tci_008146	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	FFRRLLK	tr|A0A6L2JGN4|A0A6L2JGN4_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_008146 PE=4 SV=1	0.93413	1.378	9623.4	8299.3	7249.2	10706	7610.7	0	0	0	0	0	0	0	9623.4	0	0	0	8299.3	0	0	0	0	0	0	7249.2	0	0	0	0	0	0	0	0	0	0	0	0	0	7647.6	0	10706	0	0	0	0	0	0	7610.7	0	0	0
A0A6L2JGZ8	A0A6L2JGZ8_TANCI	"Zinc finger, CCHC-type"	Tci_007940	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	CDGDLIM	"tr|A0A6L2JGZ8|A0A6L2JGZ8_TANCI Zinc finger, CCHC-type OS=Tanacetum cinerariifolium OX=118510 GN=Tci_007940 PE=4 SV=1"	0.93586	1.378	0	153610	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	153610	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JJ26	A0A6L2JJ26_TANCI	Putative reverse transcriptase domain-containing protein	Tci_009001	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	ILLPRHK	tr|A0A6L2JJ26|A0A6L2JJ26_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_009001 PE=4 SV=1	0.85229	1.378	2236.6	0	2223.2	4453.4	0	0	0	0	0	0	0	0	2236.6	0	0	0	0	0	0	0	0	0	0	2223.2	0	0	0	0	0	0	0	0	0	0	0	0	0	4453.4	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JJ41	A0A6L2JJ41_TANCI	Ubiquitin hydrolase	Tci_008670	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			hydrolase activity [GO:0016787]; nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	hydrolase activity [GO:0016787]; nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	FTSATPK	tr|A0A6L2JJ41|A0A6L2JJ41_TANCI Ubiquitin hydrolase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_008670 PE=4 SV=1	0.85185	1.378	20099	0	8942.2	7955.6	10731	0	0	0	20099	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6803.6	0	0	0	0	8942.2	0	0	7681.2	0	0	7955.6	0	0	0	0	0	0	0	0	0	0	0	0	0	10731
A0A6L2JJE2	A0A6L2JJE2_TANCI	Uncharacterized protein	Tci_009121	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GHPNLVM	tr|A0A6L2JJE2|A0A6L2JJE2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_009121 PE=4 SV=1	0.85714	1.378	0	5381.4	0	0	3737.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5381.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3737.2	0	0	0	0	0	0	0	0
A0A6L2JJH6	A0A6L2JJH6_TANCI	Monodehydroascorbate reductase	Tci_009151	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TNKVECYWNMFTTMRDK	tr|A0A6L2JJH6|A0A6L2JJH6_TANCI Monodehydroascorbate reductase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_009151 PE=4 SV=1	0.92537	1.378	0	0	20226	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20226	16103	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JKB7	A0A6L2JKB7_TANCI	Integrase catalytic domain-containing protein	Tci_009451	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	EACRVSK	tr|A0A6L2JKB7|A0A6L2JKB7_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_009451 PE=4 SV=1	0.84877	1.378	0	0	13065	0	13366	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13065	0	0	0	0	0	0	0	0	0	0	0	0	0	13366	0	0	0	0	0	0	0	0
A0A6L2JKI8	A0A6L2JKI8_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_009095	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	LSQRHSNK	tr|A0A6L2JKI8|A0A6L2JKI8_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_009095 PE=4 SV=1	0.91954	1.6832	5093.2	15104	13711	9326.2	10121	0	3873.3	0	0	0	0	0	1821.1	5093.2	3299.3	15104	0	6369.9	5414.4	0	10432	0	0	0	3631.5	13711	0	0	0	0	12586	0	0	3381	0	0	0	0	9326.2	0	3477.1	0	0	10121	0	0	0	0	0	0
A0A6L2JKU6	A0A6L2JKU6_TANCI	Uncharacterized protein	Tci_009631	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QLILPVK	tr|A0A6L2JKU6|A0A6L2JKU6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_009631 PE=4 SV=1	0.84353	1.378	0	0	13905	11814	2670400	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13905	0	0	0	0	0	0	0	0	0	0	11814	0	2670400	0	0	0	0	0	0	0	0
A0A6L2JLB9	A0A6L2JLB9_TANCI	Ubiquitin-like-specific protease ESD4	Tci_009450	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			peptidase activity [GO:0008233]	peptidase activity [GO:0008233]	MECEWFM	tr|A0A6L2JLB9|A0A6L2JLB9_TANCI Ubiquitin-like-specific protease ESD4 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_009450 PE=4 SV=1	0.84785	1.378	0	0	0	23846	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23846	0	0	0	0	0	0	0	0	0	0
A0A6L2JMA5	A0A6L2JMA5_TANCI	Reverse transcriptase Ty1/copia-type domain-containing protein	Tci_009770	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KIVRVLHSK	tr|A0A6L2JMA5|A0A6L2JMA5_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_009770 PE=4 SV=1	0.8676	1.378	3025.3	0	0	0	0	0	0	0	0	0	0	0	3025.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JN08	A0A6L2JN08_TANCI	Uncharacterized protein	Tci_010168	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SSSEEAR	tr|A0A6L2JN08|A0A6L2JN08_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_010168 PE=4 SV=1;tr|A0A124SBX7|A0A124SBX7_CYNCS Lecithin:cholesterol/phospholipid:diacylglycerol acyltransferase OS=Cynara cardunculus var. scolymus OX=598	0.87743	1.378	0	37966	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37966	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JN72	A0A6L2JN72_TANCI	Reverse transcriptase domain-containing protein	Tci_010045	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	NGMMPPM	tr|A0A6L2JN72|A0A6L2JN72_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_010045 PE=4 SV=1	0.8671	1.378	0	0	0	0	40182	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	40182
A0A6L2JNZ5	A0A6L2JNZ5_TANCI	"Retrotransposon protein, putative, unclassified"	Tci_010498	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					FGDQCVK	"tr|A0A6L2JNZ5|A0A6L2JNZ5_TANCI Retrotransposon protein, putative, unclassified OS=Tanacetum cinerariifolium OX=118510 GN=Tci_010498 PE=4 SV=1"	0.86907	1.378	0	0	0	0	19393	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19393	0	0
A0A6L2JQ15	A0A6L2JQ15_TANCI	Uncharacterized protein	Tci_011041	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VVGCRHK	tr|A0A6L2JQ15|A0A6L2JQ15_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_011041 PE=4 SV=1	0.86278	1.378	12909	17994	11957	13861	10281	0	0	0	11744	12909	0	0	0	11453	0	0	0	10081	17994	0	0	0	0	0	8268.8	0	0	0	0	11957	0	0	11866	13861	0	13094	0	0	0	0	0	0	0	0	0	0	0	0	10281	0
A0A6L2JQW1	A0A6L2JQW1_TANCI	RNA-directed RNA polymerase (EC 2.7.7.48)	Tci_010945	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	gene silencing by RNA [GO:0031047]		RNA binding [GO:0003723]; RNA-directed 5'-3' RNA polymerase activity [GO:0003968]; gene silencing by RNA [GO:0031047]	RNA binding [GO:0003723]; RNA-directed 5'-3' RNA polymerase activity [GO:0003968]	AMNMRDR	tr|A0A6L2JQW1|A0A6L2JQW1_TANCI RNA-directed RNA polymerase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_010945 PE=3 SV=1	0.86103	1.378	26916	25782	0	0	0	0	0	0	0	0	0	0	26916	0	0	25782	25567	0	0	0	0	0	19259	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JRJ9	A0A6L2JRJ9_TANCI	Reverse transcriptase domain-containing protein	Tci_011581	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	VEDNGEM	tr|A0A6L2JRJ9|A0A6L2JRJ9_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_011581 PE=4 SV=1	0.84264	1.378	0	0	0	22233	11111	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22233	0	0	0	0	0	0	11111	0	0	0	0	0
A0A6L2JS08	A0A6L2JS08_TANCI	Reverse transcriptase Ty1/copia-type domain-containing protein	Tci_010603	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DSCCCYK	tr|A0A6L2JS08|A0A6L2JS08_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_010603 PE=4 SV=1	0.82626	1.378	0	0	10931	11470	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10931	6744.9	11470	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JSB7	A0A6L2JSB7_TANCI	Uncharacterized protein	Tci_010482	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GDNENQNGNGGNGNEGR	tr|A0A6L2JSB7|A0A6L2JSB7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_010482 PE=4 SV=1	0.89617	1.378	0	0	0	0	21048	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21048	0	0	0	0	0	0	0	0
A0A6L2JSP5	A0A6L2JSP5_TANCI	Ribonuclease H-like domain-containing protein	Tci_012024	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		CTSDLWR	tr|A0A6L2JSP5|A0A6L2JSP5_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_012024 PE=4 SV=1	0.82673	1.378	10410	11369	13087	0	0	0	0	0	0	0	0	0	10410	0	0	0	0	0	0	0	0	0	11369	0	0	0	0	0	0	0	0	13087	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JT22	A0A6L2JT22_TANCI	Putative reverse transcriptase domain-containing protein	Tci_011878	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	EAVPVVR	tr|A0A6L2JT22|A0A6L2JT22_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_011878 PE=4 SV=1	0.89552	1.378	0	0	0	5806.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5806.1	0	0	0	0	0	0	0	0	0	0
A0A6L2JT84	A0A6L2JT84_TANCI	Uncharacterized protein	Tci_012259	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SSDVHRR	tr|A0A6L2JT84|A0A6L2JT84_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_012259 PE=4 SV=1	0.82773	1.378	0	0	29638	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29638	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JTG6	A0A6L2JTG6_TANCI	Uncharacterized protein	Tci_012264	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	LKSLVAIESK	tr|A0A6L2JTG6|A0A6L2JTG6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_012264 PE=4 SV=1	0.8272	1.378	0	0	0	1328.9	832.79	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1328.9	0	0	0	0	0	0	0	0	0	0	0	832.79	0
A0A6L2JTT3	A0A6L2JTT3_TANCI	Uncharacterized mitochondrial protein AtMg00810-like	Tci_011223	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	FACACRR	tr|A0A6L2JTT3|A0A6L2JTT3_TANCI Uncharacterized mitochondrial protein AtMg00810-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_011223 PE=4 SV=1	0.82644	1.378	11943	0	0	0	0	0	0	0	6686.2	11943	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JU69	A0A6L2JU69_TANCI	CCHC-type domain-containing protein	Tci_012130	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	LIKPPAR	tr|A0A6L2JU69|A0A6L2JU69_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_012130 PE=4 SV=1;tr|A0A699JFR3|A0A699JFR3_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_606098 PE=4 SV	0.825	2.3659	0	0	29164	17120	56016	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29164	0	0	0	0	0	0	0	0	17120	0	0	0	0	0	0	0	56016	0	0	0	0	0	0	0
A0A6L2JU90	A0A6L2JU90_TANCI	Uncharacterized protein	Tci_011393	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SPPAGIR	tr|A0A6L2JU90|A0A6L2JU90_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_011393 PE=4 SV=1	0.81756	1.378	21757	22642	22194	25606	20264	21757	19158	0	0	0	0	0	0	0	18753	0	22642	0	0	0	0	0	21588	22194	0	21878	0	0	0	0	0	0	0	0	0	20342	22813	0	25606	0	0	0	0	0	0	0	0	18303	20264	0
A0A6L2JUG9	A0A6L2JUG9_TANCI	Ribonuclease H-like domain-containing protein	Tci_012709	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	VLLSFLK	tr|A0A6L2JUG9|A0A6L2JUG9_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_012709 PE=4 SV=1	0.81612	1.378	10992	27474	0	0	0	0	0	10992	0	0	0	0	0	0	0	0	27474	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JUV0	A0A6L2JUV0_TANCI	Uncharacterized mitochondrial protein AtMg00810-like	Tci_012340	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KHLKVVK	tr|A0A6L2JUV0|A0A6L2JUV0_TANCI Uncharacterized mitochondrial protein AtMg00810-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_012340 PE=4 SV=1;tr|A0A6L2LRZ2|A0A6L2LRZ2_TANCI Reverse transcriptase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_035695 PE=	0.88725	1.378	0	1337.3	0	0	0	0	0	0	0	0	0	0	0	0	0	1337.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JV83	A0A6L2JV83_TANCI	Copia protein	Tci_012969	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VMSSGKR	tr|A0A6L2JV83|A0A6L2JV83_TANCI Copia protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_012969 PE=4 SV=1	0.88837	1.378	0	13982	0	5050.4	0	0	0	0	0	0	0	0	0	0	13982	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5050.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JVJ8	A0A6L2JVJ8_TANCI	Integrase catalytic domain-containing protein	Tci_013041	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	VYVCFDASYGLFFGTDK	tr|A0A6L2JVJ8|A0A6L2JVJ8_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_013041 PE=4 SV=1	0.88372	1.378	0	0	0	15043	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15043	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JWB4	A0A6L2JWB4_TANCI	gag_pre-integrs domain-containing protein (Fragment)	Tci_011882	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	CATLHRK	tr|A0A6L2JWB4|A0A6L2JWB4_TANCI gag_pre-integrs domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_011882 PE=4 SV=1	0.8867	1.378	0	26201	18595	34476	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26201	0	0	0	0	0	13535	0	0	0	0	18595	0	0	0	34476	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JWI5	A0A6L2JWI5_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_012213	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EHSGHER	tr|A0A6L2JWI5|A0A6L2JWI5_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_012213 PE=4 SV=1;tr|A0A6L2JU53|A0A6L2JU53_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetu	0.81847	1.378	7898.8	0	0	0	5701.3	7898.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5701.3	0	0	0	0	0
A0A6L2JWV4	A0A6L2JWV4_TANCI	Uncharacterized protein	Tci_013579	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ARLIGFK	tr|A0A6L2JWV4|A0A6L2JWV4_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_013579 PE=4 SV=1	0.83593	1.378	0	0	10160	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10160	0	0	0	0	0	9308.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JX29	A0A6L2JX29_TANCI	Zf-CCHC domain-containing protein/UBN2 domain-containing protein	Tci_013636	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	TTLLKKK	tr|A0A6L2JX29|A0A6L2JX29_TANCI Zf-CCHC domain-containing protein/UBN2 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_013636 PE=4 SV=1	0.83222	1.378	13424	0	11962	0	0	0	0	0	13424	10444	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11962	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JX83	A0A6L2JX83_TANCI	Uncharacterized protein	Tci_013268	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					WGGKIVK	tr|A0A6L2JX83|A0A6L2JX83_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_013268 PE=4 SV=1	0.82841	1.378	0	0	16000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JXD1	A0A6L2JXD1_TANCI	Reverse transcriptase domain-containing protein	Tci_013756	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	ITYFENMK	tr|A0A6L2JXD1|A0A6L2JXD1_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_013756 PE=4 SV=1	0.88506	1.7035	2983.6	0	0	0	0	2983.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2JXJ4	A0A6L2JXJ4_TANCI	Uncharacterized protein	Tci_012563	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					CNCTGYM	tr|A0A6L2JXJ4|A0A6L2JXJ4_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_012563 PE=4 SV=1	0.83408	1.378	39452	16478	19414	23867	20072	0	17237	0	7214.4	14770	0	39452	0	0	0	0	0	0	9952.9	0	0	0	16478	0	0	0	0	0	0	19414	6305.3	0	0	23867	0	9371.5	0	0	3512.9	0	0	0	0	0	0	0	0	20072	0	0
A0A6L2JY75	A0A6L2JY75_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_013677	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; potassium ion transmembrane transporter activity [GO:0015079]; RNA-directed DNA polymerase activity [GO:0003964]	potassium ion transmembrane transporter activity [GO:0015079]; RNA-directed DNA polymerase activity [GO:0003964]	SMLWRIR	tr|A0A6L2JY75|A0A6L2JY75_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_013677 PE=3 SV=1	0.83133	1.378	11619	16847	16543	16273	0	0	0	0	0	0	0	0	11619	0	0	0	15923	0	0	0	0	0	16847	16543	0	0	0	0	0	10387	0	0	0	0	0	0	0	0	16273	13777	16175	0	0	0	0	0	0	0	0	0
A0A6L2JYW2	A0A6L2JYW2_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment)	Tci_014184	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	YTIKSTNNVALKEYDLK	tr|A0A6L2JYW2|A0A6L2JYW2_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_014184 PE=4 SV=1	0.895	1.378	13373	25828	0	14144	12112	0	9717.1	6870.9	0	0	0	0	13373	0	13293	0	0	25828	0	0	0	7987.9	15429	0	0	0	0	0	0	0	0	0	0	0	0	14142	0	0	0	0	14144	0	0	0	0	0	0	12112	0	0
A0A6L2JZY9	A0A6L2JZY9_TANCI	Uncharacterized protein	Tci_014050	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RDGLSHK	tr|A0A6L2JZY9|A0A6L2JZY9_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_014050 PE=4 SV=1	0.89364	1.378	0	0	12033	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12033	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2K005	A0A6L2K005_TANCI	RT_RNaseH_2 domain-containing protein	Tci_014604	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	VQLSPER	"tr|A0A6L2K005|A0A6L2K005_TANCI RT_RNaseH_2 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_014604 PE=4 SV=1;tr|A0A6L2JY64|A0A6L2JY64_TANCI RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein OS="	0.8871	1.378	0	3101600	0	4404600	7562300	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3101600	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4404600	0	0	0	7562300	0	4500200	0	0	0	7118500
A0A6L2K0I0	A0A6L2K0I0_TANCI	Pentatricopeptide repeat-containing protein At2g34400	Tci_014791	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NFPMNEFVQLAHDVTGK	tr|A0A6L2K0I0|A0A6L2K0I0_TANCI Pentatricopeptide repeat-containing protein At2g34400 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_014791 PE=4 SV=1;tr|A0A2U1Q940|A0A2U1Q940_ARTAN Pentatricopeptide repeat (PPR-like) superfamily protein OS=Artemisia annua OX	0.90625	1.378	0	0	0	57487	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	57487	0	0	0	0	0	0	0	0	0	0
A0A6L2K0Y6	A0A6L2K0Y6_TANCI	DNA-directed DNA polymerase	Tci_014508	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			DNA-directed DNA polymerase activity [GO:0003887]; nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	DNA-directed DNA polymerase activity [GO:0003887]; nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	NILNQAR	tr|A0A6L2K0Y6|A0A6L2K0Y6_TANCI DNA-directed DNA polymerase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_014508 PE=4 SV=1	0.92052	1.378	0	0	0	0	5968500	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5968500	0	0
A0A6L2K1W6	A0A6L2K1W6_TANCI	Integrase catalytic domain-containing protein	Tci_015007	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	KTKNSLLLR	tr|A0A6L2K1W6|A0A6L2K1W6_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_015007 PE=4 SV=1	0.91026	1.378	0	0	0	0	145040	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	145040	0	0	0	0	0
A0A6L2K251	A0A6L2K251_TANCI	Ribonuclease H-like domain-containing protein	Tci_014113	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	PVAFEDR	tr|A0A6L2K251|A0A6L2K251_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_014113 PE=4 SV=1;tr|A0A6L2MB12|A0A6L2MB12_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_043	0.88903	1.378	11748	0	0	17623	12673	0	0	11748	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17623	0	0	0	0	0	12673	0	0	0	0	0	0
A0A6L2K278	A0A6L2K278_TANCI	Uncharacterized protein (Fragment)	Tci_015449	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					FKTYDEYKDAWIYEWNK	tr|A0A6L2K278|A0A6L2K278_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_015449 PE=4 SV=1	0.88945	1.378	37591	50380	0	0	10490	37591	0	0	0	0	0	0	0	0	0	0	0	50380	38795	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8209.7	0	0	0	10490	0
A0A6L2K2D2	A0A6L2K2D2_TANCI	Uncharacterized protein	Tci_014940	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PPSAQPK	tr|A0A6L2K2D2|A0A6L2K2D2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_014940 PE=4 SV=1	0.88071	1.378	17147	10627	0	0	0	0	0	0	0	0	0	17147	0	0	0	0	0	0	10627	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2K2E7	A0A6L2K2E7_TANCI	CCHC-type domain-containing protein (Fragment)	Tci_015474	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	RPAKDPR	tr|A0A6L2K2E7|A0A6L2K2E7_TANCI CCHC-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_015474 PE=4 SV=1	0.87397	1.378	0	0	4348.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4348.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2K2Y6	A0A6L2K2Y6_TANCI	Uncharacterized protein	Tci_014212	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PNAAVLK	tr|A0A6L2K2Y6|A0A6L2K2Y6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_014212 PE=4 SV=1	0.89109	1.378	0	9017.1	2619	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9017.1	0	0	0	0	0	2619	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2K3G3	A0A6L2K3G3_TANCI	Uncharacterized protein	Tci_015245	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GGENGGR	tr|A0A6L2K3G3|A0A6L2K3G3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_015245 PE=4 SV=1;tr|A0A6L2JGI3|A0A6L2JGI3_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_006983 PE=4 SV=	0.74194	2.756	0	0	0	40737	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	40737	5264.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2K3S9	A0A6L2K3S9_TANCI	Reverse transcriptase domain-containing protein	Tci_014693	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QDGGVER	tr|A0A6L2K3S9|A0A6L2K3S9_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_014693 PE=4 SV=1	0.88988	1.378	0	8874.7	0	18785	0	0	0	0	0	0	0	0	0	0	0	0	8874.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18785	0	0	0	0	0	0	0	0	0	0
A0A6L2K442	A0A6L2K442_TANCI	CCHC-type domain-containing protein	Tci_015757	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	YIEFRIDMIPGAFPVVK	tr|A0A6L2K442|A0A6L2K442_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_015757 PE=4 SV=1	0.88038	1.378	0	15586	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15586	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2K4W8	A0A6L2K4W8_TANCI	Ribonuclease H-like domain-containing protein	Tci_015828	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SHQTAGGYDNKDLRYFR	tr|A0A6L2K4W8|A0A6L2K4W8_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_015828 PE=4 SV=1	0.86932	1.378	0	0	0	18397	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18397	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2K5L5	A0A6L2K5L5_TANCI	Uncharacterized protein	Tci_016108	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ATMVEQM	tr|A0A6L2K5L5|A0A6L2K5L5_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_016108 PE=4 SV=1	0.90083	1.378	0	45922	10822	17719	8456.7	0	0	0	0	0	0	0	0	0	0	34619	0	0	0	0	45922	0	0	0	10822	0	0	0	0	0	8617.8	0	0	0	0	0	0	0	0	17719	0	0	0	0	0	8456.7	0	0	0	0
A0A6L2K5M3	A0A6L2K5M3_TANCI	Ankyrin repeat-containing protein	Tci_015142	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	PILKKYK	tr|A0A6L2K5M3|A0A6L2K5M3_TANCI Ankyrin repeat-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_015142 PE=4 SV=1;tr|A0A699PL61|A0A699PL61_TANCI MULE domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_816300 PE=4 SV=1;tr|	0.69697	2.756	19807	27508	0	24472	7030.3	0	0	0	0	19807	0	17701	0	0	0	0	0	27508	0	0	0	0	16440	0	0	0	0	0	0	0	0	0	24472	0	0	0	0	0	0	0	0	7030.3	0	0	0	0	0	0	0	0
