Entry Entry Name Protein names Gene Names Organism Gene Ontology (biological process) Gene Ontology (cellular component) Gene Ontology (molecular function) T: Peptide sequences N: Q-value N: Score Intensity DAPT PR5 D14 G1 DAPT0 R1_1 Intensity DAPT PR5 D14 G1 DAPT0 R1_2 Intensity DAPT PR5 D14 G1 DAPT0 R1_3 Intensity DAPT PR5 D14 G1 DAPT0 R2_1 Intensity DAPT PR5 D14 G1 DAPT0 R2_2 Intensity DAPT PR5 D14 G1 DAPT0 R2_3 Intensity DAPT PR5 D14 G1 DAPT0 R3_1 Intensity DAPT PR5 D14 G1 DAPT0 R3_2 Intensity DAPT PR5 D14 G1 DAPT0 R3_3 Intensity DAPT PR5 D14 G3 D5 R1_1 Intensity DAPT PR5 D14 G3 D5 R1_2 Intensity DAPT PR5 D14 G3 D5 R1_3 Intensity DAPT PR5 D14 G3 D5 R2_1 Intensity DAPT PR5 D14 G3 D5 R2_2 Intensity DAPT PR5 D14 G3 D5 R2_3 Intensity DAPT PR5 D14 G3 D5 R3_1 Intensity DAPT PR5 D14 G3 D5 R3_2 Intensity DAPT PR5 D14 G3 D5 R3_3 Intensity DAPT PR5 D14 G4 D10 R1_1 Intensity DAPT PR5 D14 G4 D10 R1_2 Intensity DAPT PR5 D14 G4 D10 R1_3 Intensity DAPT PR5 D14 G4 D10 R2_1 Intensity DAPT PR5 D14 G4 D10 R2_2 Intensity DAPT PR5 D14 G4 D10 R2_3 Intensity DAPT PR5 D14 G4 D10 R3_1 Intensity DAPT PR5 D14 G4 D10 R3_2 Intensity DAPT PR5 D14 G4 D10 R3_3 Intensity DAPT PR5 D7 G1 D0 R1_1 Intensity DAPT PR5 D7 G1 D0 R1_2 Intensity DAPT PR5 D7 G1 D0 R1_3 Intensity DAPT PR5 D7 G1 D0 R2_1 Intensity DAPT PR5 D7 G1 D0 R2_2 Intensity DAPT PR5 D7 G1 D0 R2_3 Intensity DAPT PR5 D7 G1 D0 R3_1 Intensity DAPT PR5 D7 G1 D0 R3_2 Intensity DAPT PR5 D7 G1 D0 R3_3 Intensity DAPT PR5 D7 G3 D5 R1_1 Intensity DAPT PR5 D7 G3 D5 R1_2 Intensity DAPT PR5 D7 G3 D5 R1_3 Intensity DAPT PR5 D7 G3 D5 R2_1 Intensity DAPT PR5 D7 G3 D5 R2_2 Intensity DAPT PR5 D7 G3 D5 R2_3 Intensity DAPT PR5 D7 G3 D5 R3_1 Intensity DAPT PR5 D7 G3 D5 R3_2 Intensity DAPT PR5 D7 G3 D5 R3_3 Intensity DAPT PR5 D7 G4 D10 R1_1 Intensity DAPT PR5 D7 G4 D10 R1_2 Intensity DAPT PR5 D7 G4 D10 R1_3 Intensity DAPT PR5 D7 G4 D10 R2_1 Intensity DAPT PR5 D7 G4 D10 R2_2 Intensity DAPT PR5 D7 G4 D10 R2_3 Intensity DAPT PR5 D7 G4 D10 R3_1 Intensity DAPT PR5 D7 G4 D10 R3_2 Intensity DAPT PR5 D7 G4 D10 R3_3 Intensity iPS PR5 R1_1 Intensity iPS PR5 R1_2 Intensity iPS PR5 R1_3 Intensity iPS PR5 R2_1 Intensity iPS PR5 R2_2 Intensity iPS PR5 R2_3 Intensity iPS PR5 R3_1 Intensity iPS PR5 R3_2 Intensity iPS PR5 R3_3 A0A023I2Y2 A0A023I2Y2_PIG Integrin beta ITGB5 Sus scrofa domesticus (domestic pig) cell adhesion [GO:0007155]; integrin-mediated signaling pathway [GO:0007229] plasma membrane [GO:0005886] metal ion binding [GO:0046872] CAWCFKEDFGSLR 0 323.31 12.3315 10.4232 10.6223 12.3785 11.6974 12.8146 14.6259 13.6673 13.9117 13.5888 10.3894 11.4831 11.9985 12.569 13.9637 12.0513 11.5294 12.3103 11.1092 13.1109 11.1076 11.858 13.2492 11.0644 12.1399 13.879 13.4433 12.4255 10.4996 10.1214 11.8082 11.4871 10.8755 11.3588 11.092 10.7771 12.2855 11.2557 11.8741 11.0729 7.32984 10.143 10.457 11.7978 10.6356 10.8548 9.58318 9.39836 10.6307 11.5064 9.08361 10.1998 10.2703 10.7788 9.61055 10.9816 11.4496 10.1388 8.43638 6.9697 9.90512 8.90126 10.216 A0A060AF33 A0A060AF33_PIG Cadherin-16 CDH16 Sus scrofa domesticus (domestic pig) homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156] plasma membrane [GO:0005886] calcium ion binding [GO:0005509] APSAPTPTLAPLAPVPTR 0.95893 107.09 6.61131 0 9.18987 8.78931 4.34731 7.87793 0 9.8237 5.76134 7.55766 0 5.64639 9.97542 9.80155 9.54425 8.42744 10.455 8.25451 0 4.72378 9.17453 9.32026 7.55635 10.793 0 0 5.65927 6.66491 0 8.68394 10.4174 10.39 9.30677 5.251 8.50064 9.0621 8.95099 0 7.95006 0 0 0 3.21246 10.4495 0 5.10957 0 6.26577 8.46797 0 0 8.47828 0 7.96584 0 8.14644 0 0 0 0 0 0 0 A0A068ENU0 A0A068ENU0_PIG Cytochrome P450 3A (EC 1.14.14.