A0A6L2K5Q6	A0A6L2K5Q6_TANCI	Putative reverse transcriptase domain-containing protein	Tci_016706	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			aspartic-type endopeptidase activity [GO:0004190]; nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	aspartic-type endopeptidase activity [GO:0004190]; nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	GFLKITK	tr|A0A6L2K5Q6|A0A6L2K5Q6_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_016706 PE=4 SV=1	0.81818	2.1255	0	0	11063	15162	12461	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11063	0	0	8670.3	0	0	0	0	0	15162	0	0	13366	0	0	0	0	12461	0	0	0	0	0	0	0
A0A6L2K613	A0A6L2K613_TANCI	Protein FAR1-RELATED SEQUENCE	Tci_016804	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	"regulation of transcription, DNA-templated [GO:0006355]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; zinc ion binding [GO:0008270]; regulation of transcription, DNA-templated [GO:0006355]"	zinc ion binding [GO:0008270]	MFFLLGK	tr|A0A6L2K613|A0A6L2K613_TANCI Protein FAR1-RELATED SEQUENCE OS=Tanacetum cinerariifolium OX=118510 GN=Tci_016804 PE=3 SV=1	0.87907	1.378	0	0	0	0	18414	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18414
A0A6L2K638	A0A6L2K638_TANCI	Putative ribonuclease H-like domain-containing protein	Tci_015523	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					YFCVKVK	tr|A0A6L2K638|A0A6L2K638_TANCI Putative ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_015523 PE=4 SV=1	0.88846	1.378	2065500	24451	411660	27974	19288	16377	13581	0	0	2065500	0	0	20213	0	0	0	0	24451	0	0	0	0	0	0	15088	0	0	0	0	0	411660	0	0	0	0	27974	25209	0	0	0	0	0	0	0	19288	14633	0	14754	0	0
A0A6L2K661	A0A6L2K661_TANCI	Monodehydroascorbate reductase	Tci_016841	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		NNKKMMR	tr|A0A6L2K661|A0A6L2K661_TANCI Monodehydroascorbate reductase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_016841 PE=4 SV=1	0.88318	1.378	152130	90127	156930	111450	235840	0	106010	70871	120870	0	0	152130	0	113380	48941	0	0	0	84716	0	79286	90127	0	0	0	0	155710	0	0	0	156930	0	89147	111450	0	0	0	0	0	0	0	0	0	0	227650	0	0	0	235840	0
A0A6L2K6D3	A0A6L2K6D3_TANCI	Leucine-rich repeat-containing protein	Tci_016300	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]		CSEYTQK	tr|A0A6L2K6D3|A0A6L2K6D3_TANCI Leucine-rich repeat-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_016300 PE=4 SV=1;tr|A0A699HGC4|A0A699HGC4_TANCI Leucine-rich repeat-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_382030 	0.86231	1.378	4154.9	0	0	0	0	0	4154.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2K6Q7	A0A6L2K6Q7_TANCI	"Putative reverse transcriptase domain, ribonuclease H-like domain, aspartic peptidase domain protein"	Tci_016478	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	QKPLWKK	"tr|A0A6L2K6Q7|A0A6L2K6Q7_TANCI Putative reverse transcriptase domain, ribonuclease H-like domain, aspartic peptidase domain protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_016478 PE=4 SV=1"	0.90222	1.378	0	61114	88399	104020	6187.2	0	0	0	0	0	0	0	0	0	5170.7	21526	0	0	0	61114	0	0	0	0	0	0	88399	0	0	0	0	0	0	0	104020	0	56195	0	0	14906	0	0	0	0	0	0	0	6187.2	0	0
A0A6L2K6U4	A0A6L2K6U4_TANCI	DNA-directed DNA polymerase	Tci_016470	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			DNA-directed DNA polymerase activity [GO:0003887]	DNA-directed DNA polymerase activity [GO:0003887]	SEPADYK	tr|A0A6L2K6U4|A0A6L2K6U4_TANCI DNA-directed DNA polymerase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_016470 PE=4 SV=1	0.8886	1.378	53511	78625	98275	51762	21577	0	0	0	0	0	53511	0	0	0	78625	75605	71722	0	0	47574	0	0	0	41529	0	76869	0	87003	0	92827	98275	0	0	0	0	0	0	0	51762	0	0	0	0	0	0	21577	0	0	0	0
A0A6L2K792	A0A6L2K792_TANCI	"Zinc finger, CCHC-type"	Tci_016847	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	LVLVYKKR	"tr|A0A6L2K792|A0A6L2K792_TANCI Zinc finger, CCHC-type OS=Tanacetum cinerariifolium OX=118510 GN=Tci_016847 PE=4 SV=1"	0.14286	3.0038	3516.1	31360	29190	36410	46088	3516.1	0	0	0	0	0	0	0	0	0	0	0	0	0	21754	31360	0	0	7200.8	0	24186	27018	0	29190	3499.4	0	0	0	0	18316	0	12516	36410	18429	13852	0	46088	22049	0	29262	0	34004	0	0	0
A0A6L2K7G9	A0A6L2K7G9_TANCI	Ribonuclease H-like domain-containing protein	Tci_015812	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					FWAQPAK	tr|A0A6L2K7G9|A0A6L2K7G9_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_015812 PE=4 SV=1	0.92183	1.378	0	7845.3	3167.1	8808.2	6015.4	0	0	0	0	0	0	0	0	0	5509.6	7845.3	0	0	0	0	0	0	0	0	0	0	0	0	3167.1	0	0	0	0	6498.3	0	0	0	8808.2	0	0	0	0	0	0	6015.4	0	0	0	0	0
A0A6L2K7H4	A0A6L2K7H4_TANCI	Putative reverse transcriptase domain-containing protein	Tci_016718	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	HDPLAMLLTRGKAK	tr|A0A6L2K7H4|A0A6L2K7H4_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_016718 PE=4 SV=1;tr|A0A6L2LMQ6|A0A6L2LMQ6_TANCI Putative ribonuclease H-like domain-containing protein (Fragment) OS=Tanac	0.86433	1.378	0	0	17116	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17116	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2K813	A0A6L2K813_TANCI	Putative reverse transcriptase domain-containing protein	Tci_016850	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	SLHIYEK	tr|A0A6L2K813|A0A6L2K813_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_016850 PE=4 SV=1	0.88666	1.378	0	0	8134.7	7371.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5402.9	0	8134.7	0	0	0	0	0	0	7371.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2K8A0	A0A6L2K8A0_TANCI	Uncharacterized protein	Tci_017626	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RPIPVVK	tr|A0A6L2K8A0|A0A6L2K8A0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_017626 PE=4 SV=1	0.88708	1.378	0	6453.4	8953.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6453.4	0	0	0	0	0	0	0	0	0	0	0	0	8953.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2K8H1	A0A6L2K8H1_TANCI	Cysteine-rich RLK (Receptor-like protein kinase) 8 (Fragment)	Tci_017000	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			kinase activity [GO:0016301]	kinase activity [GO:0016301]	VKLQYYM	tr|A0A6L2K8H1|A0A6L2K8H1_TANCI Cysteine-rich RLK (Receptor-like protein kinase) 8 (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_017000 PE=4 SV=1	0.88751	1.378	21495	0	28499	14913	0	0	0	0	0	0	21495	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28499	0	0	0	0	0	0	0	14913	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2K8I1	A0A6L2K8I1_TANCI	Uncharacterized protein	Tci_017709	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NDNTKKK	tr|A0A6L2K8I1|A0A6L2K8I1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_017709 PE=4 SV=1	0.88208	1.378	0	0	0	3782.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3782.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2K8I7	A0A6L2K8I7_TANCI	Ribonuclease H-like domain-containing protein	Tci_017058	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VVDGAVQPIAPSTTEQR	tr|A0A6L2K8I7|A0A6L2K8I7_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_017058 PE=4 SV=1	0.88626	1.378	0	17972	0	11398	16541	0	0	0	0	0	0	0	0	0	0	17972	0	0	0	0	16340	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11398	9994.3	5677.2	0	0	16541	0	0	0	7018.8	0	0	0
A0A6L2K8Z1	A0A6L2K8Z1_TANCI	Uncharacterized protein	Tci_017170	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					AHYDSEK	tr|A0A6L2K8Z1|A0A6L2K8Z1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_017170 PE=4 SV=1;tr|A0A699GUL6|A0A699GUL6_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_158895 PE=4 SV=1	0.78966	1.378	0	0	12532	17801	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12532	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17801	0	0	0	0	0	0	0	0	0	0
A0A6L2KA63	A0A6L2KA63_TANCI	CCHC-type domain-containing protein	Tci_016903	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	CGPNQQR	tr|A0A6L2KA63|A0A6L2KA63_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_016903 PE=4 SV=1;tr|A0A6L2NUI8|A0A6L2NUI8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_060253 PE=4 SV=1;tr|A0A69	0.88462	2.1673	7896.3	0	10791	7263.1	10436	0	4831.8	7896.3	0	0	0	0	7028	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10791	0	7263.1	0	0	0	0	0	0	0	0	0	0	0	10436	0	0	0	0
A0A6L2KAH6	A0A6L2KAH6_TANCI	"28S ribosomal protein S9, mitochondrial"	Tci_018441	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	translation [GO:0006412]	integral component of membrane [GO:0016021]; ribosome [GO:0005840]	integral component of membrane [GO:0016021]; ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	PLKRFVK	"tr|A0A6L2KAH6|A0A6L2KAH6_TANCI 28S ribosomal protein S9, mitochondrial OS=Tanacetum cinerariifolium OX=118510 GN=Tci_018441 PE=4 SV=1"	0.88851	1.378	10696	9259.3	0	0	0	0	0	0	0	0	10696	0	0	0	0	0	0	0	0	9259.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KAW3	A0A6L2KAW3_TANCI	Reverse transcriptase domain-containing protein	Tci_018454	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	GPLCQRK	tr|A0A6L2KAW3|A0A6L2KAW3_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_018454 PE=4 SV=1;tr|A0A166HTK6|A0A166HTK6_DAUCS Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_003036 PE=	0.78235	1.378	0	46274	0	35386	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	46274	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35386	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KB30	A0A6L2KB30_TANCI	Putative reverse transcriptase domain-containing protein	Tci_018524	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	MLASPLHSK	tr|A0A6L2KB30|A0A6L2KB30_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_018524 PE=4 SV=1	0.88894	1.378	0	2602	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2602	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KCA8	A0A6L2KCA8_TANCI	Uncharacterized protein	Tci_019061	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PGAPGGR	tr|A0A6L2KCA8|A0A6L2KCA8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_019061 PE=4 SV=1	0.88613	1.378	5514.5	10228	5663.5	0	0	0	3146.9	5514.5	0	0	0	0	0	0	0	0	10228	0	0	0	0	0	0	0	0	0	0	0	0	0	5663.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KCR5	A0A6L2KCR5_TANCI	Protein SPA1-related 2-like isoform X1	Tci_018490	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	photomorphogenesis [GO:0009640]		photomorphogenesis [GO:0009640]		CCVNAVK	tr|A0A6L2KCR5|A0A6L2KCR5_TANCI Protein SPA1-related 2-like isoform X1 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_018490 PE=4 SV=1	0.88417	1.378	0	0	4389.2	0	10502	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4389.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7363.9	0	10502	0
A0A6L2KD69	A0A6L2KD69_TANCI	Retrotrans_gag domain-containing protein	Tci_018630	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PSNQIPTEIQVVLPQVK	tr|A0A6L2KD69|A0A6L2KD69_TANCI Retrotrans_gag domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_018630 PE=4 SV=1;tr|A0A6L2KHA8|A0A6L2KHA8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_019333 PE=4 SV=1	0.87454	1.378	0	29804	0	5909.9	0	0	0	0	0	0	0	0	0	0	0	0	0	10078	29804	0	0	7183.2	0	0	0	0	0	0	0	0	0	0	5909.9	4431.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KD85	A0A6L2KD85_TANCI	ATP-dependent DNA helicase (EC 3.6.4.12)	Tci_017822	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA recombination [GO:0006310]; DNA repair [GO:0006281]; telomere maintenance [GO:0000723]		ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0140603]; DNA helicase activity [GO:0003678]; DNA recombination [GO:0006310]; DNA repair [GO:0006281]; telomere maintenance [GO:0000723]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0140603]; DNA helicase activity [GO:0003678]	GNDGSAM	tr|A0A6L2KD85|A0A6L2KD85_TANCI ATP-dependent DNA helicase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_017822 PE=3 SV=1	0.8846	1.378	0	16556	13172	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16556	0	0	0	0	0	0	0	13172	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KDX3	A0A6L2KDX3_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_019676	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KPKVPQK	tr|A0A6L2KDX3|A0A6L2KDX3_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_019676 PE=4 SV=1	0.88679	2.1662	36135	39956	0	0	20340	0	36135	0	0	0	0	0	0	0	39956	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20340	0	0	0	0	0
A0A6L2KEI8	A0A6L2KEI8_TANCI	Reverse transcriptase domain-containing protein	Tci_019120	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	NLENSMM	tr|A0A6L2KEI8|A0A6L2KEI8_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_019120 PE=4 SV=1;tr|A0A6L2KWI7|A0A6L2KWI7_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118	0.88508	1.378	0	0	13411	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13411	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KEP7	A0A6L2KEP7_TANCI	"Transposase, MuDR, MULE transposase domain protein"	Tci_018433	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	TFNMNPK	"tr|A0A6L2KEP7|A0A6L2KEP7_TANCI Transposase, MuDR, MULE transposase domain protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_018433 PE=4 SV=1"	0.88593	1.378	16854	16384	0	0	0	0	0	0	0	0	0	16854	0	0	0	0	0	0	0	0	0	7876.6	16384	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KEZ0	A0A6L2KEZ0_TANCI	Uncharacterized protein	Tci_018533	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					CPVQIRK	tr|A0A6L2KEZ0|A0A6L2KEZ0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_018533 PE=4 SV=1	0.88679	1.378	7640.1	0	0	0	0	0	0	0	6928.2	7640.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KEZ3	A0A6L2KEZ3_TANCI	Reverse transcriptase domain-containing protein	Tci_019467	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	MLRKTLK	tr|A0A6L2KEZ3|A0A6L2KEZ3_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_019467 PE=4 SV=1	0.88608	1.378	0	0	0	13971	8356.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13971	0	0	0	0	0	0	8356.9	0	0	0	0	0	0	0	0
A0A6L2KF20	A0A6L2KF20_TANCI	E3 ubiquitin-protein ligase UPL1-like	Tci_018442	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			ubiquitin-protein transferase activity [GO:0004842]	ubiquitin-protein transferase activity [GO:0004842]	VVLVLLR	tr|A0A6L2KF20|A0A6L2KF20_TANCI E3 ubiquitin-protein ligase UPL1-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_018442 PE=4 SV=1	0.88799	1.378	3466.1	0	0	0	0	0	0	0	0	3466.1	0	2658.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KFB4	A0A6L2KFB4_TANCI	Uncharacterized protein	Tci_019418	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					METHAAM	tr|A0A6L2KFB4|A0A6L2KFB4_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_019418 PE=4 SV=1	0.88946	1.378	0	0	2811.3	2606.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2811.3	2606.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KFC1	A0A6L2KFC1_TANCI	Ribonuclease H-like domain-containing protein	Tci_020054	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					WECRAPK	tr|A0A6L2KFC1|A0A6L2KFC1_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_020054 PE=4 SV=1	0.8984	1.378	0	0	0	2287	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2287	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KFD8	A0A6L2KFD8_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_020149	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TKTFSMK	tr|A0A6L2KFD8|A0A6L2KFD8_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_020149 PE=4 SV=1	0.89002	1.378	0	0	0	0	11285	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11285	0	0	0	0	0	0	0	0
A0A6L2KFI7	A0A6L2KFI7_TANCI	Uncharacterized protein	Tci_019430	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					AFWSAVM	tr|A0A6L2KFI7|A0A6L2KFI7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_019430 PE=4 SV=1	0.89045	1.378	0	48918	74184	53540	22318	0	0	0	0	0	0	0	0	0	0	0	0	30208	48918	0	0	0	0	0	0	0	0	0	0	0	74184	0	0	53540	0	0	0	0	0	0	0	0	0	22318	0	0	0	0	0	0
A0A6L2KFS5	A0A6L2KFS5_TANCI	Beta-caryophyllene synthase	Tci_019747	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	diterpenoid biosynthetic process [GO:0016102]		magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333]; diterpenoid biosynthetic process [GO:0016102]	magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333]	VTGSGGK	tr|A0A6L2KFS5|A0A6L2KFS5_TANCI Beta-caryophyllene synthase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_019747 PE=4 SV=1	0.89049	1.378	0	19326	13030	9720.2	19386	0	0	0	0	0	0	0	0	0	0	0	11631	0	0	19326	9749.9	0	0	0	0	0	0	0	13030	0	0	0	0	0	0	0	9313.6	9720.2	0	0	0	0	19386	0	0	0	0	0	0	0
A0A6L2KH64	A0A6L2KH64_TANCI	Ribonuclease H-like domain-containing protein	Tci_020684	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					YSPVHPR	tr|A0A6L2KH64|A0A6L2KH64_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_020684 PE=4 SV=1	0.89219	1.378	0	20241	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20241	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KHZ2	A0A6L2KHZ2_TANCI	RNA-directed DNA polymerase homolog	Tci_021089	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	SEHPITK	tr|A0A6L2KHZ2|A0A6L2KHZ2_TANCI RNA-directed DNA polymerase homolog OS=Tanacetum cinerariifolium OX=118510 GN=Tci_021089 PE=4 SV=1	0.89261	1.378	19799	36908	26235	25090	14887	19799	14767	15680	0	0	0	0	0	0	19095	26043	21478	36908	0	0	0	0	0	16190	15499	0	0	0	26235	0	0	0	0	0	0	25090	18917	0	0	0	23474	0	0	0	0	0	0	14887	0	0
A0A6L2KI80	A0A6L2KI80_TANCI	Ubiquitin carboxyl-terminal hydrolase 12-like isoform X2	Tci_021146	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			hydrolase activity [GO:0016787]	hydrolase activity [GO:0016787]	GDGCEQK	tr|A0A6L2KI80|A0A6L2KI80_TANCI Ubiquitin carboxyl-terminal hydrolase 12-like isoform X2 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_021146 PE=4 SV=1	0.89304	1.378	35688	33982	18405	7290.2	0	0	0	0	0	16107	0	35688	0	0	0	0	0	0	33982	0	0	15323	0	0	0	0	0	5951.6	0	18405	0	0	7290.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KJJ6	A0A6L2KJJ6_TANCI	"Transposase (Putative), gypsy type"	Tci_020173	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RCVVDAR	"tr|A0A6L2KJJ6|A0A6L2KJJ6_TANCI Transposase (Putative), gypsy type OS=Tanacetum cinerariifolium OX=118510 GN=Tci_020173 PE=4 SV=1"	0.89271	1.378	0	26578	11206	8355.7	24843	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26578	9976.1	0	0	0	0	0	0	0	11206	0	0	0	0	0	0	0	0	8355.7	0	0	0	24843	0	0	0	0	1836.5	0	0	0
A0A6L2KJL0	A0A6L2KJL0_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_020012	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			aspartic-type endopeptidase activity [GO:0004190]; nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	aspartic-type endopeptidase activity [GO:0004190]; nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	HNLLFTK	tr|A0A6L2KJL0|A0A6L2KJL0_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_020012 PE=4 SV=1	0.88993	1.378	0	0	0	0	11686	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11686	0	0	0	0	0	0
A0A6L2KKD3	A0A6L2KKD3_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_021110	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	AYSAYAK	tr|A0A6L2KKD3|A0A6L2KKD3_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_021110 PE=4 SV=1	0.88998	1.378	0	0	0	0	2851.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2851.7	0	0
A0A6L2KKY2	A0A6L2KKY2_TANCI	Integrase catalytic domain-containing protein	Tci_021375	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	GVAQEDM	tr|A0A6L2KKY2|A0A6L2KKY2_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_021375 PE=4 SV=1	0.89003	1.378	0	12422	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12422	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KLA3	A0A6L2KLA3_TANCI	Uncharacterized protein	Tci_022271	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	MAHSDYK	tr|A0A6L2KLA3|A0A6L2KLA3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_022271 PE=4 SV=1	0.89045	1.378	0	55974	36314	0	48454	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	55974	27967	0	36314	0	22312	0	8812.6	22347	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	48454	0	0	0	0
A0A6L2KLI0	A0A6L2KLI0_TANCI	NAC domain-containing protein 7-like	Tci_022341	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	"regulation of transcription, DNA-templated [GO:0006355]"		"DNA binding [GO:0003677]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]	RAVVPRK	tr|A0A6L2KLI0|A0A6L2KLI0_TANCI NAC domain-containing protein 7-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_022341 PE=4 SV=1	0.89012	1.378	18361	21040	8211.8	6772.7	0	0	0	0	18361	0	0	0	0	0	0	0	0	0	21040	0	0	0	17560	0	0	0	0	0	0	0	8211.8	0	6772.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KM77	A0A6L2KM77_TANCI	Uncharacterized protein	Tci_022047	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	VDYLFAK	tr|A0A6L2KM77|A0A6L2KM77_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_022047 PE=4 SV=1	0.89021	1.378	3948100	3240500	2481300	3184400	3407000	3948100	3347000	0	0	0	0	3393500	0	0	0	0	3217400	0	0	0	3240500	0	0	0	0	2460700	0	0	0	2481300	0	0	0	0	0	33139	3184400	0	0	0	0	0	3174600	3407000	0	0	0	0	3036900	0
A0A6L2KMA0	A0A6L2KMA0_TANCI	Reverse transcriptase domain-containing protein	Tci_022424	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	DYECEDWVK	tr|A0A6L2KMA0|A0A6L2KMA0_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_022424 PE=4 SV=1	0.86538	2.1744	0	0	3211.1	2595.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3211.1	0	0	0	2595.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KNK0	A0A6L2KNK0_TANCI	"RNA-directed DNA polymerase, eukaryota (Fragment)"	Tci_022150	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	SESDNNR	"tr|A0A6L2KNK0|A0A6L2KNK0_TANCI RNA-directed DNA polymerase, eukaryota (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_022150 PE=4 SV=1"	0.88407	1.378	0	0	0	0	70312	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	70312	0
A0A6L2KP89	A0A6L2KP89_TANCI	Reverse transcriptase domain-containing protein	Tci_022747	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	DSFVFLK	tr|A0A6L2KP89|A0A6L2KP89_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_022747 PE=4 SV=1;tr|A0A6L2KW97|A0A6L2KW97_TANCI DNA-directed DNA polymerase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_024142 PE	0.94178	1.378	31433	26376	18929	29448	11842	25562	24087	31433	11173	0	0	0	29859	0	26376	0	0	21461	0	0	0	0	16988	0	0	0	0	0	0	0	10718	18929	0	29448	0	16248	0	0	0	0	0	0	0	0	0	11842	0	8190.8	0	0
A0A6L2KPU1	A0A6L2KPU1_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_022053	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GYFKEKK	tr|A0A6L2KPU1|A0A6L2KPU1_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_022053 PE=4 SV=1	0.87462	1.378	0	9495	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9495	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KQ09	A0A6L2KQ09_TANCI	Putative multidrug resistance protein	Tci_023364	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	EPKGQTR	tr|A0A6L2KQ09|A0A6L2KQ09_TANCI Putative multidrug resistance protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_023364 PE=4 SV=1	0.87505	1.378	0	0	16203	18131	6704.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16203	0	0	0	0	0	0	0	0	0	0	0	18131	0	0	0	0	0	0	6704.9	0	0	0	0	0