-) CYP3A22 Sus scrofa domesticus (domestic pig) endoplasmic reticulum membrane [GO:0005789] "heme binding [GO:0020037]; iron ion binding [GO:0005506]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen [GO:0016712]" AVLVKECYSAFTNR 0.93038 226.9 11.1362 11.6224 11.6504 11.1996 13.3859 13.2168 11.905 9.84803 12.1878 12.0176 8.94673 10.6637 9.41718 5.94427 10.8028 0 9.85437 8.98285 5.71658 11.0928 10.6999 12.7846 10.1576 13.2285 10.8706 11.3676 0 10.6118 10.9799 11.9258 9.39876 10.4411 9.62808 10.2071 10.6221 0 10.4286 10.6612 10.7624 11.1098 9.46269 6.23502 10.2698 9.42805 7.22275 10.3495 9.86307 10.3361 10.7753 0 8.05826 9.88299 7.87922 8.7198 9.4664 7.28392 8.192 9.66326 9.3544 7.30533 6.39103 8.52642 9.61546 A0A068J2Q8 A0A068J2Q8_PIG Vascular permeability factor VEGF Sus scrofa domesticus (domestic pig) angiogenesis [GO:0001525]; cell differentiation [GO:0030154]; positive regulation of cell division [GO:0051781] membrane [GO:0016020] growth factor activity [GO:0008083]; heparin binding [GO:0008201] ARQENPCGPCSER 0.97169 91.568 6.47461 7.37156 5.99761 9.22665 9.21357 10.4133 6.78293 10.3846 9.20975 8.82594 7.63249 9.18036 9.6685 9.72467 9.0177 0 8.9546 10.7805 9.54371 0 0 8.04658 8.988 8.48623 8.90451 7.21364 7.6014 10.1599 8.9786 6.71727 0 7.30268 8.80022 9.54807 6.5521 0 1.78877 0 6.54312 7.12412 7.2074 6.86419 7.94011 8.49217 8.12205 8.46087 7.42358 8.35804 8.97862 9.03971 8.79915 0 6.05767 8.54728 7.24279 0 6.23289 5.49063 6.54394 5.13258 0 6.99537 0 A0A076EBT4 A0A076EBT4_PIG NADH-ubiquinone oxidoreductase chain 3 (EC 7.1.1.2) ND3 Sus scrofa domesticus (domestic pig) mitochondrial membrane [GO:0031966]; respirasome [GO:0070469] NADH dehydrogenase (ubiquinone) activity [GO:0008137] LPFSMKFFLVAITFLLFDLK 0.99442 9.7911 0 0 0 0 0 0 0 0 0 0 0 10.2301 0 0 0 0 0 0 5.30126 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A076EBU5 A0A076EBU5_PIG ATP synthase protein 8 ATP8 Sus scrofa domesticus (domestic pig) proton motive force-driven ATP synthesis [GO:0015986] "mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) [GO:0000276]" proton transmembrane transporter activity [GO:0015078] HSTPWEMK 0.99235 9.626 0 0 0 0 0 0 0 0 0 9.81498 0 0 0 0 0 0 0 0 0 0 0 0 5.34017 0 0 0 8.25432 8.2149 0 0 8.88981 0 10.6657 0 0 8.8888 0 0 12.9106 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.07815 0 0 0 0 0 0 A0A076EBZ3 A0A076EBZ3_PIG NADH-ubiquinone oxidoreductase chain 5 (EC 7.1.1.2) ND5 Sus scrofa domesticus (domestic pig) ATP synthesis coupled electron transport [GO:0042773] mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469] NADH dehydrogenase (ubiquinone) activity [GO:0008137] AMLFMCSGSIIHSLNDEQDIRK 0.9714 53.368 0 0 0 10.242 8.08523 0 0 0 0 0 0 9.41515 10.3692 10.3432 8.59731 0 0 8.8097 0 0 0 0 0 10.0929 0 6.77136 4.6634 0 0 0 0 0 8.98177 7.52184 3.85718 0 6.14664 0 0 0 8.23016 0 0 8.1632 7.83555 0 7.9751 0 0 0 0 0 0 0 0 0 0 0 0 0 4.14877 3.48954 9.30028 A0A076ED90 A0A076ED90_PIG NADH-ubiquinone oxidoreductase chain 4 (EC 7.1.1.2) ND4 Sus scrofa domesticus (domestic pig) ATP synthesis coupled electron transport [GO:0042773] mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469] NADH