A0A6L2KQM9	A0A6L2KQM9_TANCI	Ribonuclease H-like domain-containing protein	Tci_022900	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TPYDLLHGRKPSIGFMR	tr|A0A6L2KQM9|A0A6L2KQM9_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_022900 PE=4 SV=1	0.90323	1.378	0	15168	0	14156	4926.9	0	0	0	0	0	0	0	0	0	15168	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14156	0	0	0	0	13239	0	0	0	0	0	0	4926.9	0	0
A0A6L2KRD1	A0A6L2KRD1_TANCI	Uncharacterized protein	Tci_022553	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PGARIGK	tr|A0A6L2KRD1|A0A6L2KRD1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_022553 PE=4 SV=1	0.87435	1.378	1958.8	0	0	0	0	0	0	0	0	0	1958.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KRU5	A0A6L2KRU5_TANCI	DNA replication licensing factor MCM7 (EC 3.6.4.12)	MCM7 Tci_023365	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	cell cycle [GO:0007049]; DNA replication initiation [GO:0006270]	MCM complex [GO:0042555]; nucleus [GO:0005634]	MCM complex [GO:0042555]; nucleus [GO:0005634]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0140603]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; cell cycle [GO:0007049]; DNA replication initiation [GO:0006270]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0140603]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]	DKDSFDM	tr|A0A6L2KRU5|A0A6L2KRU5_TANCI DNA replication licensing factor MCM7 OS=Tanacetum cinerariifolium OX=118510 GN=MCM7 PE=3 SV=1	0.87478	1.378	0	0	5309	3301.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5309	0	3301.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KRY2	A0A6L2KRY2_TANCI	CCHC-type domain-containing protein	Tci_024299	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	MRKTNCR	tr|A0A6L2KRY2|A0A6L2KRY2_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_024299 PE=4 SV=1	0.87522	1.378	0	0	121960	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	121960	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KS45	A0A6L2KS45_TANCI	Ribonuclease H-like domain-containing protein	Tci_022823	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	NLGNISR	tr|A0A6L2KS45|A0A6L2KS45_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_022823 PE=4 SV=1	0.86885	1.378	0	0	0	0	26733	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26733	0	0
A0A6L2KS67	A0A6L2KS67_TANCI	Uncharacterized protein	Tci_023390	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	DSMRRMK	tr|A0A6L2KS67|A0A6L2KS67_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_023390 PE=4 SV=1	0.87565	1.378	0	171490	0	0	0	0	0	0	0	0	0	0	0	0	171490	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KS98	A0A6L2KS98_TANCI	"Retrotransposon protein, putative, unclassified"	Tci_023618	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VLLIKHK	"tr|A0A6L2KS98|A0A6L2KS98_TANCI Retrotransposon protein, putative, unclassified OS=Tanacetum cinerariifolium OX=118510 GN=Tci_023618 PE=4 SV=1;tr|A0A699GW52|A0A699GW52_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic "	0.94114	1.378	0	29725	0	7357.2	0	0	0	0	0	0	0	0	0	0	0	0	29725	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7357.2	0	0	0	0	0	0	0	0	0
A0A6L2KSJ9	A0A6L2KSJ9_TANCI	Uncharacterized protein	Tci_024521	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		DPEDGAM	tr|A0A6L2KSJ9|A0A6L2KSJ9_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_024521 PE=4 SV=1	0.87608	1.378	0	0	0	14805	11699	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14805	0	0	0	0	0	0	0	11699	0	0	0	0	0	0
A0A6L2KSX6	A0A6L2KSX6_TANCI	Reverse transcriptase domain-containing protein	Tci_024047	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	RAIPKAR	tr|A0A6L2KSX6|A0A6L2KSX6_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_024047 PE=4 SV=1	0.87651	1.378	0	10491	62240	18870	9714.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10491	0	0	0	0	0	0	0	0	62240	0	0	0	0	0	0	0	0	4229.5	18870	0	0	9714.3	0	0	0	0	0	0	0	0
A0A6L2KTD5	A0A6L2KTD5_TANCI	Uncharacterized protein (Fragment)	Tci_024534	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					YCSSSGR	tr|A0A6L2KTD5|A0A6L2KTD5_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_024534 PE=4 SV=1	0.87694	1.378	19186	0	135950	13945	48975	0	0	0	16334	19186	0	18202	0	0	0	0	0	0	0	0	0	0	0	0	0	135950	0	0	0	22682	0	0	0	13945	0	0	0	0	0	0	0	0	0	48975	0	0	0	0	0	0
A0A6L2KVW9	A0A6L2KVW9_TANCI	Reverse transcriptase domain-containing protein	Tci_025751	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HICNAIK	tr|A0A6L2KVW9|A0A6L2KVW9_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_025751 PE=4 SV=1	0.87218	1.378	0	0	0	0	29618	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29618	0	0	0	0	0	0	0	0
A0A6L2KW16	A0A6L2KW16_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_025157	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	YVVKRLR	tr|A0A6L2KW16|A0A6L2KW16_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_025157 PE=4 SV=1	0.87262	1.378	0	0	0	0	44231	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	44231	0	0	0	0	0	0	0
A0A6L2KW42	A0A6L2KW42_TANCI	CCHC-type domain-containing protein	Tci_024740	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	AHRIILK	tr|A0A6L2KW42|A0A6L2KW42_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_024740 PE=4 SV=1	0.87305	1.378	5907	7999.1	0	0	0	0	0	0	0	0	0	5907	0	0	0	0	0	0	7999.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KWA2	A0A6L2KWA2_TANCI	Reverse transcriptase domain-containing protein	Tci_025267	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	SKHSRDDYLYCVDHTAK	tr|A0A6L2KWA2|A0A6L2KWA2_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_025267 PE=4 SV=1	0.88718	1.378	0	0	0	0	16704	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16704	0	0	0	0	0
A0A6L2KWQ5	A0A6L2KWQ5_TANCI	Reverse transcriptase domain-containing protein	Tci_025397	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	ADNGDEM	tr|A0A6L2KWQ5|A0A6L2KWQ5_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_025397 PE=4 SV=1	0.87348	1.378	0	6289.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6289.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KXP8	A0A6L2KXP8_TANCI	Uncharacterized protein	Tci_025285	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	CWSDGGK	tr|A0A6L2KXP8|A0A6L2KXP8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_025285 PE=4 SV=1	0.87403	1.378	12470	12951	0	8973	0	0	0	0	0	0	12470	0	0	0	0	0	0	0	0	12951	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8973	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KXU0	A0A6L2KXU0_TANCI	CCHC-type domain-containing protein	Tci_024702	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	RMPIKLR	"tr|A0A6L2KXU0|A0A6L2KXU0_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_024702 PE=4 SV=1;tr|A0A6L2K209|A0A6L2K209_TANCI RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein OS=Ta"	0.91152	1.378	0	2148.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2148.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2KY44	A0A6L2KY44_TANCI	"Retrotransposon protein, putative, Ty3-gypsy subclass"	Tci_025455	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	FGLFAEK	"tr|A0A6L2KY44|A0A6L2KY44_TANCI Retrotransposon protein, putative, Ty3-gypsy subclass OS=Tanacetum cinerariifolium OX=118510 GN=Tci_025455 PE=4 SV=1"	0.87781	1.378	0	0	0	4743500	1610200	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4743500	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1610200
A0A6L2KZ77	A0A6L2KZ77_TANCI	Copia protein	Tci_026796	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KLPDDNK	tr|A0A6L2KZ77|A0A6L2KZ77_TANCI Copia protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_026796 PE=4 SV=1	0.88162	1.378	0	0	0	257250	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	257250	0	0	0	0	0	0	0	0	0	0
A0A6L2KZL3	A0A6L2KZL3_TANCI	"Retrotransposon protein, putative, unclassified"	Tci_025910	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HSPWSVK	"tr|A0A6L2KZL3|A0A6L2KZL3_TANCI Retrotransposon protein, putative, unclassified OS=Tanacetum cinerariifolium OX=118510 GN=Tci_025910 PE=4 SV=1"	0.75862	2.756	26563	23681	27284	14404	35098	23343	15717	0	0	0	0	0	0	26563	0	0	0	0	0	0	0	23681	0	25436	0	0	0	0	0	27284	0	0	0	0	0	0	14404	10170	0	0	13388	0	0	0	0	10743	24963	0	35098	0
A0A6L2KZY7	A0A6L2KZY7_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_026095	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	LKKAPYR	tr|A0A6L2KZY7|A0A6L2KZY7_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_026095 PE=4 SV=1	0.89796	1.378	0	0	0	4633.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4633.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2L0V0	A0A6L2L0V0_TANCI	Reverse transcriptase domain-containing protein	Tci_027479	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	RAIVKSK	tr|A0A6L2L0V0|A0A6L2L0V0_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_027479 PE=4 SV=1	0.88402	1.378	0	11384	10939	7695.5	9548.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11384	0	0	0	10939	0	0	0	0	0	0	0	0	0	0	0	0	0	7695.5	0	0	0	0	9548.8	0	0	0	0	0	0	0
A0A6L2L122	A0A6L2L122_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_026927	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	DTAEPEN	tr|A0A6L2L122|A0A6L2L122_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_026927 PE=4 SV=1	0.88225	1.378	0	0	0	0	14426	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14426	0	0
A0A6L2L1T7	A0A6L2L1T7_TANCI	Reverse transcriptase domain-containing protein	Tci_026102	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	GHDMTAK	tr|A0A6L2L1T7|A0A6L2L1T7_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_026102 PE=4 SV=1	0.88311	1.378	0	0	0	23563	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23563	0	0	0	0	0	0	0	0	0
A0A6L2L256	A0A6L2L256_TANCI	Uncharacterized protein	Tci_027766	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HTYAHRR	tr|A0A6L2L256|A0A6L2L256_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_027766 PE=4 SV=1	0.88354	1.378	0	0	137240	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	137240	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2L299	A0A6L2L299_TANCI	SWIM-type domain-containing protein	Tci_027198	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	QWLVDRNPNSWCRAFFR	tr|A0A6L2L299|A0A6L2L299_TANCI SWIM-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_027198 PE=4 SV=1	0.88542	1.378	0	35716	53689	55065	198300	0	0	0	0	0	0	0	0	0	0	0	0	0	22211	0	0	35716	0	0	0	0	0	0	53689	0	0	17183	0	0	0	55065	54127	0	0	0	0	0	198300	0	0	0	0	0	0	0
A0A6L2L2D7	A0A6L2L2D7_TANCI	Uncharacterized protein	Tci_026975	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LLHTFFR	tr|A0A6L2L2D7|A0A6L2L2D7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_026975 PE=4 SV=1	0.88359	1.378	5831	0	10180	201870	7659.7	0	0	0	0	0	0	0	0	5831	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10180	8370.1	0	0	4453.8	0	0	0	201870	0	0	0	0	0	0	0	0	0	7659.7	4939.3	0
A0A6L2L2I3	A0A6L2L2I3_TANCI	Uncharacterized protein	Tci_026383	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GEGEEGM	tr|A0A6L2L2I3|A0A6L2L2I3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_026383 PE=4 SV=1	0.88114	1.378	0	13894	0	5844	11920	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13894	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5844	0	0	11920	0	0	0	0	0	0	0	0
A0A6L2L2L4	A0A6L2L2L4_TANCI	CCHC-type domain-containing protein	Tci_027774	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	VHPIAIK	tr|A0A6L2L2L4|A0A6L2L2L4_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_027774 PE=4 SV=1	0.88028	1.378	0	7005.9	4933.3	0	13236	0	0	0	0	0	0	0	0	0	0	7005.9	0	0	0	0	0	0	0	0	0	4933.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13236	0	0	0	0	0	0	0	0
A0A6L2L2Z3	A0A6L2L2Z3_TANCI	Reverse transcriptase domain-containing protein	Tci_028211	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GPVKIAK	tr|A0A6L2L2Z3|A0A6L2L2Z3_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_028211 PE=4 SV=1	0.87748	1.378	5640.6	4339.7	0	0	0	0	0	0	5640.6	0	0	0	0	0	0	0	0	0	0	0	0	0	4339.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2L349	A0A6L2L349_TANCI	Reverse transcriptase domain-containing protein	Tci_028271	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	phosphate ion transport [GO:0006817]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; RNA-DNA hybrid ribonuclease activity [GO:0004523]; phosphate ion transport [GO:0006817]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	GFPIGMK	tr|A0A6L2L349|A0A6L2L349_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_028271 PE=3 SV=1	0.87791	1.378	35446	77063	27186	14058	46673	35446	0	0	0	0	0	11122	34967	9362.5	0	0	0	77063	41640	0	0	0	0	27186	0	0	0	0	0	0	0	0	14058	10571	0	11891	0	0	0	0	0	0	0	18490	23296	0	0	25647	46673	0
A0A6L2L424	A0A6L2L424_TANCI	Putative reverse transcriptase domain-containing protein	Tci_027585	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	IGHMAYK	tr|A0A6L2L424|A0A6L2L424_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_027585 PE=4 SV=1	0.88947	1.378	0	0	0	0	5295.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5295.1	0	0
A0A6L2L6D1	A0A6L2L6D1_TANCI	CCHC-type domain-containing protein	Tci_029164	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	ECNCCMK	tr|A0A6L2L6D1|A0A6L2L6D1_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_029164 PE=4 SV=1	0.87984	1.378	0	20052	22611	3062.9	7987.9	0	0	0	0	0	0	0	0	0	0	18917	0	0	0	0	0	0	20052	0	0	2447.9	0	0	22611	0	0	0	0	3062.9	0	0	0	0	0	0	0	0	0	0	0	0	0	7987.9	0	0
A0A6L2L6N8	A0A6L2L6N8_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_028290	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PADDDGK	tr|A0A6L2L6N8|A0A6L2L6N8_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_028290 PE=4 SV=1	0.86667	1.378	496470	1842500	2013500	1335900	769430	468980	11229	289890	0	0	496470	0	13166	0	28192	303860	58479	1842500	891620	434760	305350	324600	0	177330	157990	0	0	2013500	522710	241820	193270	617300	218610	214270	275460	659760	812110	791930	1335900	747860	114800	666740	769430	693800	98502	57171	284220	764180	708310	425960
A0A6L2L6P5	A0A6L2L6P5_TANCI	WRKY domain-containing protein	Tci_029489	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	KGVKPVK	tr|A0A6L2L6P5|A0A6L2L6P5_TANCI WRKY domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_029489 PE=4 SV=1	0.8928	1.378	0	14983	10147	9421.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14983	0	0	0	0	0	0	0	0	10147	0	0	0	0	0	0	0	0	0	9421.6	0	0	0	0	0	0	0	0	0	0	0
A0A6L2L6Q7	A0A6L2L6Q7_TANCI	Uncharacterized protein	Tci_028515	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	FGHTPLPGPYLKSLWFK	tr|A0A6L2L6Q7|A0A6L2L6Q7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_028515 PE=4 SV=1	0.86296	1.378	0	15847	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15847	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2L7A8	A0A6L2L7A8_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_028725	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ARLAYWK	tr|A0A6L2L7A8|A0A6L2L7A8_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_028725 PE=4 SV=1	0.90928	1.378	0	0	3562.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3562.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2L7R3	A0A6L2L7R3_TANCI	Lysine-specific demethylase REF6	Tci_029674	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	methylation [GO:0032259]		methyltransferase activity [GO:0008168]; methylation [GO:0032259]	methyltransferase activity [GO:0008168]	FLLRKSR	tr|A0A6L2L7R3|A0A6L2L7R3_TANCI Lysine-specific demethylase REF6 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_029674 PE=4 SV=1	0.91012	1.378	23552	24292	27807	0	0	0	0	0	0	0	23552	0	0	0	0	0	0	0	0	24292	0	0	0	0	0	0	27807	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2L7T7	A0A6L2L7T7_TANCI	Uncharacterized protein	Tci_028343	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LHAFCAK	tr|A0A6L2L7T7|A0A6L2L7T7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_028343 PE=4 SV=1	0.91054	1.378	0	3965.4	0	6557.1	6550.4	0	0	0	0	0	0	0	0	0	0	3965.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6557.1	0	0	0	0	0	0	0	6550.4	0	0	0	0	0	0	0
A0A6L2L7U0	A0A6L2L7U0_TANCI	Uncharacterized protein	Tci_028690	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ELGHTGK	tr|A0A6L2L7U0|A0A6L2L7U0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_028690 PE=4 SV=1;tr|A0A6L2MSC5|A0A6L2MSC5_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_048851 PE=4 SV=1;tr|A0A6L2MP56|A0A6L2	0.84091	2.2155	0	18376	15589	0	29134	0	0	0	0	0	0	0	0	0	0	0	18376	0	0	0	0	0	0	0	0	0	0	0	0	0	15589	0	0	0	0	0	0	0	0	0	0	0	29134	0	0	0	0	0	0	0
A0A6L2L812	A0A6L2L812_TANCI	Reverse transcriptase domain-containing protein	Tci_029238	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	RAKTLSR	tr|A0A6L2L812|A0A6L2L812_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_029238 PE=4 SV=1;tr|A0A6L2JN74|A0A6L2JN74_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118	0.86765	1.378	0	0	4579.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4579.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2L836	A0A6L2L836_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_029971	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	TYQSKTK	tr|A0A6L2L836|A0A6L2L836_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_029971 PE=4 SV=1	0.91099	1.378	0	21805	0	0	0	0	0	0	0	0	0	0	0	0	0	21805	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2L845	A0A6L2L845_TANCI	Uncharacterized protein	Tci_028995	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	LNCCCER	tr|A0A6L2L845|A0A6L2L845_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_028995 PE=4 SV=1	0.91194	1.378	0	0	1996.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1996.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2L8L1	A0A6L2L8L1_TANCI	Uncharacterized protein	Tci_030131	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LLLGKHK	tr|A0A6L2L8L1|A0A6L2L8L1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_030131 PE=4 SV=1	0.8209	2.1229	0	0	0	0	14561	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14561	0	0	0
A0A6L2L8P2	A0A6L2L8P2_TANCI	ATP-dependent DNA helicase (EC 3.6.4.12) (Fragment)	Tci_028643	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA recombination [GO:0006310]; DNA repair [GO:0006281]; telomere maintenance [GO:0000723]		ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0140603]; DNA helicase activity [GO:0003678]; DNA recombination [GO:0006310]; DNA repair [GO:0006281]; telomere maintenance [GO:0000723]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0140603]; DNA helicase activity [GO:0003678]	EARAMLR	tr|A0A6L2L8P2|A0A6L2L8P2_TANCI ATP-dependent DNA helicase (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_028643 PE=3 SV=1	0.91183	1.378	7531.8	0	13450	25101	14937	6809	7531.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13450	0	0	0	0	11050	0	0	25101	0	0	0	0	0	14937	0	0	0	0
A0A6L2L9L6	A0A6L2L9L6_TANCI	DNA replication helicase	Tci_029310	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			helicase activity [GO:0004386]	helicase activity [GO:0004386]	GGGCMYK	tr|A0A6L2L9L6|A0A6L2L9L6_TANCI DNA replication helicase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_029310 PE=4 SV=1	0.90803	1.378	416100	0	0	0	0	196800	0	0	0	0	0	0	0	416100	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LAC2	A0A6L2LAC2_TANCI	Uncharacterized protein	Tci_029560	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DDAEDDR	tr|A0A6L2LAC2|A0A6L2LAC2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_029560 PE=4 SV=1	0.90536	1.378	4087.6	0	0	4774.1	0	4087.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4774.1	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LAT9	A0A6L2LAT9_TANCI	Integrase_H2C2 domain-containing protein	Tci_030814	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SCEYCSK	tr|A0A6L2LAT9|A0A6L2LAT9_TANCI Integrase_H2C2 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_030814 PE=4 SV=1	0.9062	1.378	0	0	0	9295.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9295.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LB51	A0A6L2LB51_TANCI	"Protein kinase-like domain, phloem protein 2-like protein"	Tci_030934	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	NLIVCAR	"tr|A0A6L2LB51|A0A6L2LB51_TANCI Protein kinase-like domain, phloem protein 2-like protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_030934 PE=4 SV=1"	0.90624	1.378	0	11380	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11380	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LBC3	A0A6L2LBC3_TANCI	"Zinc finger, CCHC-type"	Tci_030408	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SEIEPAEESK	"tr|A0A6L2LBC3|A0A6L2LBC3_TANCI Zinc finger, CCHC-type OS=Tanacetum cinerariifolium OX=118510 GN=Tci_030408 PE=4 SV=1;tr|A0A699UZ86|A0A699UZ86_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_899112 PE=4 SV=1;tr|A0A699V"	0.90666	1.378	101180	154280	122260	180760	171470	0	0	0	0	0	101180	0	0	0	0	0	151710	0	0	0	0	154280	142330	0	0	83587	96458	122260	103900	0	0	0	0	0	0	0	180760	0	102280	120150	92460	171470	76485	0	0	0	141550	0	98557	141650
A0A6L2LBD7	A0A6L2LBD7_TANCI	"RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein"	Tci_030417	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	LPFLLFR	"tr|A0A6L2LBD7|A0A6L2LBD7_TANCI RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_030417 PE=4 SV=1"	0.89256	1.378	0	0	2289.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2289.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LBF0	A0A6L2LBF0_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_030438	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TLGKGRK	tr|A0A6L2LBF0|A0A6L2LBF0_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_030438 PE=4 SV=1	0.90707	1.378	19692	0	19293	33262	14820	0	17895	0	0	0	0	0	19692	17841	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19293	0	18453	0	0	0	0	0	0	33262	0	0	0	0	0	0	0	14820	0	0
A0A6L2LBU5	A0A6L2LBU5_TANCI	Reverse transcriptase Ty1/copia-type domain-containing protein	Tci_031199	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HYVIENLKFLKQEMSIK	tr|A0A6L2LBU5|A0A6L2LBU5_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_031199 PE=4 SV=1	0.90526	1.378	16720	47500	0	0	0	0	0	0	16720	13010	0	0	0	0	0	0	0	0	47500	0	0	11306	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LC73	A0A6L2LC73_TANCI	Uncharacterized protein (Fragment)	Tci_031329	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	VPLRTPK	tr|A0A6L2LC73|A0A6L2LC73_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_031329 PE=4 SV=1	0.91965	1.378	0	2763.4	0	2160	4397.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2763.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2160	0	0	0	0	0	0	4397.1	3989	0	0	0	0	0	0	0
A0A6L2LCU1	A0A6L2LCU1_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_030013	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	NCLLIAR	tr|A0A6L2LCU1|A0A6L2LCU1_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_030013 PE=4 SV=1	0.93333	1.5954	0	8867.3	10339	13088	9627.5	0	0	0	0	0	0	0	0	0	0	0	8867.3	0	6425.6	0	0	0	0	0	0	10339	0	0	5414.8	0	0	0	0	0	0	0	0	0	0	13088	0	0	9627.5	0	0	0	0	0	0	0