dehydrogenase (ubiquinone) activity [GO:0008137] ENALMALHILPLLLLTLNPK 0.99764 4.5799 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.4019 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A076EHN8 A0A076EHN8_PIG NADH-ubiquinone oxidoreductase chain 3 (EC 7.1.1.2) ND3 Sus scrofa domesticus (domestic pig) mitochondrial membrane [GO:0031966]; respirasome [GO:0070469] NADH dehydrogenase (ubiquinone) activity [GO:0008137] TMLTMALFLLTLLAASLAYEWTQK 0.99763 4.7003 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4.10576 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A077ERM6 A0A077ERM6_PIG Cytochrome b CYTB Sus scrofa domesticus (domestic pig) respiratory electron transport chain [GO:0022904] mitochondrial inner membrane [GO:0005743]; respiratory chain complex III [GO:0045275] metal ion binding [GO:0046872]; ubiquinol-cytochrome-c reductase activity [GO:0008121] DVNYGWIIR 1 3.806 0 0 0 0 0 0 0 8.63205 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.4545 0 0 0 0 0 8.15563 0 0 4.56267 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.30095 A0A077ES84 A0A077ES84_PIG Cytochrome c oxidase subunit 2 COX2 Sus scrofa domesticus (domestic pig) mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469] copper ion binding [GO:0005507]; cytochrome-c oxidase activity [GO:0004129] ILYMMDEINNPTLTVK 0.99236 9.6022 0 0 0 0 0 9.61793 0 0 0 0 0 9.10876 0 9.66185 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.75124 0 0 0 0 0 0 0 0 0 0 7.88539 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A077ES89 A0A077ES89_PIG NADH-ubiquinone oxidoreductase chain 4L (EC 7.1.1.2) ND4L Sus scrofa domesticus (domestic pig) ATP synthesis coupled electron transport [GO:0042773] mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469] NADH dehydrogenase (ubiquinone) activity [GO:0008137] MPLVYMNIITAFAIALAGLLMYR 0.99523 5.0129 0 0 0 0 0 10.0449 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.86672 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A077EXZ4 A0A077EXZ4_PIG NADH-ubiquinone oxidoreductase chain 2 (EC 7.1.1.2) ND2 Sus scrofa domesticus (domestic pig) "mitochondrial electron transport, NADH to ubiquinone [GO:0006120]" mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469] NADH dehydrogenase (ubiquinone) activity [GO:0008137] AMEAATK 0.99204 9.3986 8.00607 0 0 0 0 0 0 0 0 8.64133 0 0 0 9.0165 0 0 0 6.82273 0 0 7.01246 0 8.31583 9.08116 6.54469 0 0 0 0 0 0 0 0 9.52583 0 0 0 0 0 0 0 0 8.31098 0 7.53302 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A090AKB2 A0A090AKB2_PIG MHC class II antigen SLA-DRa Sus scrofa domesticus (domestic pig) adaptive immune response [GO:0002250]; antigen processing and presentation of peptide or polysaccharide antigen via MHC class II [GO:0002504] MHC class II protein complex [GO:0042613] EDHLFRK 0.9915 14.125 0 8.92113 0 0 8.61102 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.142 0 0 0 0 0 7.82744 0 0 0 0 0 0 0 0 0 0 A0A097ZIC1 A0A097ZIC1_PIG POU domain protein POU6F2 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700] AGMQNLTEFIGSEPSK 0.95715 99.838 11.1867 0 0 0 5.80648 0 0 11.5706 7.57024 0 0 7.9633 0 11.3222 8.4605 0 0 0 0 10.77 11.0285 7.416 9.71548 7.7664 5.90306 0 0 10.5024 5.0245 5.53543 7.42265 0 8.34301 0 9.52701 0 0 8.74214 11.55 0 8.09117 0 6.57377 10.9806 0 7.79799 12.1264 5.43982 0 10.7296 9.69699 9.33067 7.4707 