A0A6L2LCX5	A0A6L2LCX5_TANCI	NusB antitermination factor	Tci_031581	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	"DNA-templated transcription, termination [GO:0006353]; regulation of transcription, DNA-templated [GO:0006355]; transcription antitermination [GO:0031564]"		"RNA binding [GO:0003723]; DNA-templated transcription, termination [GO:0006353]; regulation of transcription, DNA-templated [GO:0006355]; transcription antitermination [GO:0031564]"	RNA binding [GO:0003723]	TFIKGLK	tr|A0A6L2LCX5|A0A6L2LCX5_TANCI NusB antitermination factor OS=Tanacetum cinerariifolium OX=118510 GN=Tci_031581 PE=3 SV=1;tr|A0A2U1Q924|A0A2U1Q924_ARTAN NusB antitermination factor OS=Artemisia annua OX=35608 GN=CTI12_AA056270 PE=3 SV=1;tr|A0A251T9W0|A0A25	0.82685	1.378	0	14760	5337	12303	0	0	0	0	0	0	0	0	0	0	0	0	14760	0	0	0	0	0	0	0	0	0	0	0	5337	0	0	0	0	0	0	0	12303	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LFI2	A0A6L2LFI2_TANCI	Ribonuclease H-like domain-containing protein (Fragment)	Tci_032346	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SLPAHMR	tr|A0A6L2LFI2|A0A6L2LFI2_TANCI Ribonuclease H-like domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_032346 PE=4 SV=1	0.91799	1.378	0	0	0	10169	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10169	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LG58	A0A6L2LG58_TANCI	Integrase catalytic domain-containing protein	Tci_032118	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	LVNDDDM	tr|A0A6L2LG58|A0A6L2LG58_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_032118 PE=4 SV=1	0.9184	1.378	0	0	93754	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	93754	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LGA8	A0A6L2LGA8_TANCI	Uncharacterized protein	Tci_032824	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RAQPILK	tr|A0A6L2LGA8|A0A6L2LGA8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_032824 PE=4 SV=1	0.91923	1.378	4048.5	0	16172	18116	7881.2	0	0	0	0	0	0	0	4048.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16172	0	14921	18116	0	0	0	0	0	0	0	0	0	0	0	0	7881.2	0	0	0
A0A6L2LH69	A0A6L2LH69_TANCI	Uncharacterized protein	Tci_031920	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PMCDSSS	tr|A0A6L2LH69|A0A6L2LH69_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_031920 PE=4 SV=1	0.89583	1.378	0	4130.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4130.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LHI2	A0A6L2LHI2_TANCI	Uncharacterized protein	Tci_033244	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KTKIYYK	tr|A0A6L2LHI2|A0A6L2LHI2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_033244 PE=4 SV=1	0.92093	1.378	749050	471930	480140	575860	712870	0	87305	443800	0	0	73541	383660	0	749050	0	338700	97496	451370	471930	126310	425340	440500	0	0	42713	44091	66764	134510	480140	0	0	43484	354080	0	75224	550770	366310	575860	520880	43814	41961	712870	505680	77174	287060	7642.8	0	0	0	0
A0A6L2LI44	A0A6L2LI44_TANCI	Copia protein	Tci_033461	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VKPKITK	tr|A0A6L2LI44|A0A6L2LI44_TANCI Copia protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_033461 PE=4 SV=1;tr|A0A6L2JW12|A0A6L2JW12_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_013249 PE=4 SV=1	0.84126	1.378	0	0	0	0	6526.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6526.2	0
A0A6L2LIW7	A0A6L2LIW7_TANCI	Uncharacterized protein	Tci_033741	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EWHALHSCTKCGFCEHR	tr|A0A6L2LIW7|A0A6L2LIW7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_033741 PE=4 SV=1	0.89873	1.378	8307.6	8462.1	16626	0	16897	0	0	0	0	8307.6	0	0	0	0	0	0	0	0	0	0	0	8462.1	0	0	0	0	0	0	16626	0	0	0	0	0	0	0	0	0	0	0	0	16897	0	0	0	0	0	0	0	0
A0A6L2LJ21	A0A6L2LJ21_TANCI	Uncharacterized protein (Fragment)	Tci_033616	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RALKSVK	tr|A0A6L2LJ21|A0A6L2LJ21_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_033616 PE=4 SV=1	0.91364	1.378	0	0	13676	9599.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13676	0	0	0	0	0	0	0	0	9599.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LJG6	A0A6L2LJG6_TANCI	Integrase catalytic domain-containing protein	Tci_033959	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	DKCGSSR	tr|A0A6L2LJG6|A0A6L2LJG6_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_033959 PE=4 SV=1	0.89212	1.378	21176	15159	14261	0	30669	20628	0	0	0	0	0	0	21176	0	0	0	0	0	0	0	0	15159	0	0	0	0	0	0	0	0	14261	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30669	0
A0A6L2LJN9	A0A6L2LJN9_TANCI	Integrase catalytic domain-containing protein	Tci_034029	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	KFIVRFK	tr|A0A6L2LJN9|A0A6L2LJN9_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_034029 PE=4 SV=1	0.91451	1.378	0	0	0	22280	17311	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22280	0	0	0	0	0	0	0	17311	0	0	0	0	0	0	0
A0A6L2LKJ2	A0A6L2LKJ2_TANCI	Uncharacterized protein	Tci_033577	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QTKTFGK	tr|A0A6L2LKJ2|A0A6L2LKJ2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_033577 PE=4 SV=1	0.91455	1.378	0	11764	0	0	4092.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11764	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4092.7
A0A6L2LMA4	A0A6L2LMA4_TANCI	Reverse transcriptase domain-containing protein	Tci_013423 Tci_034776	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	PVPARCR	tr|A0A6L2LMA4|A0A6L2LMA4_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_013423 PE=4 SV=1	0.9158	1.378	22682	13226	21900	16901	2330000	0	0	0	0	22682	0	0	21823	22232	0	0	0	13226	0	0	0	0	0	0	15332	0	0	0	0	21900	0	0	0	16901	0	0	0	0	0	0	0	0	0	0	0	11338	0	0	0	2330000
A0A6L2LME4	A0A6L2LME4_TANCI	Uncharacterized protein	Tci_033313	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	DHDGDDK	tr|A0A6L2LME4|A0A6L2LME4_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_033313 PE=4 SV=1	0.88306	1.378	4357.4	0	2073.3	0	0	0	0	0	0	0	0	4357.4	0	0	0	0	0	0	0	0	0	0	0	2073.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LMU4	A0A6L2LMU4_TANCI	Uncharacterized protein (Fragment)	Tci_034458	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VPKPVGK	tr|A0A6L2LMU4|A0A6L2LMU4_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_034458 PE=4 SV=1	0.91622	1.378	0	13551	13656	21950	3902.5	0	0	0	0	0	0	0	0	0	2465.3	13551	0	0	0	0	9950	0	0	9724.4	0	0	0	0	13656	0	0	0	0	0	0	0	8683.8	21950	7746.6	10991	0	0	0	0	3902.5	1214.6	0	0	0	0
A0A6L2LMZ3	A0A6L2LMZ3_TANCI	"RNA-directed DNA polymerase, eukaryota (Fragment)"	Tci_033523	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			protein dimerization activity [GO:0046983]; RNA-directed DNA polymerase activity [GO:0003964]	protein dimerization activity [GO:0046983]; RNA-directed DNA polymerase activity [GO:0003964]	EGNGNGN	"tr|A0A6L2LMZ3|A0A6L2LMZ3_TANCI RNA-directed DNA polymerase, eukaryota (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_033523 PE=4 SV=1"	0.91663	1.378	13432	11310	0	7050.3	0	4639.4	0	0	8892.7	0	0	13432	0	5902.7	0	0	0	11310	0	0	0	0	7412.7	0	0	0	0	0	0	0	0	0	0	0	0	7050.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LPK5	A0A6L2LPK5_TANCI	Reverse transcriptase domain-containing protein	Tci_035017	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	TEGPDGK	tr|A0A6L2LPK5|A0A6L2LPK5_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_035017 PE=4 SV=1	0.90444	1.378	0	0	0	37649	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37649	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LPX8	A0A6L2LPX8_TANCI	Reverse transcriptase	Tci_034985	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	FGPDELR	tr|A0A6L2LPX8|A0A6L2LPX8_TANCI Reverse transcriptase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_034985 PE=4 SV=1	0.89565	1.378	0	19843	0	0	0	0	0	0	0	0	0	0	0	0	0	16112	0	0	0	16063	19843	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LQQ0	A0A6L2LQQ0_TANCI	Uncharacterized protein	Tci_034393	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EQCWDYK	tr|A0A6L2LQQ0|A0A6L2LQQ0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_034393 PE=4 SV=1	0.89692	1.378	0	0	0	0	2499.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2499.1	0	0	0	0	0	0	0	0
A0A6L2LRB9	A0A6L2LRB9_TANCI	Putative reverse transcriptase domain-containing protein	Tci_034633	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	MTPKVLK	tr|A0A6L2LRB9|A0A6L2LRB9_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_034633 PE=4 SV=1	0.89705	1.378	0	0	0	9973.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9973.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LSY8	A0A6L2LSY8_TANCI	Uncharacterized protein	Tci_036035	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LGGLLRK	tr|A0A6L2LSY8|A0A6L2LSY8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_036035 PE=4 SV=1	0.89713	1.378	22342	4072.5	37717	16400	9956.3	5713.7	0	0	0	0	22342	0	0	0	0	4072.5	0	0	0	0	0	0	0	0	0	0	0	37717	0	0	0	0	0	0	0	0	16400	0	0	0	0	0	0	0	9956.3	0	0	0	0	0
A0A6L2LSZ7	A0A6L2LSZ7_TANCI	Retrotransposon protein	Tci_036045	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ARLLWQK	tr|A0A6L2LSZ7|A0A6L2LSZ7_TANCI Retrotransposon protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_036045 PE=4 SV=1	0.89755	1.378	0	0	0	7764.4	7616.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7764.4	0	0	0	0	0	0	0	7616.2	0	0	0	0	0	0	0
A0A6L2LTI1	A0A6L2LTI1_TANCI	Retrotran_gag_3 domain-containing protein	Tci_035730	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					CSCSFCR	tr|A0A6L2LTI1|A0A6L2LTI1_TANCI Retrotran_gag_3 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_035730 PE=4 SV=1	0.8677	1.378	0	89519	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	89519	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LTR2	A0A6L2LTR2_TANCI	Reverse transcriptase	Tci_035503	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	AGADHNK	tr|A0A6L2LTR2|A0A6L2LTR2_TANCI Reverse transcriptase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_035503 PE=4 SV=1	0.89523	1.378	0	0	0	7014.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7014.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LTT2	A0A6L2LTT2_TANCI	Uncharacterized protein	Tci_035523	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MSGKVCK	tr|A0A6L2LTT2|A0A6L2LTT2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_035523 PE=4 SV=1;tr|A0A6L2LP18|A0A6L2LP18_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_0355	0.91235	1.378	0	4779.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4779.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LTT5	A0A6L2LTT5_TANCI	Putative reverse transcriptase domain-containing protein	Tci_036527	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	RCVAQVR	tr|A0A6L2LTT5|A0A6L2LTT5_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_036527 PE=4 SV=1	0.8948	1.378	46483	0	0	0	0	0	46483	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LU17	A0A6L2LU17_TANCI	Retrotrans_gag domain-containing protein	Tci_037291	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		HGSYHHR	tr|A0A6L2LU17|A0A6L2LU17_TANCI Retrotrans_gag domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_037291 PE=4 SV=1;tr|A0A699RZA9|A0A699RZA9_TANCI Transposon Ty3-G Gag-Pol polyprotein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=	0.89476	1.378	356390	32204	0	287670	0	0	0	0	356390	0	0	0	0	0	0	0	0	0	32204	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	287670	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LUF4	A0A6L2LUF4_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_036565	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	APSGQSS	tr|A0A6L2LUF4|A0A6L2LUF4_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_036565 PE=4 SV=1	0.87059	1.378	63678	77452	91014	67438	12861	40691	42713	45448	59287	63678	0	0	46448	38276	36081	0	0	58682	77452	0	46527	49783	0	0	27976	0	0	0	79314	88151	91014	90665	45941	43234	0	67438	0	0	0	0	0	0	0	10969	0	0	5561.7	12861	0	0
A0A6L2LUF5	A0A6L2LUF5_TANCI	Gag-Pol polyprotein	Tci_037216	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	MTRLPNR	tr|A0A6L2LUF5|A0A6L2LUF5_TANCI Gag-Pol polyprotein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_037216 PE=4 SV=1	0.89322	1.378	19228	0	0	0	0	0	0	0	0	0	0	19228	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LVG7	A0A6L2LVG7_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_037781	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	PPILPKK	tr|A0A6L2LVG7|A0A6L2LVG7_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_037781 PE=4 SV=1	0.89369	1.378	29285	20280	11790	22411	17972	0	0	0	29285	27793	0	0	0	0	0	0	0	0	0	0	0	20280	14903	0	11790	0	0	0	0	0	0	0	22411	0	0	0	0	0	0	0	0	11709	0	17972	0	0	10466	0	0	0
A0A6L2LVK8	A0A6L2LVK8_TANCI	Uncharacterized protein	Tci_036995	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					IILPHSR	tr|A0A6L2LVK8|A0A6L2LVK8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_036995 PE=4 SV=1	0.89298	1.378	9031.1	0	0	0	0	7562.8	7330.5	9031.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LVW6	A0A6L2LVW6_TANCI	Reverse transcriptase domain-containing protein	Tci_037247	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	LLNDDPF	tr|A0A6L2LVW6|A0A6L2LVW6_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_037247 PE=4 SV=1;tr|A0A6L2J711|A0A6L2J711_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118	0.87747	1.378	0	0	17652	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17652	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LW19	A0A6L2LW19_TANCI	Uncharacterized protein	Tci_037145	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KPSVPFR	tr|A0A6L2LW19|A0A6L2LW19_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_037145 PE=4 SV=1	0.89302	1.378	8242.8	0	0	6283	0	0	6713.1	0	0	0	0	0	8242.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6283	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LX33	A0A6L2LX33_TANCI	Uncharacterized protein	Tci_036703	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	GMKSNFK	tr|A0A6L2LX33|A0A6L2LX33_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_036703 PE=4 SV=1	0.78261	2.756	0	8734.7	313800	10935	10986	0	0	0	0	0	0	0	0	0	0	7797	8734.7	0	0	0	0	0	0	308060	0	313800	0	0	10133	0	0	0	0	0	8386	0	10935	8090.5	9423.1	7638.2	0	10986	0	0	0	0	5195.8	0	0	0
A0A6L2LX57	A0A6L2LX57_TANCI	Reverse transcriptase domain-containing protein	Tci_038321	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	HGDSSDR	tr|A0A6L2LX57|A0A6L2LX57_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_038321 PE=4 SV=1;tr|A0A699MEN7|A0A699MEN7_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifo	0.87209	1.7526	0	209930	0	0	0	0	0	0	0	0	0	0	0	0	209930	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LY44	A0A6L2LY44_TANCI	Uncharacterized protein	Tci_037300	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RPTKPAR	tr|A0A6L2LY44|A0A6L2LY44_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_037300 PE=4 SV=1	0.89844	1.378	0	0	0	0	23033	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23033	0	0	0
A0A6L2LYU9	A0A6L2LYU9_TANCI	Uncharacterized protein	Tci_038297	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QRAPGNTR	tr|A0A6L2LYU9|A0A6L2LYU9_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_038297 PE=4 SV=1	0.81034	2.156	0	0	19553	0	6343.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19553	0	0	0	0	0	0	0	0	0	0	0	0	0	6343.9	0	0	0	0	0	0
A0A6L2LYV9	A0A6L2LYV9_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_038448	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KKTIMYR	tr|A0A6L2LYV9|A0A6L2LYV9_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_038448 PE=4 SV=1	0.90222	1.378	0	25922	0	24515	0	0	0	0	0	0	0	0	0	0	0	0	0	25922	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24515	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LYZ3	A0A6L2LYZ3_TANCI	Uncharacterized protein	Tci_038991	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NNTTIHR	tr|A0A6L2LYZ3|A0A6L2LYZ3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_038991 PE=4 SV=1	0.89886	1.378	0	20182	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20182	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2LZT9	A0A6L2LZT9_TANCI	Uncharacterized protein	Tci_037792	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PLPLLLK	tr|A0A6L2LZT9|A0A6L2LZT9_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_037792 PE=4 SV=1	0.90134	1.378	13242	5498.1	0	0	0	0	2173.2	0	0	6058.4	0	13242	0	0	0	0	0	5498.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2M014	A0A6L2M014_TANCI	Uncharacterized protein	Tci_038525	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VQIVIIK	tr|A0A6L2M014|A0A6L2M014_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_038525 PE=4 SV=1	0.90218	1.378	0	0	0	73326	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	73326	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2M0N2	A0A6L2M0N2_TANCI	Integrase catalytic domain-containing protein	Tci_038755	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	RAQNFRR	tr|A0A6L2M0N2|A0A6L2M0N2_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_038755 PE=4 SV=1	0.9036	1.378	0	0	14375	14374	7657.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14375	0	0	0	0	0	0	0	0	14374	0	0	0	0	0	0	0	0	0	7657.4	0	0	0	0	0	0
A0A6L2M132	A0A6L2M132_TANCI	Uncharacterized protein	Tci_038250	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	KNFHGPR	tr|A0A6L2M132|A0A6L2M132_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_038250 PE=4 SV=1;tr|A0A6L2LIF3|A0A6L2LIF3_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 	0.92058	1.378	0	0	0	1970500	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1970500	0	0	0	0	0	0	0	0	0	0
A0A6L2M162	A0A6L2M162_TANCI	"Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic"	Tci_039734	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	KNIWKHK	"tr|A0A6L2M162|A0A6L2M162_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic OS=Tanacetum cinerariifolium OX=118510 GN=Tci_039734 PE=4 SV=1"	0.88353	1.378	10900	12522	11435	10115	8850.8	2504.8	0	0	0	0	0	0	0	10900	0	0	0	12522	0	0	0	0	0	0	0	0	0	0	0	11435	0	0	10115	0	0	0	0	0	0	0	0	0	0	8850.8	0	0	0	0	0	0
A0A6L2M1E0	A0A6L2M1E0_TANCI	Uncharacterized protein	Tci_039824	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					IPLRITVQKAVQK	tr|A0A6L2M1E0|A0A6L2M1E0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_039824 PE=4 SV=1;tr|A0A699L690|A0A699L690_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_694987 PE=4 SV=1	0.90227	1.378	0	0	29748	37400	40533	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17899	0	0	29748	0	0	0	0	0	37400	0	0	27593	0	0	0	0	40533	0	0	0	0	0	0	0
A0A6L2M1Q4	A0A6L2M1Q4_TANCI	Reverse transcriptase Ty1/copia-type domain-containing protein	Tci_039347	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RPELDNR	tr|A0A6L2M1Q4|A0A6L2M1Q4_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_039347 PE=4 SV=1	0.90231	1.378	0	0	11607	12420	7717.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10565	0	0	11607	0	0	0	0	0	0	0	0	0	12420	0	0	0	0	0	0	0	7717.2	0	0	0
A0A6L2M1Q8	A0A6L2M1Q8_TANCI	Zinc knuckle CX2CX4HX4C	Tci_039468	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VHNAGAR	tr|A0A6L2M1Q8|A0A6L2M1Q8_TANCI Zinc knuckle CX2CX4HX4C OS=Tanacetum cinerariifolium OX=118510 GN=Tci_039468 PE=4 SV=1	0.90273	1.378	0	8204.7	19926	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8204.7	0	0	0	0	19926	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2M1Z3	A0A6L2M1Z3_TANCI	Ribonuclease H-like domain-containing protein	Tci_040011	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	MMSIVFK	tr|A0A6L2M1Z3|A0A6L2M1Z3_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_040011 PE=4 SV=1	0.90314	1.378	0	0	12216	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12216	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2M2F9	A0A6L2M2F9_TANCI	CCHC-type domain-containing protein	Tci_040184	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	NHIKGCK	tr|A0A6L2M2F9|A0A6L2M2F9_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_040184 PE=4 SV=1	0.9024	1.378	0	0	6018.7	8828.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6018.7	0	0	0	0	0	0	0	0	0	0	8828.2	0	0	0	0	0	0	0	0	0	0
A0A6L2M2I5	A0A6L2M2I5_TANCI	Uncharacterized protein	Tci_040214	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NNRRWAR	tr|A0A6L2M2I5|A0A6L2M2I5_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_040214 PE=4 SV=1	0.89928	1.378	0	18214	0	0	0	0	0	0	0	0	0	0	0	0	0	13407	0	0	0	18214	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2M2Z3	A0A6L2M2Z3_TANCI	"RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein"	Tci_040356	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	VHRPKIR	"tr|A0A6L2M2Z3|A0A6L2M2Z3_TANCI RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_040356 PE=4 SV=1"	0.90013	1.378	0	4334.5	2911.6	0	5631.9	0	0	0	0	0	0	0	0	0	0	1468	0	0	0	3108.9	4334.5	0	0	0	0	2911.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5631.9	0	0	0	0	0	0	0	0
A0A6L2M3T8	A0A6L2M3T8_TANCI	Reverse transcriptase domain-containing protein	Tci_039845	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	WHSQVAK	tr|A0A6L2M3T8|A0A6L2M3T8_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_039845 PE=4 SV=1	0.90055	1.378	0	34428	18822	0	0	0	0	0	0	0	0	0	0	0	0	34428	0	0	0	0	0	0	0	0	0	0	0	0	18822	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2M406	A0A6L2M406_TANCI	Uncharacterized protein	Tci_040706	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LKDQSHK	tr|A0A6L2M406|A0A6L2M406_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_040706 PE=4 SV=1	0.90097	1.378	23991	36657	20581	0	19136	0	0	0	0	21798	0	23991	0	0	0	0	0	0	36657	0	0	24666	0	0	0	0	0	0	0	20581	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19136
A0A6L2M465	A0A6L2M465_TANCI	Uncharacterized protein	Tci_040794	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VVSKPVK	tr|A0A6L2M465|A0A6L2M465_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_040794 PE=4 SV=1	0.90143	1.378	24938	19094	18159	18316	0	0	0	0	0	0	24938	0	0	0	0	0	0	0	0	19094	0	0	0	0	0	0	18159	0	0	0	0	0	0	0	18316	0	0	0	3589.1	0	0	0	0	0	0	0	0	0	0	0
A0A6L2M494	A0A6L2M494_TANCI	Ribonuclease H-like domain-containing protein	Tci_039392	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	GYDLFIK	tr|A0A6L2M494|A0A6L2M494_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_039392 PE=4 SV=1	0.90185	1.378	70841	48686	0	2914500	68453	0	0	0	0	0	70841	0	0	0	0	0	0	0	0	48686	33405	0	0	0	0	0	0	0	0	0	0	0	0	0	66670	2914500	0	0	0	0	38190	68453	0	0	0	0	0	0	0	0
A0A6L2M4I0	A0A6L2M4I0_TANCI	Reverse transcriptase domain-containing protein	Tci_039482	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	GENNGDM	tr|A0A6L2M4I0|A0A6L2M4I0_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_039482 PE=4 SV=1	0.90189	1.378	6354.9	7905.5	7132.2	6481.2	0	0	0	6354.9	0	0	0	0	0	0	0	0	7905.5	0	0	0	0	0	0	0	0	7132.2	0	0	0	0	0	0	0	0	0	0	0	6481.2	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2M4K6	A0A6L2M4K6_TANCI	Putative reverse transcriptase domain-containing protein	Tci_039243	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	RALLYKK	tr|A0A6L2M4K6|A0A6L2M4K6_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_039243 PE=4 SV=1	0.90232	1.378	6612.5	18384	17136	9470.3	17648	0	0	0	0	0	6612.5	0	0	0	0	10554	0	0	0	18384	0	0	0	0	0	0	7221.1	0	17136	0	0	0	0	0	0	0	0	5714.9	9470.3	0	0	0	17648	0	0	0	0	0	0	0
A0A6L2M4X3	A0A6L2M4X3_TANCI	Ribonuclease H-like domain-containing protein	Tci_040979	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	SWYETLDTYLLENRFQR	tr|A0A6L2M4X3|A0A6L2M4X3_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_040979 PE=4 SV=1	0.85769	1.378	9780.7	0	0	0	0	0	0	0	0	9780.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2M576	A0A6L2M576_TANCI	Integrase catalytic domain-containing protein	Tci_040748	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	GSCCYDM	tr|A0A6L2M576|A0A6L2M576_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_040748 PE=4 SV=1;tr|A0A699MFU2|A0A699MFU2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_745379 PE=4 SV=	0.87066	1.378	88947	67201	99446	0	151870	0	69016	0	0	0	0	0	0	88947	0	63771	0	0	0	0	67201	0	0	0	0	0	0	0	0	0	0	99446	0	0	0	0	0	0	0	0	0	0	0	151870	0	0	0	0	0	81358
A0A6L2M6H0	A0A6L2M6H0_TANCI	Ribonuclease H-like domain-containing protein (Fragment)	Tci_041594	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					YCEYYDK	tr|A0A6L2M6H0|A0A6L2M6H0_TANCI Ribonuclease H-like domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_041594 PE=4 SV=1	0.76471	2.5533	0	0	0	18481	10528	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18481	0	0	0	0	0	0	0	0	0	10528	0	0	0	0	0
A0A6L2M738	A0A6L2M738_TANCI	Reverse transcriptase Ty1/copia-type domain-containing protein (Fragment)	Tci_041729	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		FLLPRCK	tr|A0A6L2M738|A0A6L2M738_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_041729 PE=4 SV=1	0.8308	1.378	52331	66078	84807	67418	47925	52331	38614	0	0	0	24220	0	21631	18670	18666	55826	49858	0	0	66078	22720	28272	0	20147	37209	20987	0	0	84807	0	0	0	0	0	67418	0	0	24020	49415	34332	43401	47925	0	0	15601	0	16819	27417	44163	0
A0A6L2M7I8	A0A6L2M7I8_TANCI	Uncharacterized protein	Tci_040560	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DPSAGSD	tr|A0A6L2M7I8|A0A6L2M7I8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_040560 PE=4 SV=1;tr|A0A5N6PXQ6|A0A5N6PXQ6_9ASTR Peptidyl-prolyl cis-trans isomerase OS=Mikania micrantha OX=192012 GN=E3N88_04954 PE=4 SV=1;tr|A0A5N6LH85|A	0.82353	2.118	0	0	3838.1	0	4071	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3838.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4071	0	0
A0A6L2M7Z7	A0A6L2M7Z7_TANCI	Uncharacterized protein	Tci_042039	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KGNENRK	tr|A0A6L2M7Z7|A0A6L2M7Z7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_042039 PE=4 SV=1;tr|A0A6L2LB73|A0A6L2LB73_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_030989 PE=4 SV=1	0.88889	1.378	0	4101	0	0	0	0	0	0	0	0	0	0	0	0	4101	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2M8Q9	A0A6L2M8Q9_TANCI	Putative reverse transcriptase domain-containing protein	Tci_041595	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	YCATYSR	tr|A0A6L2M8Q9|A0A6L2M8Q9_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_041595 PE=4 SV=1	0.83177	1.378	168020	0	0	0	0	0	0	0	0	0	0	168020	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2M8R5	A0A6L2M8R5_TANCI	Integrase catalytic domain-containing protein	Tci_041837	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	GHPKGGK	tr|A0A6L2M8R5|A0A6L2M8R5_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_041837 PE=4 SV=1	0.89778	1.378	112740	76440	104180	61119	25486	56178	71557	57250	0	111440	0	112740	0	45254	0	0	0	0	72029	0	0	42915	76440	0	0	70873	66765	80080	0	0	104180	0	0	61119	0	0	0	0	0	0	0	0	0	0	0	0	0	25486	0	0
A0A6L2M9E7	A0A6L2M9E7_TANCI	CCHC-type domain-containing protein	Tci_042651	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	MLLKIHK	tr|A0A6L2M9E7|A0A6L2M9E7_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_042651 PE=4 SV=1	0.8346	1.378	5859.8	0	0	0	0	4830.5	0	3800.2	0	0	0	0	5859.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2M9Q3	A0A6L2M9Q3_TANCI	Uncharacterized protein	Tci_042616	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GIMPPAK	tr|A0A6L2M9Q3|A0A6L2M9Q3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_042616 PE=4 SV=1	0.83318	1.378	40967	44843	76353	19084	25705	31075	0	34078	0	0	0	0	40967	0	0	0	0	44843	41674	0	0	18567	12071	69847	66561	76353	0	0	0	33151	25324	36852	0	19084	0	0	0	0	0	0	0	0	0	0	0	25705	0	0	23880	0
A0A6L2M9R2	A0A6L2M9R2_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_042626	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	CFENDHTYVACLKGKQHK	tr|A0A6L2M9R2|A0A6L2M9R2_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_042626 PE=4 SV=1	0.74286	2.4998	0	0	0	638160	21583	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	638160	0	0	0	0	0	21583	0	0	0
A0A6L2MAJ3	A0A6L2MAJ3_TANCI	MULE domain-containing protein	Tci_042245	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PMHLVFR	tr|A0A6L2MAJ3|A0A6L2MAJ3_TANCI MULE domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_042245 PE=4 SV=1;tr|A0A6L2LDT1|A0A6L2LDT1_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=T	0.91239	1.378	8642	9966.3	0	0	8382.3	0	0	0	8642	6397.3	0	0	0	7333.3	0	0	0	9712.7	0	0	0	9966.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8382.3	0
A0A6L2MAS4	A0A6L2MAS4_TANCI	"Retrotransposon protein, putative, Ty1-copia subclass"	Tci_043094	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	ECAGDNK	"tr|A0A6L2MAS4|A0A6L2MAS4_TANCI Retrotransposon protein, putative, Ty1-copia subclass OS=Tanacetum cinerariifolium OX=118510 GN=Tci_043094 PE=4 SV=1"	0.83363	1.378	0	0	11131	14420	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11131	0	0	0	0	0	0	0	0	0	0	14420	0	0	0	0	0	0	0	0	0	0
A0A6L2MBM6	A0A6L2MBM6_TANCI	Ribonuclease H-like domain-containing protein	Tci_042635	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KPKPNCR	"tr|A0A6L2MBM6|A0A6L2MBM6_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_042635 PE=4 SV=1;tr|A0A6L2M8Z1|A0A6L2M8Z1_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic OS"	0.83266	1.378	0	0	0	17769	9824.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13174	17769	0	0	0	0	0	0	9824.9	0	0
A0A6L2MBR5	A0A6L2MBR5_TANCI	DUF4218 domain-containing protein	Tci_043286	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GDDGGHR	tr|A0A6L2MBR5|A0A6L2MBR5_TANCI DUF4218 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_043286 PE=4 SV=1	0.82983	1.378	0	8584.2	0	17242	0	0	0	0	0	0	0	0	0	0	0	0	8584.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17242	0	8739.8	0	0	0	0	0	0	0	0	0	0
A0A6L2MCF2	A0A6L2MCF2_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_043661	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TIVQHKK	tr|A0A6L2MCF2|A0A6L2MCF2_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_043661 PE=4 SV=1;tr|A0A6L2NKH3|A0A6L2NKH3_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetu	0.82976	1.378	0	0	8973.1	6531.2	6089.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4749.6	0	0	0	0	0	0	8973.1	6531.2	3929.4	0	0	0	0	0	0	0	0	0	0	0	0	0	6089.1	5569.8	0
A0A6L2MF10	A0A6L2MF10_TANCI	Potassium transporter 5-like	Tci_044554	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; potassium ion transmembrane transporter activity [GO:0015079]	potassium ion transmembrane transporter activity [GO:0015079]	ECSRPEM	tr|A0A6L2MF10|A0A6L2MF10_TANCI Potassium transporter 5-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_044554 PE=3 SV=1	0.82864	1.378	30521	0	32385	0	99217	0	0	0	0	0	30521	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32385	0	0	0	0	0	0	0	0	0	0	0	0	0	99217	0	0	0	0	0	0	0	0
A0A6L2MG13	A0A6L2MG13_TANCI	Gag-Pol polyprotein	Tci_044846	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QSHKASK	tr|A0A6L2MG13|A0A6L2MG13_TANCI Gag-Pol polyprotein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_044846 PE=4 SV=1	0.82887	1.378	0	0	38397	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38397	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MGG1	A0A6L2MGG1_TANCI	Putative Gag-Pol polyprotein	Tci_045051	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ECAKELK	tr|A0A6L2MGG1|A0A6L2MGG1_TANCI Putative Gag-Pol polyprotein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_045051 PE=4 SV=1	0.82931	1.378	0	0	0	0	45505	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	45505	0	0	0	0	0	0
A0A6L2MGK4	A0A6L2MGK4_TANCI	"RNA-directed DNA polymerase, eukaryota"	Tci_043592	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	VEVYSDK	"tr|A0A6L2MGK4|A0A6L2MGK4_TANCI RNA-directed DNA polymerase, eukaryota OS=Tanacetum cinerariifolium OX=118510 GN=Tci_043592 PE=4 SV=1"	0.83549	1.378	0	0	16021	12695	6912.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16021	0	0	0	0	0	0	12695	0	0	0	8315.6	0	0	0	6912.3	0	0	0	0	0	0	0
A0A6L2MGT1	A0A6L2MGT1_TANCI	PMEI domain-containing protein	Tci_045154	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			enzyme inhibitor activity [GO:0004857]	enzyme inhibitor activity [GO:0004857]	GIGLYFK	tr|A0A6L2MGT1|A0A6L2MGT1_TANCI PMEI domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_045154 PE=4 SV=1	0.84119	1.378	28864	0	0	0	0	0	0	28864	0	0	0	0	0	18006	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MJ21	A0A6L2MJ21_TANCI	Uncharacterized protein	Tci_045939	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					CSCTGDM	tr|A0A6L2MJ21|A0A6L2MJ21_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_045939 PE=4 SV=1	0.84213	1.378	27984	149840	441310	89381	21387	9583.2	27984	0	0	0	0	0	14275	0	149840	0	0	0	0	0	0	0	0	0	19609	0	441310	0	0	0	16629	0	0	0	0	0	89381	0	0	0	0	0	0	0	21387	0	11553	20289	0	0
A0A6L2MJ64	A0A6L2MJ64_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_045768	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	PKPPLLK	tr|A0A6L2MJ64|A0A6L2MJ64_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_045768 PE=4 SV=1	0.90909	1.378	214410	617210	442280	222240	41322000	0	0	0	176770	0	46580	0	214410	150650	165470	291880	77756	265840	617210	219000	133510	349770	202280	63498	44475	146970	33991	442280	359520	0	101160	137150	135920	0	0	222240	156830	18742	62588	87537	101490	41322000	228320	21807	41569	22243	50005	97844	81560	29357000
A0A6L2MKD1	A0A6L2MKD1_TANCI	Reverse transcriptase domain-containing protein	Tci_046158	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	HSSGSDK	tr|A0A6L2MKD1|A0A6L2MKD1_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_046158 PE=4 SV=1	0.78947	2.4106	0	17911	0	11744	0	0	0	0	0	0	0	0	0	0	17911	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11744	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MKG3	A0A6L2MKG3_TANCI	CCHC-type domain-containing protein	Tci_044743	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	QKMLLIR	tr|A0A6L2MKG3|A0A6L2MKG3_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_044743 PE=4 SV=1	0.84035	1.378	0	0	7462.1	0	11574	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7462.1	0	0	0	0	0	0	0	0	0	0	0	0	11574	0	0	0	0	0	0	0	0
A0A6L2MKL5	A0A6L2MKL5_TANCI	Uncharacterized protein	Tci_045907	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DECVPCK	tr|A0A6L2MKL5|A0A6L2MKL5_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_045907 PE=4 SV=1	0.8408	1.378	0	0	0	0	8253.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8253.7	0	0	0	0	0	0
A0A6L2MMV3	A0A6L2MMV3_TANCI	Reverse transcriptase domain-containing protein	Tci_045623	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	HGCHGNK	tr|A0A6L2MMV3|A0A6L2MMV3_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_045623 PE=4 SV=1	0.83645	1.378	0	0	0	23931	43543	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23931	0	0	0	0	0	43543	0	0	0	0	0	0	0	0
A0A6L2MN71	A0A6L2MN71_TANCI	Integrase catalytic domain-containing protein	Tci_047434	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	NIIPVNK	tr|A0A6L2MN71|A0A6L2MN71_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_047434 PE=4 SV=1	0.83697	1.378	0	0	4169	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4169	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MN76	A0A6L2MN76_TANCI	"Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic"	Tci_047459	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					YLYDSWKGRMELYMQNR	"tr|A0A6L2MN76|A0A6L2MN76_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic OS=Tanacetum cinerariifolium OX=118510 GN=Tci_047459 PE=4 SV=1"	0.88739	1.378	0	0	372810	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	372810	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MNZ8	A0A6L2MNZ8_TANCI	Gag-Pol polyprotein	Tci_047428	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	VFKVGLK	tr|A0A6L2MNZ8|A0A6L2MNZ8_TANCI Gag-Pol polyprotein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_047428 PE=4 SV=1	0.83831	1.378	19577	40790	44139	34257	16610	0	19577	14500	0	0	0	0	0	0	30030	0	20599	40790	0	0	26988	0	0	0	0	34735	0	0	0	0	44139	0	0	0	0	33611	20514	29113	0	34257	0	0	0	0	0	0	16610	0	0	0
A0A6L2MPZ6	A0A6L2MPZ6_TANCI	Putative ribonuclease H-like domain-containing protein	Tci_047798	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	LPPKGNK	tr|A0A6L2MPZ6|A0A6L2MPZ6_TANCI Putative ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_047798 PE=4 SV=1	0.8392	1.378	0	5446.8	0	0	1293.7	0	0	0	0	0	0	0	0	0	0	1659.5	0	0	0	5446.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1293.7	0	0	0
A0A6L2MQ80	A0A6L2MQ80_TANCI	Uncharacterized protein	Tci_046920	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LKAAPPK	tr|A0A6L2MQ80|A0A6L2MQ80_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_046920 PE=4 SV=1	0.90265	1.378	20103	14395	13530	7747.7	5153.6	20103	0	18192	0	0	0	0	0	0	0	0	0	0	14395	0	0	0	0	0	0	0	0	0	13530	0	0	0	0	0	0	0	0	0	7747.7	0	0	0	0	0	0	0	5153.6	0	0	0
A0A6L2MQE2	A0A6L2MQE2_TANCI	Reverse transcriptase Ty1/copia-type domain-containing protein	Tci_046503	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					STSEEPR	tr|A0A6L2MQE2|A0A6L2MQE2_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_046503 PE=4 SV=1	0.84098	1.378	373030	0	662960	0	0	373030	0	0	0	0	0	0	0	22950	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	662960	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MQI3	A0A6L2MQI3_TANCI	Putative reverse transcriptase domain-containing protein	Tci_048201	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	ARVLPPK	tr|A0A6L2MQI3|A0A6L2MQI3_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_048201 PE=4 SV=1;tr|A0A699HSC3|A0A699HSC3_TANCI Zf-CCHC domain-containing protein/UBN2 domain-containing protein OS=Tanace	0.82833	1.378	12775	7521.2	0	0	7854.4	12775	9023.7	0	0	0	0	0	11932	0	0	7521.2	0	0	0	0	7156.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7854.4	0	0	0	6596.3	0	0	0	0
A0A6L2MQK5	A0A6L2MQK5_TANCI	"Butyrate--CoA ligase AAE11, peroxisomal-like"	Tci_046573	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			"hydrolase activity, acting on ester bonds [GO:0016788]; ligase activity [GO:0016874]"	"hydrolase activity, acting on ester bonds [GO:0016788]; ligase activity [GO:0016874]"	KQALFFK	"tr|A0A6L2MQK5|A0A6L2MQK5_TANCI Butyrate--CoA ligase AAE11, peroxisomal-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_046573 PE=4 SV=1;tr|A0A699J4Q8|A0A699J4Q8_TANCI RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain prot"	0.88362	1.378	0	0	0	0	13311	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13311	0	0	0	0	0	0
A0A6L2MQY0	A0A6L2MQY0_TANCI	Reverse transcriptase Ty1/copia-type domain-containing protein	Tci_048351	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GGHDGSR	tr|A0A6L2MQY0|A0A6L2MQY0_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_048351 PE=4 SV=1	0.82119	1.378	0	0	0	4357	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4357	0	0	0	0	0	0	0	0	0	0
A0A6L2MR56	A0A6L2MR56_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_048441	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					CMVDQSM	tr|A0A6L2MR56|A0A6L2MR56_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_048441 PE=4 SV=1	0.8218	1.378	40065	0	0	0	0	0	0	0	0	0	0	40065	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MRA4	A0A6L2MRA4_TANCI	Reverse transcriptase domain-containing protein	Tci_048248	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	VSLDTYK	tr|A0A6L2MRA4|A0A6L2MRA4_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_048248 PE=4 SV=1	0.82225	1.378	16146	0	0	0	0	0	16146	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MRB5	A0A6L2MRB5_TANCI	Putative ribonuclease H-like domain-containing protein	Tci_048494	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PHIVVKK	tr|A0A6L2MRB5|A0A6L2MRB5_TANCI Putative ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_048494 PE=4 SV=1	0.94558	1.378	18852	17094	17995	21917	17944	0	17590	0	0	0	0	0	18852	0	0	0	0	0	0	0	0	17094	0	0	0	0	0	0	0	0	17995	0	0	0	0	21917	0	0	0	0	0	0	0	0	0	17944	0	0	0	0
A0A6L2MRH3	A0A6L2MRH3_TANCI	Xylulose kinase-1	Tci_047945	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			kinase activity [GO:0016301]	kinase activity [GO:0016301]	LKLFRVK	tr|A0A6L2MRH3|A0A6L2MRH3_TANCI Xylulose kinase-1 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_047945 PE=4 SV=1;tr|A0A6L2K361|A0A6L2K361_TANCI Putative ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_014453 PE=4 	0.8845	1.378	0	0	0	27884	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27884	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MS63	A0A6L2MS63_TANCI	Calcium-dependent protein kinase 19-like	Tci_047510	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; protein serine/threonine kinase activity [GO:0004674]	MKHELAK	tr|A0A6L2MS63|A0A6L2MS63_TANCI Calcium-dependent protein kinase 19-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_047510 PE=3 SV=1	0.82406	1.378	39936	25609	0	0	0	0	0	0	39936	0	0	30200	0	0	0	0	0	17559	0	0	0	0	25609	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MSG6	A0A6L2MSG6_TANCI	Uncharacterized protein	Tci_048255	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					CAKIHNK	tr|A0A6L2MSG6|A0A6L2MSG6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_048255 PE=4 SV=1	0.82028	1.378	0	0	0	2257	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2257	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MSJ4	A0A6L2MSJ4_TANCI	Reverse transcriptase domain-containing protein	Tci_047650	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	CSPDGKK	tr|A0A6L2MSJ4|A0A6L2MSJ4_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_047650 PE=4 SV=1	0.81983	1.378	508060	428250	302360	355560	312650	378300	384590	309900	341840	354150	0	386770	508060	348780	0	0	0	0	0	348040	0	0	428250	0	65397	0	0	296080	289590	302360	0	0	279320	0	287870	298810	306040	355560	346940	0	0	0	312650	0	0	0	0	0	0	0
A0A6L2MSK2	A0A6L2MSK2_TANCI	"RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein"	Tci_048934	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	KPIPNCK	"tr|A0A6L2MSK2|A0A6L2MSK2_TANCI RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_048934 PE=4 SV=1"	0.81377	1.378	0	30178	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30178	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MSK7	A0A6L2MSK7_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_048327	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	MDIDYER	tr|A0A6L2MSK7|A0A6L2MSK7_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_048327 PE=4 SV=1	0.9396	1.378	0	0	5674.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5674.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MSP0	A0A6L2MSP0_TANCI	BAHD acyltransferase DCR	Tci_048778	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	"acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]"	HVPFASK	tr|A0A6L2MSP0|A0A6L2MSP0_TANCI BAHD acyltransferase DCR OS=Tanacetum cinerariifolium OX=118510 GN=Tci_048778 PE=3 SV=1	0.81423	1.378	135650	0	0	0	0	135650	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MT02	A0A6L2MT02_TANCI	Histone H2A	Tci_048908	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		nucleosome [GO:0000786]; nucleus [GO:0005634]	nucleosome [GO:0000786]; nucleus [GO:0005634]; DNA binding [GO:0003677]; protein heterodimerization activity [GO:0046982]	DNA binding [GO:0003677]; protein heterodimerization activity [GO:0046982]	GKSAADM	tr|A0A6L2MT02|A0A6L2MT02_TANCI Histone H2A OS=Tanacetum cinerariifolium OX=118510 GN=Tci_048908 PE=3 SV=1	0.81431	1.378	0	56765	20110	0	45551	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28969	56765	0	0	20110	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	45551	0	0	0	0	0	0	0	0
A0A6L2MT66	A0A6L2MT66_TANCI	Reverse transcriptase domain-containing protein	Tci_047880	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	VEVDMMR	tr|A0A6L2MT66|A0A6L2MT66_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_047880 PE=4 SV=1	0.81476	1.378	0	52923	0	117310	0	0	0	0	0	0	0	0	0	0	0	0	52923	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	117310	95190	0	0	0	0	0	0	0	0	0
A0A6L2MTI4	A0A6L2MTI4_TANCI	Auxilin-like protein	Tci_048615	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	protein glycosylation [GO:0006486]		glycosyltransferase activity [GO:0016757]; protein glycosylation [GO:0006486]	glycosyltransferase activity [GO:0016757]	LMIPLFLVDVICLVRRK	tr|A0A6L2MTI4|A0A6L2MTI4_TANCI Auxilin-like protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_048615 PE=4 SV=1	0.8961	1.378	15509	53892	67396	37162	42935	15509	0	0	0	12560	0	0	13094	0	0	9342.1	53892	0	0	0	0	0	0	0	9771.8	14719	0	0	67396	0	0	0	0	11081	0	0	0	0	0	0	37162	0	42935	0	0	16075	13746	0	0	0
A0A6L2MTK1	A0A6L2MTK1_TANCI	Reverse transcriptase domain-containing protein	Tci_049118	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	GVFSTTR	tr|A0A6L2MTK1|A0A6L2MTK1_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_049118 PE=4 SV=1	0.81567	1.378	8687.1	5801.7	7456.9	5774	0	8364.5	0	8687.1	0	0	0	0	0	0	0	0	5801.7	0	0	0	0	0	0	5427.2	0	0	0	0	7456.9	0	0	0	0	0	0	0	0	0	5774	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MUA0	A0A6L2MUA0_TANCI	Putative ribonuclease H-like domain-containing protein	Tci_047923	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	AWYETLANYLLANGFQR	tr|A0A6L2MUA0|A0A6L2MUA0_TANCI Putative ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_047923 PE=4 SV=1;tr|A0A699JN73|A0A699JN73_TANCI Uncharacterized mitochondrial protein AtMg00810-like (Fragment) OS=Tanacetum	0.9	1.378	0	0	0	0	11990	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11990	0	0	0
A0A6L2MUG7	A0A6L2MUG7_TANCI	Uncharacterized protein	Tci_049609	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	DEEDGSK	tr|A0A6L2MUG7|A0A6L2MUG7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_049609 PE=4 SV=1	0.81658	1.378	0	10480	0	0	10629	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10480	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10629	0	0	0	0	0
A0A6L2MVD0	A0A6L2MVD0_TANCI	Uncharacterized protein	Tci_049778	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KVPKECR	tr|A0A6L2MVD0|A0A6L2MVD0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_049778 PE=4 SV=1	0.81711	1.378	0	956150	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	956150	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MVR8	A0A6L2MVR8_TANCI	Uncharacterized protein	Tci_048443 Tci_053686	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VQLDDDK	tr|A0A6L2MVR8|A0A6L2MVR8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_048443 PE=4 SV=1	0.81938	1.378	0	0	0	18716	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18716	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MVV0	A0A6L2MVV0_TANCI	CASP-like protein	Tci_048880	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	cell wall organization [GO:0071555]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; cell wall organization [GO:0071555]		HAQQNMM	tr|A0A6L2MVV0|A0A6L2MVV0_TANCI CASP-like protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_048880 PE=3 SV=1	0.82512	1.378	11292	10587	0	5892.9	0	0	0	0	0	0	0	0	11292	0	0	0	0	0	10587	0	0	0	0	0	0	0	0	0	0	0	0	0	5892.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MW02	A0A6L2MW02_TANCI	Uncharacterized protein	Tci_050021	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ESLCQEQYVKSQYRCEK	tr|A0A6L2MW02|A0A6L2MW02_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_050021 PE=4 SV=1	0.88957	1.378	5403.1	0	0	364510	2136.1	0	0	5403.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9634.6	0	0	364510	0	0	0	0	0	0	0	2136.1	0	0	0
A0A6L2MWB6	A0A6L2MWB6_TANCI	"Kinesin-like protein KIN-7D, mitochondrial"	Tci_048562	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PNVLKLK	"tr|A0A6L2MWB6|A0A6L2MWB6_TANCI Kinesin-like protein KIN-7D, mitochondrial OS=Tanacetum cinerariifolium OX=118510 GN=Tci_048562 PE=4 SV=1"	0.8278	1.378	0	0	57175	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	57175	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MWB7	A0A6L2MWB7_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_049697	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ILMEKLEGLFYAGGFTK	tr|A0A6L2MWB7|A0A6L2MWB7_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_049697 PE=4 SV=1	0.89256	1.378	0	0	0	18042	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18042	0	0	0	0	0	0	0	0	0	0
A0A6L2MWJ8	A0A6L2MWJ8_TANCI	"RNA-directed DNA polymerase, eukaryota"	Tci_050344	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	HNACNDM	"tr|A0A6L2MWJ8|A0A6L2MWJ8_TANCI RNA-directed DNA polymerase, eukaryota OS=Tanacetum cinerariifolium OX=118510 GN=Tci_050344 PE=4 SV=1;tr|A0A699HR95|A0A699HR95_TANCI RNA-directed DNA polymerase, eukaryota OS=Tanacetum cinerariifolium OX=118510 GN=Tci_438076 "	0.82675	1.378	38083	63732	47939	29418	15336	22984	0	38083	0	25477	0	35001	20184	19520	0	30122	53489	63732	0	0	27528	0	0	16752	20003	0	0	0	47939	0	25393	0	0	29418	0	27791	0	0	0	24012	17648	0	0	0	0	9993.9	7555.6	0	15336	0
A0A6L2MX92	A0A6L2MX92_TANCI	Uncharacterized protein	Tci_050594	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SWILPSA	tr|A0A6L2MX92|A0A6L2MX92_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_050594 PE=4 SV=1	0.90393	1.378	7461.3	5492.5	5499	0	9484.5	0	5869.3	7461.3	0	0	0	0	4673.6	0	0	0	0	0	0	0	0	5492.5	0	0	0	0	0	0	0	0	0	5499	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9484.5	0	0
A0A6L2MXJ1	A0A6L2MXJ1_TANCI	Putative ribonuclease H-like domain-containing protein	Tci_048952	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	MSHYAPK	tr|A0A6L2MXJ1|A0A6L2MXJ1_TANCI Putative ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_048952 PE=4 SV=1	0.82765	1.378	9129.1	7016.2	13542	8811.2	6245.1	0	0	0	0	0	0	0	9129.1	0	7016.2	0	0	0	0	0	0	0	0	11807	0	13542	0	0	0	0	0	0	0	0	0	0	8811.2	0	0	0	0	0	0	0	6245.1	0	0	0	0	0
A0A6L2MXP4	A0A6L2MXP4_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_049133	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	QDQIVQR	tr|A0A6L2MXP4|A0A6L2MXP4_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_049133 PE=4 SV=1	0.82628	1.378	0	37603	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37603	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MXT4	A0A6L2MXT4_TANCI	Uncharacterized protein	Tci_050776	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SEVIDHR	tr|A0A6L2MXT4|A0A6L2MXT4_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_050776 PE=4 SV=1	0.94853	1.378	11376	13712	13092	10295	0	0	0	0	0	0	11376	0	0	0	0	0	0	0	0	13712	0	0	0	0	0	0	13092	0	0	0	0	0	0	0	10295	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MXW8	A0A6L2MXW8_TANCI	RNase H type-1 domain-containing protein	Tci_049640	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	nucleic acid binding [GO:0003676]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	QVLVEELKEK	tr|A0A6L2MXW8|A0A6L2MXW8_TANCI RNase H type-1 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_049640 PE=4 SV=1;tr|A0A699N9G7|A0A699N9G7_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX	0.89912	1.378	8544.8	13891	7627.3	8367.9	0	6990.7	8544.8	0	0	0	0	0	7822.2	0	6089.3	0	13891	0	0	0	0	0	0	7627.3	0	0	0	0	0	0	0	0	0	8349.9	0	5419.7	0	0	0	0	8367.9	0	0	0	0	0	0	0	0	0
A0A6L2MYI9	A0A6L2MYI9_TANCI	F-box domain-containing protein (Fragment)	Tci_049413	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EARLGIFILISAAK	tr|A0A6L2MYI9|A0A6L2MYI9_TANCI F-box domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_049413 PE=4 SV=1	0.93284	1.378	0	0	0	132460	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	132460	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MYT9	A0A6L2MYT9_TANCI	Uncharacterized protein	Tci_050010	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SFGLYYVYANDGDDEIR	tr|A0A6L2MYT9|A0A6L2MYT9_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_050010 PE=4 SV=1	0.91045	1.378	27346	23668	0	27400	0	0	0	0	27346	0	0	0	0	0	0	0	0	0	23668	0	0	0	0	0	0	0	0	0	0	0	0	0	27400	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2MZF8	A0A6L2MZF8_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_050757	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	VIHKALK	tr|A0A6L2MZF8|A0A6L2MZF8_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_050757 PE=4 SV=1	0.82581	1.378	0	0	16883	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16883	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2N109	A0A6L2N109_TANCI	Reverse transcriptase domain-containing protein	Tci_051889	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	NPQPPAK	tr|A0A6L2N109|A0A6L2N109_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_051889 PE=4 SV=1	0.90308	1.378	12997	18194	0	15856	9678.3	0	0	0	5679.8	0	0	0	10504	12997	11145	14761	18194	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9774.1	0	12645	15856	0	0	0	9678.3	6354.9	0	0	0	0
A0A6L2N1D4	A0A6L2N1D4_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_050342	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	GFHYLFR	tr|A0A6L2N1D4|A0A6L2N1D4_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_050342 PE=4 SV=1	0.83504	1.378	39234	0	86972	24885	40014	0	0	0	39234	0	0	0	0	0	0	0	0	0	0	0	0	0	0	86972	16944	35390	0	0	31506	0	0	0	0	0	0	0	24885	0	24449	0	0	0	0	0	0	0	0	0	22090	40014
A0A6L2N1N8	A0A6L2N1N8_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_052104	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	DGKRATR	tr|A0A6L2N1N8|A0A6L2N1N8_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_052104 PE=4 SV=1	0.90789	1.378	0	0	5195.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5195.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2N2R6	A0A6L2N2R6_TANCI	Uncharacterized protein	Tci_052448	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	EEPLFHK	tr|A0A6L2N2R6|A0A6L2N2R6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_052448 PE=4 SV=1;tr|A0A6L2LQI0|A0A6L2LQI0_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_0	0.89649	1.378	0	65024	57607	73317	67493	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35611	65024	0	0	57607	0	0	25883	37407	0	0	0	0	0	0	73317	0	0	0	0	70678	0	24507	0	31928	0	0	67493	0	0	0
A0A6L2N306	A0A6L2N306_TANCI	"Ribonuclease H-like domain, reverse transcriptase, RNA-dependent DNA polymerase"	Tci_052579	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	AMHQREK	"tr|A0A6L2N306|A0A6L2N306_TANCI Ribonuclease H-like domain, reverse transcriptase, RNA-dependent DNA polymerase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_052579 PE=4 SV=1"	0.86751	1.378	19062	0	0	0	5129.1	19062	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5129.1	4839.3	0	0	0	0	0
A0A6L2N4D9	A0A6L2N4D9_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_053039	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	KHKGVPK	tr|A0A6L2N4D9|A0A6L2N4D9_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_053039 PE=4 SV=1	0.90909	1.378	0	7827.9	6821.8	8198.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7827.9	0	0	0	0	0	0	0	6821.8	0	0	0	0	0	0	0	0	0	0	8198.6	0	0	0	0	0	0	0	0	0	0	0
A0A6L2N4U7	A0A6L2N4U7_TANCI	Reverse transcriptase Ty1/copia-type domain-containing protein	Tci_053158	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HDNLMKK	tr|A0A6L2N4U7|A0A6L2N4U7_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_053158 PE=4 SV=1	0.86346	1.378	0	28745	16533	14572	19612	0	0	0	0	0	0	0	0	0	0	7068.5	13850	0	0	28745	0	0	0	0	0	16533	0	0	10224	0	0	0	0	0	0	0	0	0	14572	0	0	19612	0	0	0	0	0	0	0	0
A0A6L2N581	A0A6L2N581_TANCI	Rho guanyl-nucleotide exchange factor 12	Tci_052747	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		LLTRFKK	tr|A0A6L2N581|A0A6L2N581_TANCI Rho guanyl-nucleotide exchange factor 12 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_052747 PE=4 SV=1;tr|A0A699KBX8|A0A699KBX8_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_657171 PE	0.5	2.756	0	8541	15333	0	9638.6	0	0	0	0	0	0	0	0	0	0	8541	1723.9	0	0	0	0	0	0	0	0	0	0	15333	0	0	0	0	0	0	0	0	0	0	0	0	0	9638.6	0	0	0	0	0	0	0	0
A0A6L2N584	A0A6L2N584_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_053344	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VTGQHGR	tr|A0A6L2N584|A0A6L2N584_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_053344 PE=4 SV=1	0.86389	1.378	0	0	32687	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32687	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2N5A2	A0A6L2N5A2_TANCI	DUF3883 domain-containing protein (Fragment)	Tci_052777	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HARANAR	tr|A0A6L2N5A2|A0A6L2N5A2_TANCI DUF3883 domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_052777 PE=4 SV=1	0.90667	1.378	0	0	18614	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18614	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2N5M0	A0A6L2N5M0_TANCI	Uncharacterized protein	Tci_052887	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			aspartic-type endopeptidase activity [GO:0004190]; endonuclease activity [GO:0004519]; nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	aspartic-type endopeptidase activity [GO:0004190]; endonuclease activity [GO:0004519]; nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	CAKIHNK	tr|A0A6L2N5M0|A0A6L2N5M0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_052887 PE=4 SV=1	0.85366	2.2686	0	618190	0	382690	0	0	0	0	0	0	0	0	0	0	0	618190	203000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	382690	245640	0	0	0	0	0	0	0	0	0	0
A0A6L2N5T1	A0A6L2N5T1_TANCI	Uncharacterized protein	Tci_051862	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NAGGHPK	tr|A0A6L2N5T1|A0A6L2N5T1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_051862 PE=4 SV=1	0.86707	1.378	7824.5	0	12311	6995.5	10547	0	0	0	0	0	7824.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10432	12311	0	0	0	0	0	0	6995.5	0	0	0	0	0	0	10547	0	0	0	0	0	0	0	0
A0A6L2N5X8	A0A6L2N5X8_TANCI	RNase H type-1 domain-containing protein	Tci_051912	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	nucleic acid binding [GO:0003676]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	VHMPFLR	tr|A0A6L2N5X8|A0A6L2N5X8_TANCI RNase H type-1 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_051912 PE=4 SV=1	0.8657	1.378	11697	13690	0	9403.2	18256	10031	0	7546.6	9086.4	11697	0	0	0	6743	0	0	0	0	13690	0	0	0	8231.2	0	0	0	0	0	0	0	0	0	9403.2	6695.9	0	0	0	0	0	0	0	0	0	0	0	0	0	4541	0	18256
A0A6L2N6F3	A0A6L2N6F3_TANCI	Ribonuclease H-like domain-containing protein	Tci_053779	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					CRVQPAR	tr|A0A6L2N6F3|A0A6L2N6F3_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_053779 PE=4 SV=1	0.86614	1.378	0	0	0	0	39124	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	39124	0	0
A0A6L2N6H7	A0A6L2N6H7_TANCI	CCHC-type domain-containing protein	Tci_052995	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	FGNSDNR	tr|A0A6L2N6H7|A0A6L2N6H7_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_052995 PE=4 SV=1	0.75753	1.378	0	0	121950	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	121950	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2N6J3	A0A6L2N6J3_TANCI	Copia protein (Fragment)	Tci_052122	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RALYRLK	tr|A0A6L2N6J3|A0A6L2N6J3_TANCI Copia protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_052122 PE=4 SV=1	0.91538	1.378	0	0	2021.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2021.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2N6K9	A0A6L2N6K9_TANCI	Uncharacterized protein	Tci_052132	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RSDFDGM	tr|A0A6L2N6K9|A0A6L2N6K9_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_052132 PE=4 SV=1	0.8662	1.378	6110.7	9915.9	0	2986.3	0	0	0	0	0	0	0	0	0	6110.7	0	0	0	9915.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2986.3	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2N6X1	A0A6L2N6X1_TANCI	Uncharacterized protein	Tci_053959	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MMSAAGR	tr|A0A6L2N6X1|A0A6L2N6X1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_053959 PE=4 SV=1	0.7571	1.378	65341	25718	13241	16484	32032	0	22114	19744	0	65341	0	51801	59598	33462	0	0	0	0	0	0	0	0	25718	0	13241	0	0	0	0	0	0	0	16484	15080	0	0	0	0	0	0	0	0	0	32032	0	0	0	0	0	0
A0A6L2N704	A0A6L2N704_TANCI	MAK10-like protein	Tci_053946	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MVGNPQR	tr|A0A6L2N704|A0A6L2N704_TANCI MAK10-like protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_053946 PE=4 SV=1	0.86664	1.378	0	0	0	10714	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10714	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2N777	A0A6L2N777_TANCI	Uncharacterized protein	Tci_052342	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EYANYNM	tr|A0A6L2N777|A0A6L2N777_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_052342 PE=4 SV=1	0.86372	1.378	0	0	2968.7	4063.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2475.1	2968.7	0	0	0	0	0	0	0	0	4063.5	0	0	0	0	0	0	0	0	0	0	0
A0A6L2N7T0	A0A6L2N7T0_TANCI	Uncharacterized protein	Tci_053455	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	VECFNCYKNENFARECK	tr|A0A6L2N7T0|A0A6L2N7T0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_053455 PE=4 SV=1	0.91603	1.378	13746	25121	0	46851	26564	7125	13746	10775	0	0	0	0	0	0	0	9665.2	11720	25121	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	46851	0	17398	0	26564	0	4278.1	0	0	0	0	0
A0A6L2N8I1	A0A6L2N8I1_TANCI	Uncharacterized protein	Tci_053745	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DDDLEAK	tr|A0A6L2N8I1|A0A6L2N8I1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_053745 PE=4 SV=1	0.85953	1.378	27115	0	0	0	0	0	0	0	0	0	0	0	27115	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2N8I9	A0A6L2N8I9_TANCI	Uncharacterized protein	Tci_053390	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	LEKVQQM	tr|A0A6L2N8I9|A0A6L2N8I9_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_053390 PE=4 SV=1;tr|A0A699P4G6|A0A699P4G6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_805383 PE=4 SV=1;tr|A0A699HFF9|A0A699	0.89732	1.378	20937	14082	0	14924	2404.9	7421.5	0	10379	0	0	0	0	20937	0	0	0	14082	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14585	14924	0	0	0	0	0	0	0	0	0	0	2404.9	0	0
A0A6L2N8S7	A0A6L2N8S7_TANCI	DUF659 domain-containing protein	Tci_052922	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					YLWNLPK	tr|A0A6L2N8S7|A0A6L2N8S7_TANCI DUF659 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_052922 PE=4 SV=1	0.85996	1.378	5658.5	0	6418.6	0	0	4903	0	0	0	0	0	0	5658.5	0	0	0	0	0	0	0	0	0	0	4124.8	0	0	0	0	6418.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2N8W0	A0A6L2N8W0_TANCI	"Reverse transcriptase, RNA-dependent DNA polymerase"	Tci_053073	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	KKMVIIR	"tr|A0A6L2N8W0|A0A6L2N8W0_TANCI Reverse transcriptase, RNA-dependent DNA polymerase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_053073 PE=4 SV=1"	0.80633	1.378	0	0	0	0	9144.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9144.8	0	0	0	0	0	0	0	0
A0A6L2N938	A0A6L2N938_TANCI	Zinc knuckle CX2CX4HX4C	Tci_053042	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SANGGNM	tr|A0A6L2N938|A0A6L2N938_TANCI Zinc knuckle CX2CX4HX4C OS=Tanacetum cinerariifolium OX=118510 GN=Tci_053042 PE=4 SV=1	0.86003	1.378	9047.2	10231	24269	13920	6415.4	0	3322.4	0	0	0	0	0	0	9047.2	0	0	0	0	0	0	0	10231	0	0	0	0	0	0	0	0	24269	4796.9	10491	0	0	13920	0	0	0	0	0	0	0	0	0	6415.4	0	4262	0	0
A0A6L2N9C1	A0A6L2N9C1_TANCI	CCHC-type domain-containing protein	Tci_054771	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	NLGNNGR	tr|A0A6L2N9C1|A0A6L2N9C1_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_054771 PE=4 SV=1	0.80476	1.378	31110	12939	83793	22930	0	0	11613	0	31110	0	0	0	0	0	0	12939	0	0	0	0	0	0	0	0	66507	0	0	0	0	32131	83793	0	0	0	0	0	0	0	0	22930	20726	0	0	0	0	0	0	0	0	0
A0A6L2N9H2	A0A6L2N9H2_TANCI	Reverse transcriptase domain-containing protein	Tci_054237	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	GFTPMAK	tr|A0A6L2N9H2|A0A6L2N9H2_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_054237 PE=4 SV=1	0.80437	1.378	0	46623	38698	41488	51225	0	0	0	0	0	0	0	0	0	0	21475	0	0	0	46623	11674	0	0	0	0	0	38698	0	30819	0	0	0	0	0	0	0	0	0	41488	0	0	0	51225	0	0	0	0	0	0	0
A0A6L2N9U2	A0A6L2N9U2_TANCI	Reverse transcriptase domain-containing protein	Tci_053880	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	CKRAATR	tr|A0A6L2N9U2|A0A6L2N9U2_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_053880 PE=4 SV=1	0.80359	1.378	0	13424	21038	17757	24712	0	0	0	0	0	0	0	0	0	13424	9927	0	0	0	0	12434	0	0	0	0	0	0	0	21038	0	0	0	0	0	0	0	0	17757	0	0	0	24712	0	0	0	0	0	0	0	0
A0A6L2NA12	A0A6L2NA12_TANCI	Uncharacterized protein	Tci_053352	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VVHAIVR	tr|A0A6L2NA12|A0A6L2NA12_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_053352 PE=4 SV=1	0.86146	1.378	0	0	7199.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7199.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NA17	A0A6L2NA17_TANCI	"Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic"	Tci_055054	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	SKPTRNK	"tr|A0A6L2NA17|A0A6L2NA17_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic OS=Tanacetum cinerariifolium OX=118510 GN=Tci_055054 PE=4 SV=1"	0.8032	1.378	6394.4	0	0	0	0	6394.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NA48	A0A6L2NA48_TANCI	Uncharacterized protein	Tci_053990	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					RALPKNK	tr|A0A6L2NA48|A0A6L2NA48_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_053990 PE=4 SV=1	0.86234	1.378	11469	10255	0	18347	13413	2365.4	11469	0	9196	0	0	0	0	0	0	10255	0	0	0	6407.8	7863.2	0	0	0	0	0	0	0	0	0	0	0	0	0	18347	8210.9	4894.4	13301	0	8535.2	10823	0	11149	0	13413	0	0	8614.3	0	0
A0A6L2NAK1	A0A6L2NAK1_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_054607	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	VQLNAER	tr|A0A6L2NAK1|A0A6L2NAK1_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_054607 PE=4 SV=1	0.93333	1.378	450540	412540	318230	509290	272390	0	450540	0	0	0	0	0	0	0	401520	0	0	0	0	0	0	412540	0	318230	0	289300	0	0	0	0	0	274450	0	0	377130	0	509290	0	0	0	0	0	0	0	272390	261600	0	0	0	0
A0A6L2NAN3	A0A6L2NAN3_TANCI	Uncharacterized protein	Tci_055251	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PIRRGAR	tr|A0A6L2NAN3|A0A6L2NAN3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_055251 PE=4 SV=1	0.80281	1.378	0	23804	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23804	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NB92	A0A6L2NB92_TANCI	Putative reverse transcriptase domain-containing protein	Tci_054745	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	MYKDLCTFKCNAYVAMK	tr|A0A6L2NB92|A0A6L2NB92_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_054745 PE=4 SV=1	0.88446	1.378	0	143540	32790	12162	13643	0	0	0	0	0	0	0	0	0	0	0	143540	15766	0	0	25275	0	0	0	16581	32790	0	0	0	0	0	0	0	0	0	12162	10509	0	0	0	0	0	0	0	6913.9	0	0	0	13643	0
A0A6L2NBC1	A0A6L2NBC1_TANCI	Serine/threonine protein kinase SRPK1	Tci_055456	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; protein serine/threonine kinase activity [GO:0004674]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; protein serine/threonine kinase activity [GO:0004674]; zinc ion binding [GO:0008270]	QCQSSRC	tr|A0A6L2NBC1|A0A6L2NBC1_TANCI Serine/threonine protein kinase SRPK1 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_055456 PE=4 SV=1	0.80242	1.378	0	0	0	0	6794.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6794.6	0	0	0	0	0	0
A0A6L2NBJ2	A0A6L2NBJ2_TANCI	Reverse transcriptase domain-containing protein	Tci_055581	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	YVLTLLK	tr|A0A6L2NBJ2|A0A6L2NBJ2_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_055581 PE=4 SV=1	0.80203	1.378	0	0	0	9777.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3564.6	0	0	9777.7	0	0	0	0	0	0	0	0	0	0
A0A6L2NC11	A0A6L2NC11_TANCI	Reverse transcriptase Ty1/copia-type domain-containing protein	Tci_055719	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	GSCLEDM	tr|A0A6L2NC11|A0A6L2NC11_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_055719 PE=4 SV=1	0.86733	1.378	0	0	4403.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4403.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NCE1	A0A6L2NCE1_TANCI	Putative reverse transcriptase domain-containing protein	Tci_054192	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	ACETIEK	tr|A0A6L2NCE1|A0A6L2NCE1_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_054192 PE=4 SV=1	0.80126	1.378	0	0	4475.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4475.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NCX3	A0A6L2NCX3_TANCI	Putative reverse transcriptase domain-containing protein	Tci_054372	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	CHGNGGK	tr|A0A6L2NCX3|A0A6L2NCX3_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_054372 PE=4 SV=1	0.80087	1.378	0	30895	0	0	13283	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13283	0	0	0	0	0	0	0
A0A6L2NDA7	A0A6L2NDA7_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_056181	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PSDDGSR	tr|A0A6L2NDA7|A0A6L2NDA7_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_056181 PE=4 SV=1	0.86864	1.378	0	9587.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9587.5	0	0	0	4793.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NEM6	A0A6L2NEM6_TANCI	Uncharacterized protein	Tci_056666	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VWNPHSK	tr|A0A6L2NEM6|A0A6L2NEM6_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_056666 PE=4 SV=1	0.86951	1.378	0	0	0	16678	26059	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12849	0	0	16678	26059	11545	0	0	0	0	0	0	0
A0A6L2NEN0	A0A6L2NEN0_TANCI	GDSL esterase/lipase At5g55050-like	Tci_055935	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			"hydrolase activity, acting on ester bonds [GO:0016788]"	"hydrolase activity, acting on ester bonds [GO:0016788]"	TAGTSGK	tr|A0A6L2NEN0|A0A6L2NEN0_TANCI GDSL esterase/lipase At5g55050-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_055935 PE=3 SV=1	0.82258	2.1389	0	0	4426.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4426.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NER4	A0A6L2NER4_TANCI	Putative reverse transcriptase domain-containing protein	Tci_056689	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	EDHMNSK	tr|A0A6L2NER4|A0A6L2NER4_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_056689 PE=4 SV=1	0.8001	1.378	0	127850	82178	0	124200	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	94181	0	127850	0	82178	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	124200	0	0	0	0	0	0	0
A0A6L2NEU3	A0A6L2NEU3_TANCI	Uncharacterized protein	Tci_056047	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	SGGGNGE	tr|A0A6L2NEU3|A0A6L2NEU3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_056047 PE=4 SV=1	0.79971	1.378	0	5697.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5697.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NFL6	A0A6L2NFL6_TANCI	Putative reverse transcriptase domain-containing protein	Tci_056297	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	VHIPIAR	tr|A0A6L2NFL6|A0A6L2NFL6_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_056297 PE=4 SV=1	0.86924	1.378	0	20170	14453	0	0	0	0	0	0	0	0	0	0	0	0	0	20170	0	0	0	0	0	0	0	0	0	0	0	0	0	14453	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NFQ4	A0A6L2NFQ4_TANCI	NAM-associated domain-containing protein	Tci_056327	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GASGHGM	tr|A0A6L2NFQ4|A0A6L2NFQ4_TANCI NAM-associated domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_056327 PE=4 SV=1	0.86974	1.378	0	0	6025.3	12323	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6025.3	0	0	0	8575.9	0	0	12323	4196.8	0	0	0	0	0	0	0	0	0	0
A0A6L2NHH1	A0A6L2NHH1_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment)	Tci_056975	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	LNLLHMD	tr|A0A6L2NHH1|A0A6L2NHH1_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_056975 PE=4 SV=1	0.79855	1.378	0	0	56242	25894	17162	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	56242	29683	0	0	0	0	0	0	25894	0	0	0	0	0	0	17162	0	0	7502.1	0	0	0	0	0
A0A6L2NI08	A0A6L2NI08_TANCI	Integrase catalytic domain-containing protein	Tci_056213	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	ASDHCSR	tr|A0A6L2NI08|A0A6L2NI08_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_056213 PE=4 SV=1	0.79817	1.378	0	0	0	5665.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5665.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NI43	A0A6L2NI43_TANCI	Retrotrans_gag domain-containing protein	Tci_057894	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TPIEEPK	tr|A0A6L2NI43|A0A6L2NI43_TANCI Retrotrans_gag domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_057894 PE=4 SV=1	0.90164	1.378	0	0	0	125210	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	125210	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NIA6	A0A6L2NIA6_TANCI	DUF4283 domain-containing protein	Tci_057295	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DIGDSCK	tr|A0A6L2NIA6|A0A6L2NIA6_TANCI DUF4283 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_057295 PE=4 SV=1;tr|A0A6L2JTC9|A0A6L2JTC9_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_011785 PE=4 SV=1	0.86239	1.409	2274900	6375700	579720	1540400	600390	2274900	8636.3	5662.4	33127	2226800	0	806990	0	29208	0	0	2128600	1384600	54376	6375700	0	14369	1979400	391440	19416	0	0	0	579720	0	116190	15184	1215600	23568	0	11410	1540400	0	27292	0	0	0	600390	24877	0	0	0	6612.7	6018.3	24810
A0A6L2NIB9	A0A6L2NIB9_TANCI	Retrotransposon-related protein	Tci_057187	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	VLKLFLR	tr|A0A6L2NIB9|A0A6L2NIB9_TANCI Retrotransposon-related protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_057187 PE=4 SV=1	0.86774	1.378	0	0	0	12224	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12224	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NIN7	A0A6L2NIN7_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_057287	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	AGFFGPK	tr|A0A6L2NIN7|A0A6L2NIN7_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_057287 PE=4 SV=1	0.90233	1.378	0	30410	28038	27482	39060	0	0	0	0	0	0	0	0	0	7592.9	25525	16312	0	0	0	30410	0	0	17987	0	26517	0	0	28038	0	0	0	0	0	0	27482	0	0	24952	19751	0	39060	33889	0	0	5688.2	0	0	0	0
A0A6L2NJ19	A0A6L2NJ19_TANCI	Reverse transcriptase Ty1/copia-type domain-containing protein	Tci_056573	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GDCEDGDR	tr|A0A6L2NJ19|A0A6L2NJ19_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_056573 PE=4 SV=1	0.86716	1.378	0	0	3804.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3804.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NJ65	A0A6L2NJ65_TANCI	Reverse transcriptase Ty1/copia-type domain-containing protein	Tci_058078	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VPANELR	tr|A0A6L2NJ65|A0A6L2NJ65_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_058078 PE=4 SV=1	0.85946	1.378	0	0	12216	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12216	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NJ87	A0A6L2NJ87_TANCI	Reverse transcriptase domain-containing protein	Tci_056653	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	GGRGADM	tr|A0A6L2NJ87|A0A6L2NJ87_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_056653 PE=4 SV=1	0.85903	1.378	8360.3	0	0	0	0	0	0	0	0	0	0	0	0	8360.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NJC8	A0A6L2NJC8_TANCI	Uncharacterized protein	Tci_058324	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					CGGGWEE	tr|A0A6L2NJC8|A0A6L2NJC8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_058324 PE=4 SV=1	0.80711	1.378	25725	21679	19769	29132	33138	0	19830	13853	22749	22701	0	0	23551	25725	0	0	0	0	0	0	0	0	21679	0	0	0	0	0	0	0	19769	0	27742	29132	0	0	0	0	0	0	0	0	0	25707	0	33138	32014	23921	0	0
A0A6L2NJF0	A0A6L2NJF0_TANCI	"Pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like"	Tci_058291	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NFCEDREDK	"tr|A0A6L2NJF0|A0A6L2NJF0_TANCI Pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_058291 PE=3 SV=1"	0.89119	1.378	0	0	0	45327	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	45327	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NJH9	A0A6L2NJH9_TANCI	Reverse transcriptase domain-containing protein	Tci_056652	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	YSCGSDM	tr|A0A6L2NJH9|A0A6L2NJH9_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_056652 PE=4 SV=1	0.84741	1.378	0	13097	16984	9345.8	14028	0	0	0	0	0	0	0	0	0	0	9047.3	0	0	0	0	13097	0	0	5818	0	0	16984	16276	0	0	0	0	0	0	9345.8	0	0	0	0	0	0	14028	12172	0	9146.3	0	0	0	14021	0
A0A6L2NJU8	A0A6L2NJU8_TANCI	"Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic"	Tci_058509	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					YVPPQRR	"tr|A0A6L2NJU8|A0A6L2NJU8_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic OS=Tanacetum cinerariifolium OX=118510 GN=Tci_058509 PE=4 SV=1"	0.8079	1.378	0	19648	15408	16083	0	0	0	0	0	0	0	0	0	0	0	0	19648	16822	19643	0	0	0	17309	0	14514	0	0	0	0	0	11788	15408	16083	15769	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NK44	A0A6L2NK44_TANCI	Reverse transcriptase domain-containing protein	Tci_058551	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	VPVRGCK	tr|A0A6L2NK44|A0A6L2NK44_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_058551 PE=4 SV=1;tr|A0A6L2P1X2|A0A6L2P1X2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_062993 PE=4 S	0.8483	1.378	10742	0	8772.2	0	4300.1	0	10742	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7057	0	0	0	0	0	8772.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4300.1	0	0	0	0
A0A6L2NK82	A0A6L2NK82_TANCI	Putative reverse transcriptase domain-containing protein (Fragment)	Tci_058005	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	RPVPAKK	tr|A0A6L2NK82|A0A6L2NK82_TANCI Putative reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_058005 PE=4 SV=1	0.84799	1.378	0	7382.2	2279.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7382.2	3616.8	0	0	1378.9	0	2279.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NKC7	A0A6L2NKC7_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_058709	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	LNTGNVR	tr|A0A6L2NKC7|A0A6L2NKC7_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_058709 PE=4 SV=1	0.84843	1.378	0	0	22641	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22641	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NKD8	A0A6L2NKD8_TANCI	Retrotrans_gag domain-containing protein	Tci_057053	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					FGGDDVR	tr|A0A6L2NKD8|A0A6L2NKD8_TANCI Retrotrans_gag domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_057053 PE=4 SV=1;tr|A0A2U1PGI2|A0A2U1PGI2_ARTAN Uncharacterized protein OS=Artemisia annua OX=35608 GN=CTI12_AA156220 PE=4 SV=1;tr|A0A699J	0.81111	1.378	0	0	0	0	50565	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	50565	0	0
A0A6L2NKK9	A0A6L2NKK9_TANCI	Integrase catalytic domain-containing protein	Tci_057133	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	TGMSHMNYNQVFGEYKR	tr|A0A6L2NKK9|A0A6L2NKK9_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_057133 PE=4 SV=1	0.90374	1.378	0	0	0	17524	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17524	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NKN6	A0A6L2NKN6_TANCI	Integrase catalytic domain-containing protein	Tci_058558	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	SPPLSAR	tr|A0A6L2NKN6|A0A6L2NKN6_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_058558 PE=4 SV=1	0.84887	1.378	7964.3	49938	0	28432	0	0	0	0	0	7964.3	0	0	0	0	0	0	0	0	0	0	0	42642	49938	0	0	0	0	0	0	0	0	0	0	0	0	28432	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NL01	A0A6L2NL01_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_057152	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					WTCHCDD	tr|A0A6L2NL01|A0A6L2NL01_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_057152 PE=4 SV=1	0.904	1.378	0	6127.7	9330.9	31639	15000	0	0	0	0	0	0	0	0	0	0	0	6127.7	0	0	0	0	0	0	0	0	9330.9	0	0	0	0	0	0	0	0	0	0	31639	0	12466	0	0	0	15000	0	7472.6	0	0	0	0	0
A0A6L2NL44	A0A6L2NL44_TANCI	Reverse transcriptase domain-containing protein	Tci_058969	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	NILNEPR	tr|A0A6L2NL44|A0A6L2NL44_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_058969 PE=4 SV=1	0.84894	1.378	19228	16246	11084	15337	13903	0	0	0	15483	19228	0	0	0	13934	0	0	0	16246	0	0	0	0	0	0	11084	0	0	0	0	0	10774	0	0	15337	0	0	0	0	0	0	0	0	0	0	0	0	0	13903	10696	0
A0A6L2NLM1	A0A6L2NLM1_TANCI	CCHC-type domain-containing protein	Tci_058495	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	QNLMSLEKMKSWSDYTK	tr|A0A6L2NLM1|A0A6L2NLM1_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_058495 PE=4 SV=1	0.88525	1.378	0	21096	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21096	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NLN0	A0A6L2NLN0_TANCI	DUF4283 domain-containing protein	Tci_057493	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					YAPIILK	tr|A0A6L2NLN0|A0A6L2NLN0_TANCI DUF4283 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_057493 PE=4 SV=1	0.81666	1.378	17377	0	20373	20653	0	0	0	0	0	11967	0	0	0	17377	0	0	0	0	0	0	0	0	0	0	12975	0	0	0	0	20373	13895	0	0	20653	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NLN7	A0A6L2NLN7_TANCI	"Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic"	Tci_059156	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	KKPVCEPK	"tr|A0A6L2NLN7|A0A6L2NLN7_TANCI Integrase, catalytic region, zinc finger, CCHC-type, peptidase aspartic, catalytic OS=Tanacetum cinerariifolium OX=118510 GN=Tci_059156 PE=4 SV=1"	0.84	2.0124	4967.4	0	5059.4	0	0	0	0	0	0	4967.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5059.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NLX1	A0A6L2NLX1_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_057583	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					ILKPKAK	tr|A0A6L2NLX1|A0A6L2NLX1_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_057583 PE=4 SV=1	0.81626	1.378	0	0	0	0	24443	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24443	0	0	0	0
A0A6L2NM77	A0A6L2NM77_TANCI	Putative ribonuclease H-like domain-containing protein	Tci_059261	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SSMERQR	tr|A0A6L2NM77|A0A6L2NM77_TANCI Putative ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_059261 PE=4 SV=1	0.84397	1.378	0	0	0	0	37636	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28191	0	0	0	37636
A0A6L2NMA7	A0A6L2NMA7_TANCI	Integrase catalytic domain-containing protein	Tci_059291	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	DIEMPTCVPDCSEMGKK	tr|A0A6L2NMA7|A0A6L2NMA7_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_059291 PE=4 SV=1	0.8973	1.378	0	0	0	0	70507	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	70507	0	0	0	0	0	0	0	0
A0A6L2NMH3	A0A6L2NMH3_TANCI	Integrase catalytic domain-containing protein	Tci_059268	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	PLIKGVR	tr|A0A6L2NMH3|A0A6L2NMH3_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_059268 PE=4 SV=1	0.84404	1.378	11823	0	0	0	0	0	0	0	0	0	11823	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NMM8	A0A6L2NMM8_TANCI	Reverse transcriptase Ty1/copia-type domain-containing protein	Tci_058627	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MTYCCWCK	tr|A0A6L2NMM8|A0A6L2NMM8_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_058627 PE=4 SV=1	0	3.9958	0	3362.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3362.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NN49	A0A6L2NN49_TANCI	Protein FAR1-related sequence 5-like	Tci_057982	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	"DNA integration [GO:0015074]; regulation of transcription, DNA-templated [GO:0006355]"		"nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]; regulation of transcription, DNA-templated [GO:0006355]"	nucleic acid binding [GO:0003676]	LDCDAQK	tr|A0A6L2NN49|A0A6L2NN49_TANCI Protein FAR1-related sequence 5-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_057982 PE=4 SV=1	0.90811	1.378	27191	30369	29531	0	37655	0	0	0	0	0	0	0	27191	0	30369	0	0	0	0	0	0	0	0	0	0	0	0	0	29531	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37655	0	0	0	0	0	0
A0A6L2NNY2	A0A6L2NNY2_TANCI	Uncharacterized protein	Tci_059828	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					CPYDQSK	tr|A0A6L2NNY2|A0A6L2NNY2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_059828 PE=4 SV=1	0.81465	1.378	0	0	24088	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24088	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NP89	A0A6L2NP89_TANCI	Zf-CCHC domain-containing protein/UBN2 domain-containing protein	Tci_060146	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TESSDDK	tr|A0A6L2NP89|A0A6L2NP89_TANCI Zf-CCHC domain-containing protein/UBN2 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_060146 PE=4 SV=1;tr|A0A6S7L523|A0A6S7L523_LACSI Uncharacterized protein OS=Lactuca saligna OX=75948 GN=LSAL_LOCUS5	0.89091	1.378	0	0	0	4357.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4357.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NPG1	A0A6L2NPG1_TANCI	Transposon TX1 uncharacterized	Tci_058443	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					IVKGFIR	tr|A0A6L2NPG1|A0A6L2NPG1_TANCI Transposon TX1 uncharacterized OS=Tanacetum cinerariifolium OX=118510 GN=Tci_058443 PE=4 SV=1	0.84595	1.378	7453.1	0	0	0	0	0	0	0	0	7453.1	0	0	0	3969.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NPG2	A0A6L2NPG2_TANCI	Reverse transcriptase domain-containing protein	Tci_059445	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	PKIPTKK	tr|A0A6L2NPG2|A0A6L2NPG2_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_059445 PE=4 SV=1	0.84639	1.378	75577	0	0	0	53334	75577	0	0	0	0	0	0	0	68521	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	53334
A0A6L2NPQ3	A0A6L2NPQ3_TANCI	Xylulose kinase-1	Tci_058543	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			kinase activity [GO:0016301]	kinase activity [GO:0016301]	RSLYAVM	tr|A0A6L2NPQ3|A0A6L2NPQ3_TANCI Xylulose kinase-1 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_058543 PE=4 SV=1	0.84921	1.378	0	0	0	12307	14721	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12307	0	0	0	0	0	0	0	0	0	0	0	0	8079.4	0	14721	0
A0A6L2NQK1	A0A6L2NQK1_TANCI	Uncharacterized protein (Fragment)	Tci_059290	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KYIHQPK	tr|A0A6L2NQK1|A0A6L2NQK1_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_059290 PE=4 SV=1	0.85765	1.378	0	0	0	0	13006	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13006	0
A0A6L2NQY1	A0A6L2NQY1_TANCI	Nucleobase-ascorbate transporter 6	Tci_059975	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857]	transmembrane transporter activity [GO:0022857]	SGGGGGGGAM	tr|A0A6L2NQY1|A0A6L2NQY1_TANCI Nucleobase-ascorbate transporter 6 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_059975 PE=4 SV=1	0.89767	1.378	95868	57481	0	0	76539	46267	49818	45975	95868	0	0	40975	0	54118	0	0	12318	0	57481	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9185.9	76539
A0A6L2NQY2	A0A6L2NQY2_TANCI	Zinc finger BED domain-containing protein RICESLEEPER 2-like	Tci_060504	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			protein dimerization activity [GO:0046983]	protein dimerization activity [GO:0046983]	RPTGRDK	tr|A0A6L2NQY2|A0A6L2NQY2_TANCI Zinc finger BED domain-containing protein RICESLEEPER 2-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_060504 PE=4 SV=1	0.875	1.378	0	40921	47375	47935	0	0	0	0	0	0	0	0	0	0	0	0	40921	0	0	0	0	0	0	0	0	0	0	0	47375	0	0	0	0	0	0	0	47935	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NRB1	A0A6L2NRB1_TANCI	RNase H type-1 domain-containing protein (Fragment)	Tci_059560	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	nucleic acid binding [GO:0003676]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	ATSHDAD	tr|A0A6L2NRB1|A0A6L2NRB1_TANCI RNase H type-1 domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_059560 PE=4 SV=1	0.85815	1.378	21019	0	0	18889	8382.9	15671	21019	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10916	0	0	18889	0	0	0	0	0	0	0	0	0	8382.9	0	0	0	0
A0A6L2NRB5	A0A6L2NRB5_TANCI	Uncharacterized protein	Tci_059062	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					PPKCDLR	tr|A0A6L2NRB5|A0A6L2NRB5_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_059062 PE=4 SV=1	0.81345	1.378	0	25163	26787	12433	28453	0	0	0	0	0	0	0	0	0	0	0	13989	0	0	25163	17567	0	0	0	8133.8	0	0	0	26787	0	0	9587.9	0	0	0	0	0	12433	0	0	0	28453	0	0	0	0	0	0	0	0
A0A6L2NRT3	A0A6L2NRT3_TANCI	Uncharacterized protein	Tci_060077	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QHKLSPK	tr|A0A6L2NRT3|A0A6L2NRT3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_060077 PE=4 SV=1;tr|A0A6L2LQ04|A0A6L2LQ04_TANCI Retrotransposable element Tf2 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_034173 PE=4 SV=1;tr|A0A699H2L2|	0.78014	1.378	0	0	9167	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9167	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NSG6	A0A6L2NSG6_TANCI	Ribonuclease H-like domain-containing protein	Tci_061058	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]	TTNDNMR	tr|A0A6L2NSG6|A0A6L2NSG6_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_061058 PE=4 SV=1	0.85677	1.378	46987	0	515440	97873	38830	13986	46987	27911	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	515440	0	22056	0	59359	0	97873	0	0	0	0	0	0	0	0	0	0	0	38830	0	0	0	0
A0A6L2NSK4	A0A6L2NSK4_TANCI	Putative reverse transcriptase domain-containing protein	Tci_061111	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	CDYHHEGPYPPKCNNCK	tr|A0A6L2NSK4|A0A6L2NSK4_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_061111 PE=4 SV=1	0.87574	1.378	0	0	0	46009	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	46009	26965	0	0	0	0	0	0	0	0	0
A0A6L2NSN0	A0A6L2NSN0_TANCI	CCHC-type domain-containing protein	Tci_060347	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	DTNPPDM	tr|A0A6L2NSN0|A0A6L2NSN0_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_060347 PE=4 SV=1	0.8995	1.378	107690	691250	457370	809370	689230	0	0	0	0	0	107690	0	0	0	0	199260	250190	221690	0	691250	0	0	0	215400	0	131500	0	0	136820	457370	0	60539	0	0	268580	242220	600300	809370	0	0	0	306800	689230	0	89930	79759	0	115570	0	0
A0A6L2NSP2	A0A6L2NSP2_TANCI	Serine/threonine-protein phosphatase PP-X isozyme 2 isoform X2	Tci_060070	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			hydrolase activity [GO:0016787]	hydrolase activity [GO:0016787]	LLLIAGR	tr|A0A6L2NSP2|A0A6L2NSP2_TANCI Serine/threonine-protein phosphatase PP-X isozyme 2 isoform X2 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_060070 PE=4 SV=1	0.81265	1.378	8127.9	12507	0	7047.5	0	0	0	8127.9	0	0	0	0	0	0	8254	12507	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7047.5	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NSV6	A0A6L2NSV6_TANCI	Cell division control protein 6 homolog B-like	Tci_060417	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	cell division [GO:0051301]		cell division [GO:0051301]		YSYIGFK	tr|A0A6L2NSV6|A0A6L2NSV6_TANCI Cell division control protein 6 homolog B-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_060417 PE=4 SV=1	0.85721	1.378	0	0	288680	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	288680	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NT05	A0A6L2NT05_TANCI	Uncharacterized protein	Tci_059662	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					VIQEMVK	tr|A0A6L2NT05|A0A6L2NT05_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_059662 PE=4 SV=1	0.80829	1.378	20353	8873.6	14202	0	8458.3	0	0	0	0	0	0	20353	0	0	0	0	0	0	0	0	0	0	8873.6	0	0	0	0	0	0	14202	0	0	0	0	0	0	0	0	0	0	0	0	0	8458.3	0	0	0	0	0	0
A0A6L2NT21	A0A6L2NT21_TANCI	Reverse transcriptase domain-containing protein	Tci_059723	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	VHQHCGR	tr|A0A6L2NT21|A0A6L2NT21_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_059723 PE=4 SV=1	0.85764	1.378	20976	25185	0	46941	0	0	0	0	20976	0	0	0	18974	0	0	0	0	0	25185	0	0	0	20593	0	0	0	0	0	0	0	0	0	0	46941	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NTL5	A0A6L2NTL5_TANCI	Uncharacterized protein	Tci_059933	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					SDDDNDDDEDDK	tr|A0A6L2NTL5|A0A6L2NTL5_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_059933 PE=4 SV=1	0.85771	1.378	0	0	0	0	7209.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7209.9	0	0	0	0
A0A6L2NTS1	A0A6L2NTS1_TANCI	Uncharacterized protein (Fragment)	Tci_061686	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					CLAGKFDLGGQGKSLGK	tr|A0A6L2NTS1|A0A6L2NTS1_TANCI Uncharacterized protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_061686 PE=4 SV=1	0.8655	1.378	0	0	0	25507	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25507	0	0	0	0	0	0	0	0	0	0
A0A6L2NUF1	A0A6L2NUF1_TANCI	Uncharacterized protein	Tci_061798	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DDETNSK	tr|A0A6L2NUF1|A0A6L2NUF1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_061798 PE=4 SV=1	0.85758	1.378	0	0	0	29593	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29593	0	0	0	0	0	0	0	0	0	0
A0A6L2NUT1	A0A6L2NUT1_TANCI	Uncharacterized protein	Tci_060292	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LKRDNIHLTDQSLLVVM	tr|A0A6L2NUT1|A0A6L2NUT1_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_060292 PE=4 SV=1	0.89163	1.378	20273	5535.1	19561	16894	10072	6554.5	20273	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5535.1	0	0	9031.2	0	0	0	0	19561	0	0	11811	9408.5	0	16894	0	0	0	0	0	0	0	0	0	0	0	0	10072	0
A0A6L2NUT2	A0A6L2NUT2_TANCI	Uncharacterized protein	Tci_061844	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; nucleic acid binding [GO:0003676]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; nucleic acid binding [GO:0003676]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]; zinc ion binding [GO:0008270]"	TDMYGVVYIFKARLVAK	tr|A0A6L2NUT2|A0A6L2NUT2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_061844 PE=4 SV=1	0.84615	1.378	9270.4	4482	0	7824.9	0	0	0	0	9270.4	0	0	0	0	0	0	0	0	0	0	0	0	0	4482	0	0	0	0	0	0	0	0	0	0	7824.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NUY0	A0A6L2NUY0_TANCI	Reverse transcriptase domain-containing protein (Fragment)	Tci_060393	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	ANDAFMKMNTASSSGSR	tr|A0A6L2NUY0|A0A6L2NUY0_TANCI Reverse transcriptase domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_060393 PE=4 SV=1	0.85143	1.378	0	0	0	41588	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	41588	0	0	0	0	0	0	0	0	0	0
A0A6L2NV24	A0A6L2NV24_TANCI	"Retrotransposon protein, putative, unclassified"	Tci_062159	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					QNDGDSK	"tr|A0A6L2NV24|A0A6L2NV24_TANCI Retrotransposon protein, putative, unclassified OS=Tanacetum cinerariifolium OX=118510 GN=Tci_062159 PE=4 SV=1"	0.8567	1.378	0	0	0	0	89792	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	89792	0	0	0	0	25261	0	0
A0A6L2NV69	A0A6L2NV69_TANCI	Tortifolia1-like protein 4	Tci_060910	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		microtubule [GO:0005874]	microtubule [GO:0005874]; microtubule binding [GO:0008017]	microtubule binding [GO:0008017]	DSSPPPM	tr|A0A6L2NV69|A0A6L2NV69_TANCI Tortifolia1-like protein 4 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_060910 PE=4 SV=1	0.85097	1.378	4544.8	4050.1	0	0	0	0	0	0	0	0	0	4544.8	0	0	0	0	0	0	0	0	0	4050.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NV91	A0A6L2NV91_TANCI	Integrase catalytic domain-containing protein	Tci_062229	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	PDEDDSK	tr|A0A6L2NV91|A0A6L2NV91_TANCI Integrase catalytic domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_062229 PE=4 SV=1	0.85141	1.378	7755.1	0	15446	0	0	0	0	0	0	0	7755.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15446	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NVY1	A0A6L2NVY1_TANCI	Peptidyl-tRNA hydrolase family protein	Tci_062416	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			hydrolase activity [GO:0016787]	hydrolase activity [GO:0016787]	SDHGKVR	tr|A0A6L2NVY1|A0A6L2NVY1_TANCI Peptidyl-tRNA hydrolase family protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_062416 PE=4 SV=1	0.81106	1.378	43786	30727	113560	72728	40485	0	0	0	0	0	0	34967	43786	34224	0	0	0	22404	0	0	0	30321	30727	0	0	0	0	0	0	0	113560	0	34614	72728	0	0	0	0	0	0	0	0	0	0	0	0	0	37878	35943	40485
A0A6L2NW00	A0A6L2NW00_TANCI	Ribonuclease H-like domain-containing protein	Tci_062436	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	DYGLFIK	tr|A0A6L2NW00|A0A6L2NW00_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_062436 PE=4 SV=1	0.85273	1.378	65362	38970	0	19143	0	34391	0	0	0	65362	0	0	0	0	0	0	0	38970	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19143	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NW69	A0A6L2NW69_TANCI	Putative reverse transcriptase domain-containing protein	Tci_060812	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	RAIIIPK	tr|A0A6L2NW69|A0A6L2NW69_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_060812 PE=4 SV=1	0.85317	1.378	2847100	1721100	1791200	595510	1553400	5539.3	2847100	518040	53416	1818000	326020	1071900	0	712410	3492.6	0	0	15071	26016	1721100	239220	17143	913930	351600	0	708160	1047400	1481200	773960	1791200	661540	762310	595510	30464	327110	522340	0	0	0	0	5009.2	0	1553400	0	0	62684	155670	193480	391730	14890
A0A6L2NW87	A0A6L2NW87_TANCI	Uncharacterized protein	Tci_060873	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DHDNYHK	tr|A0A6L2NW87|A0A6L2NW87_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_060873 PE=4 SV=1	0.81067	1.378	3827.6	0	0	0	0	0	3827.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NX20	A0A6L2NX20_TANCI	Reverse transcriptase domain-containing protein	Tci_061163	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	GDDESWR	tr|A0A6L2NX20|A0A6L2NX20_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_061163 PE=4 SV=1	0.85362	1.378	0	0	0	16042	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16042	0	0	0	0	0	0	0	0	0	0
A0A6L2NX36	A0A6L2NX36_TANCI	Putative ribonuclease H-like domain-containing protein (Fragment)	Tci_062654	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	ATLFMQFLEKR	tr|A0A6L2NX36|A0A6L2NX36_TANCI Putative ribonuclease H-like domain-containing protein (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_062654 PE=4 SV=1	0.85556	1.378	99782	0	0	0	34112	0	42028	0	0	0	99782	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14467	0	0	0	0	0	34112
A0A6L2NXC2	A0A6L2NXC2_TANCI	Uncharacterized protein	Tci_062744	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					NNTENAM	tr|A0A6L2NXC2|A0A6L2NXC2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_062744 PE=4 SV=1	0.8545	1.378	0	0	0	13015	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13015	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NXE4	A0A6L2NXE4_TANCI	Uncharacterized protein	Tci_062255	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					KTKTWDM	tr|A0A6L2NXE4|A0A6L2NXE4_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_062255 PE=4 SV=1	0.85494	1.378	6392.8	0	0	10539	0	0	0	0	0	0	0	0	6392.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10539	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NXL9	A0A6L2NXL9_TANCI	Reverse transcriptase domain-containing protein	Tci_062077	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	YQMNWCR	tr|A0A6L2NXL9|A0A6L2NXL9_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_062077 PE=4 SV=1	0.85538	1.378	13025	0	0	11619	0	0	0	0	0	0	13025	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11619	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NXN4	A0A6L2NXN4_TANCI	Reverse transcriptase domain-containing protein	Tci_063039	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		magnesium ion binding [GO:0000287]; nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; terpene synthase activity [GO:0010333]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	magnesium ion binding [GO:0000287]; nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; terpene synthase activity [GO:0010333]; zinc ion binding [GO:0008270]	FFKDVKHYFWDDPFLFR	tr|A0A6L2NXN4|A0A6L2NXN4_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_063039 PE=4 SV=1;tr|A0A6L2KJA9|A0A6L2KJA9_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118	0.88344	1.378	0	0	0	8872.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8872.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NXV6	A0A6L2NXV6_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_063109	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					LGGLIQCSGLTK	tr|A0A6L2NXV6|A0A6L2NXV6_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_063109 PE=4 SV=1;tr|A0A6L2M514|A0A6L2M514_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_0	0.85582	1.378	47668	32327	51825	12613	28922	0	0	0	47668	0	0	0	0	37364	0	0	0	0	0	0	0	32327	0	0	0	0	0	0	0	51825	0	0	12613	9645.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28922
A0A6L2NXZ7	A0A6L2NXZ7_TANCI	CCHC-type domain-containing protein	Tci_063149	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	KPLKPPK	tr|A0A6L2NXZ7|A0A6L2NXZ7_TANCI CCHC-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_063149 PE=4 SV=1	0.85626	1.378	10555	13644	0	0	9667.9	0	0	0	0	0	0	8395.6	0	10555	0	0	0	0	13644	0	0	10239	9745.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7641.6	0	9667.9	0	0	0	0
A0A6L2NYJ5	A0A6L2NYJ5_TANCI	"Protein fatty acid export 4, chloroplastic"	Tci_062675	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		EFDEAGN	"tr|A0A6L2NYJ5|A0A6L2NYJ5_TANCI Protein fatty acid export 4, chloroplastic OS=Tanacetum cinerariifolium OX=118510 GN=Tci_062675 PE=3 SV=1"	0.80948	1.378	0	62967	0	0	0	0	0	0	0	0	0	0	0	0	0	62967	0	16977	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2NZP5	A0A6L2NZP5_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_062123	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GFNFVQR	tr|A0A6L2NZP5|A0A6L2NZP5_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_062123 PE=4 SV=1;tr|A0A6L2NBP5|A0A6L2NBP5_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_0	0.86957	1.378	0	10313	22018	0	13997	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10313	0	0	0	0	0	19291	0	22018	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13997	0	0	0	0	0	0	0
A0A6L2P035	A0A6L2P035_TANCI	"RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein"	Tci_062927	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	VKHLPVK	"tr|A0A6L2P035|A0A6L2P035_TANCI RNA-directed DNA polymerase, eukaryota, reverse transcriptase zinc-binding domain protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_062927 PE=4 SV=1"	0.80869	1.378	0	0	8443.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8443.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2P065	A0A6L2P065_TANCI	"RNA-directed DNA polymerase, eukaryota"	Tci_062293	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	GFDDLVK	"tr|A0A6L2P065|A0A6L2P065_TANCI RNA-directed DNA polymerase, eukaryota OS=Tanacetum cinerariifolium OX=118510 GN=Tci_062293 PE=4 SV=1"	0.79779	1.378	13937	18220	0	12216	12686	0	0	0	0	0	13937	0	10338	0	0	0	0	0	0	18220	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12216	0	0	0	11309	0	0	12686	0	0	0	0	0	0	0	0
A0A6L2P0D3	A0A6L2P0D3_TANCI	Uncharacterized protein	Tci_063285	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					FPPLLLK	tr|A0A6L2P0D3|A0A6L2P0D3_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_063285 PE=4 SV=1	0.77793	1.378	745.76	0	0	0	0	0	0	745.76	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2P0I4	A0A6L2P0I4_TANCI	Putative reverse transcriptase domain-containing protein	Tci_064019	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	FLFTQVSNIANEQDYLM	tr|A0A6L2P0I4|A0A6L2P0I4_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_064019 PE=4 SV=1	0.93258	1.5954	49100	0	0	32179	0	0	0	49100	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32179	0	0	0	0	0	0	0	0	0	0
A0A6L2P1E8	A0A6L2P1E8_TANCI	Integrase_H2C2 domain-containing protein	Tci_064309	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GRMWADVVINKEGMHK	tr|A0A6L2P1E8|A0A6L2P1E8_TANCI Integrase_H2C2 domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_064309 PE=4 SV=1;tr|A0A6L2NFX2|A0A6L2NFX2_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=1	0.88372	1.7108	0	0	0	85223	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	85223	0	0	0	0	0	0	0	0	0	0	0
A0A6L2P1X7	A0A6L2P1X7_TANCI	Uncharacterized protein	Tci_063003	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GYNCPPK	tr|A0A6L2P1X7|A0A6L2P1X7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_063003 PE=4 SV=1	0.78643	1.378	0	16745	23418	16308	19003	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16745	0	0	0	0	0	23418	22465	0	0	0	0	0	0	0	0	0	16308	12029	0	0	19003	0	6432.3	3628.5	0	0	0	0
A0A6L2P1Z7	A0A6L2P1Z7_TANCI	Uncharacterized protein	Tci_063023	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					EENRPLK	tr|A0A6L2P1Z7|A0A6L2P1Z7_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_063023 PE=4 SV=1	0.93151	1.378	0	0	0	38296	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38296	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2P249	A0A6L2P249_TANCI	Ribonuclease H-like domain-containing protein	Tci_063955	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	CFCCCVK	tr|A0A6L2P249|A0A6L2P249_TANCI Ribonuclease H-like domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_063955 PE=4 SV=1	0.78605	1.378	5398.2	0	0	0	0	0	0	5398.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2P2H0	A0A6L2P2H0_TANCI	Reverse transcriptase	Tci_063797	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		aspartic-type endopeptidase activity [GO:0004190]; endonuclease activity [GO:0004519]; nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	aspartic-type endopeptidase activity [GO:0004190]; endonuclease activity [GO:0004519]; nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	DKTSASG	tr|A0A6L2P2H0|A0A6L2P2H0_TANCI Reverse transcriptase OS=Tanacetum cinerariifolium OX=118510 GN=Tci_063797 PE=4 SV=1	0.93878	1.378	34889	42349	21223	26224	20441	17116	12743	34889	0	21263	0	0	12826	0	8980.7	0	0	28530	0	0	42349	0	0	10442	6357.5	0	0	0	0	0	21223	11274	13206	26224	0	15638	0	0	0	0	24749	0	0	10845	0	19008	10403	11927	20441	0
A0A6L2P2S2	A0A6L2P2S2_TANCI	Uncharacterized protein	Tci_063293	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DTNPRPR	tr|A0A6L2P2S2|A0A6L2P2S2_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_063293 PE=4 SV=1	0.78568	1.378	9242.8	14114	12140	13838	9664	0	9242.8	0	0	0	0	0	0	0	11173	12809	14114	0	0	0	0	0	0	0	0	0	0	0	12140	0	0	0	0	0	0	0	0	13838	13125	0	11737	0	0	0	9664	0	7930	0	0	0
A0A6L2P2X3	A0A6L2P2X3_TANCI	Equilibrative nucleotide transporter 3-like	Tci_064829	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; nucleoside transmembrane transporter activity [GO:0005337]	nucleoside transmembrane transporter activity [GO:0005337]	VRNNPGR	tr|A0A6L2P2X3|A0A6L2P2X3_TANCI Equilibrative nucleotide transporter 3-like OS=Tanacetum cinerariifolium OX=118510 GN=Tci_064829 PE=3 SV=1	0.78531	1.378	0	0	9685.6	13732	11357	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6702.7	0	0	0	0	9609.5	9685.6	0	13732	10758	0	0	0	0	0	0	0	0	0	0	0	0	0	11357	0	0
A0A6L2P3A0	A0A6L2P3A0_TANCI	Uncharacterized protein	Tci_063282	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					DSVRRTR	tr|A0A6L2P3A0|A0A6L2P3A0_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_063282 PE=4 SV=1	0.78456	1.378	0	0	0	57107	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	57107	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2P624	A0A6L2P624_TANCI	Putative reverse transcriptase domain-containing protein	Tci_065784	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	DNA integration [GO:0015074]		nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]	QSMQAAR	tr|A0A6L2P624|A0A6L2P624_TANCI Putative reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_065784 PE=4 SV=1	0.78419	1.378	0	0	108940	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	108940	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2P685	A0A6L2P685_TANCI	Uncharacterized protein	Tci_065335	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					YSCAHVK	tr|A0A6L2P685|A0A6L2P685_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_065335 PE=4 SV=1	0.78382	1.378	0	0	2148.6	0	1794.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2148.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1794.2
A0A6L2P6M7	A0A6L2P6M7_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_064472	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					HAPRALK	tr|A0A6L2P6M7|A0A6L2P6M7_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_064472 PE=4 SV=1	0.78345	1.378	7047.4	12179	0	15874	0	0	0	0	7047.4	0	0	0	0	0	0	0	0	12179	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15874	14109	0	0	0	0	0	0	0	0	0
A0A6L2P6M8	A0A6L2P6M8_TANCI	Uncharacterized protein	Tci_065495	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					TLRKNGI	tr|A0A6L2P6M8|A0A6L2P6M8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_065495 PE=4 SV=1	0.93289	1.378	5430.9	21606	0	26645	1961.4	5430.9	0	0	0	0	0	0	4156.6	0	7766.1	0	0	0	0	0	21606	0	0	0	0	0	0	0	0	0	0	0	0	0	26645	0	0	0	0	0	0	0	0	0	0	0	1961.4	0	0	0
A0A6L2P6N9	A0A6L2P6N9_TANCI	60S ribosomal protein L27-like (Fragment)	Tci_066079	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	translation [GO:0006412]	ribosome [GO:0005840]	ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	NNSMGGK	tr|A0A6L2P6N9|A0A6L2P6N9_TANCI 60S ribosomal protein L27-like (Fragment) OS=Tanacetum cinerariifolium OX=118510 GN=Tci_066079 PE=4 SV=1	0.625	2.756	6285.6	0	9503.2	4437.6	0	0	0	0	0	0	0	6285.6	0	3530.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9503.2	0	4437.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2P7H1	A0A6L2P7H1_TANCI	Reverse transcriptase Ty1/copia-type domain-containing protein	Tci_065805	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MIFGYLR	tr|A0A6L2P7H1|A0A6L2P7H1_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_065805 PE=4 SV=1	0.7816	1.378	8370.4	0	13920	0	9104.4	0	0	0	0	0	0	0	8370.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13920	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9104.4	0
A0A6L2P7I0	A0A6L2P7I0_TANCI	ARF guanine-nucleotide exchange factor GNOM	Tci_065815	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)	regulation of ARF protein signal transduction [GO:0032012]	cytosol [GO:0005829]; membrane [GO:0016020]	cytosol [GO:0005829]; membrane [GO:0016020]; guanyl-nucleotide exchange factor activity [GO:0005085]; regulation of ARF protein signal transduction [GO:0032012]	guanyl-nucleotide exchange factor activity [GO:0005085]	HAVETVR	tr|A0A6L2P7I0|A0A6L2P7I0_TANCI ARF guanine-nucleotide exchange factor GNOM OS=Tanacetum cinerariifolium OX=118510 GN=Tci_065815 PE=4 SV=1	0.78124	1.378	0	0	0	0	13970	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13970	0	0	0	0
A0A6L2P7J8	A0A6L2P7J8_TANCI	Reverse transcriptase Ty1/copia-type domain-containing protein	Tci_065250	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					GFAFLEK	tr|A0A6L2P7J8|A0A6L2P7J8_TANCI Reverse transcriptase Ty1/copia-type domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_065250 PE=4 SV=1	0.78087	1.378	19545	2575300	0	2557900	2154500	0	19545	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2575300	0	0	0	0	0	0	0	0	0	0	2557900	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2154500	0	0
A0A6L2P8X8	A0A6L2P8X8_TANCI	Uncharacterized protein	Tci_065222	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)					MMPKIKK	tr|A0A6L2P8X8|A0A6L2P8X8_TANCI Uncharacterized protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_065222 PE=4 SV=1	0.7805	1.378	10990	7250.3	0	0	0	0	0	0	4410.8	7865.4	0	10990	0	0	0	0	0	0	0	0	0	0	7250.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A6L2P9U0	A0A6L2P9U0_TANCI	Retrovirus-related Pol polyprotein from transposon TNT 1-94	Tci_066207	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	NHVFIMR	tr|A0A6L2P9U0|A0A6L2P9U0_TANCI Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Tanacetum cinerariifolium OX=118510 GN=Tci_066207 PE=4 SV=1	0.93276	1.378	0	13218	14067	13221	9003.6	0	0	0	0	0	0	0	0	0	0	0	0	0	13218	0	0	0	0	0	0	0	0	0	0	14067	0	0	13221	0	0	13143	0	0	0	0	0	0	0	0	0	0	0	9003.6	0	0
A0A6L2PD69	A0A6L2PD69_TANCI	Reverse transcriptase domain-containing protein	Tci_066282	Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)			RNA-directed DNA polymerase activity [GO:0003964]	RNA-directed DNA polymerase activity [GO:0003964]	DPLIPRRNK	tr|A0A6L2PD69|A0A6L2PD69_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118510 GN=Tci_066282 PE=4 SV=1;tr|A0A6L2JQZ8|A0A6L2JQZ8_TANCI Reverse transcriptase domain-containing protein OS=Tanacetum cinerariifolium OX=118	0.7794	1.378	10606	7424.2	0	0	6200.3	0	0	0	10606	0	0	10390	0	0	0	0	0	7023.5	0	0	0	7424.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6200.3	0	0
Q3LVR7	Q3LVR7_TAROF	TO11-3 (Fragment)	To11-3	Taraxacum officinale (Common dandelion) (Leontodon taraxacum)			catechol oxidase activity [GO:0004097]	catechol oxidase activity [GO:0004097]	TTKVLVK	tr|Q3LVR7|Q3LVR7_TAROF TO11-3 (Fragment) OS=Taraxacum officinale OX=50225 GN=To11-3 PE=2 SV=1;tr|I7HUF2|I7HUF2_TAROF Polyphenol oxidase OS=Taraxacum officinale OX=50225 GN=ppo-6 PE=3 SV=1	0.80533	1.378	0	0	10339	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10339	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I1SPJ6	I1SPJ6_9DIPS	Acetyl-CoA carboxylase carboxyltransferase beta subunit (Fragment)	accD	Valeriana lancifolia	fatty acid biosynthetic process [GO:0006633]	acetyl-CoA carboxylase complex [GO:0009317]; chloroplast [GO:0009507]	acetyl-CoA carboxylase complex [GO:0009317]; chloroplast [GO:0009507]; acetyl-CoA carboxylase activity [GO:0003989]; ATP binding [GO:0005524]; transferase activity [GO:0016740]; fatty acid biosynthetic process [GO:0006633]	acetyl-CoA carboxylase activity [GO:0003989]; ATP binding [GO:0005524]; transferase activity [GO:0016740]	GFVVGEK	tr|I1SPJ6|I1SPJ6_9DIPS Acetyl-CoA carboxylase carboxyltransferase beta subunit (Fragment) OS=Valeriana lancifolia OX=947115 GN=accD PE=4 SV=1	0.8057	1.378	71649	0	64231	25394	8219.1	0	12927	0	0	12834	71649	0	29087	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	64231	0	0	0	0	0	0	25394	0	0	0	0	0	0	0	0	0	0	5921.5	0	8219.1	0
A0A6B7EJV0	A0A6B7EJV0_WEIFL	InfA (Fragment)		Weigela florida (Old fashioned weigela) (Diervilla florida)		chloroplast [GO:0009507]	chloroplast [GO:0009507]; translation initiation factor activity [GO:0003743]	translation initiation factor activity [GO:0003743]	DSDNNGR	tr|A0A6B7EJV0|A0A6B7EJV0_WEIFL InfA (Fragment) OS=Weigela florida OX=79612 PE=3 SV=1;tr|A0A411K0P7|A0A411K0P7_9DIPS Translation initiation factor IF-1 OS=Weigela japonica OX=79615 GN=infA PE=3 SV=1;tr|A0A2U8XHC4|A0A2U8XHC4_WEIFL Translation initiation fact	0.90987	1.378	18657	0	0	7973.5	9341.2	0	0	0	8604.5	18657	0	14108	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7973.5	0	0	0	0	0	0	0	0	0	9341.2	0	0	0	0	0	0
Q9FXP0	Q9FXP0_ZINVI	Homeobox-leucine zipper protein (Fragment)	ZeHB8	Zinnia violacea (Garden zinnia) (Zinnia elegans)	"regulation of transcription, DNA-templated [GO:0006355]"	nucleus [GO:0005634]	"nucleus [GO:0005634]; sequence-specific DNA binding [GO:0043565]; regulation of transcription, DNA-templated [GO:0006355]"	sequence-specific DNA binding [GO:0043565]	QMGALHH	tr|Q9FXP0|Q9FXP0_ZINVI Homeobox-leucine zipper protein (Fragment) OS=Zinnia violacea OX=34245 GN=ZeHB8 PE=2 SV=1	0.80275	1.378	0	13593	26773	20157	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13593	0	0	10389	0	0	0	0	20967	0	0	26773	0	0	0	0	20157	8443.5	0	0	0	0	0	0	0	0	0	0	0	0