11.7461 8.17048 0 0 9.62666 0 10.014 0 9.18431 9.61712 A0A0A1C940 A0A0A1C940_PIG Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) PPARG Sus scrofa domesticus (domestic pig) rhythmic process [GO:0048511] cytoplasm [GO:0005737]; nucleus [GO:0005634] nuclear receptor activity [GO:0004879]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270] ADPVVADYKYDLK 0.92262 218.35 10.0294 0 9.504 9.64596 11.0924 2.73712 10.4653 10.2068 11.8076 10.5053 9.60746 10.6492 10.1683 8.15051 10.6393 8.31696 9.85318 0 10.3647 4.27225 7.19466 10.2011 10.7671 7.40744 7.99582 9.57145 0 8.62607 9.71649 9.31705 9.23412 9.99563 10.9842 6.68594 4.13192 7.94942 9.34372 7.86431 5.29858 8.87338 8.55785 5.08508 6.93899 0 9.18495 10.3482 8.86446 5.27143 8.14011 0 10.9847 9.0063 8.5114 8.32468 9.15221 9.81748 8.72615 8.52857 6.39994 8.5423 5.03435 4.29219 3.62188 A0A0A7DRA9 A0A0A7DRA9_PIG Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) cytb Sus scrofa domesticus (domestic pig) respiratory electron transport chain [GO:0022904] mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469] electron transfer activity [GO:0009055]; metal ion binding [GO:0046872] DILGALFMMLILLILVLFSPDL 0.9966 4.9371 0 0 0 0 0 0 0 0 0 0 0 0 0 4.61712 0 0 0 0 5.64939 0 0 0 0 0 0 0 0 0 0 0 0 0 8.55382 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A0A7DRN3 A0A0A7DRN3_PIG Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) cytb Sus scrofa domesticus (domestic pig) respiratory electron transport chain [GO:0022904] mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469] electron transfer activity [GO:0009055]; metal ion binding [GO:0046872] DILGALFMMLILLILVLFSP 0.99866 4.4958 0 0 0 0 0 0 0 0 0 0 4.08525 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A0A7DRX7 A0A0A7DRX7_PIG Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) cytb Sus scrofa domesticus (domestic pig) respiratory electron transport chain [GO:0022904] mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469] electron transfer activity [GO:0009055]; metal ion binding [GO:0046872] DILGALFMMLILLILVLFS 0.99763 4.8916 5.42358 0 0 0 0 0 0 0 0 0 0 0 0 5.52626 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A0A8IJS7 A0A0A8IJS7_PIG LIM/homeobox protein Lhx3 Lhx3 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] "DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; zinc ion binding [GO:0008270]" ADYETAK 0.99696 4.7991 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4.9322 0 4.23511 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A0B4U987 A0A0B4U987_PIG Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) Cytb Sus scrofa domesticus (domestic pig) respiratory electron transport chain [GO:0022904] mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469] electron transfer activity [GO:0009055]; metal ion binding [GO:0046872] DVNYGWVIR 0.99798 4.6075 0 0 0 7.56651 0 0 0 0 0 0 0 0 8.09719 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6.01018 0 0 0 A0A0B6VNS3 A0A0B6VNS3_PIG MHC class II antigen SLA-DRB Sus scrofa domesticus (domestic pig) adaptive immune response [GO:0002250]; antigen processing and presentation of peptide or polysaccharide antigen via MHC class II [GO:0002504] MHC class II protein complex [GO:0042613] AEVDTYCR 0.99711 17.777 0 0 0 0 6.52143 0 0 10.0195 0 0 5.68656 0 0 0 0 0 0 8.5399 7.22139 0 0 0 0 9.05656 0 0 0 0 4.13422 0 0 0 0 0 0 0 6.15826 0 0 0 0 0 0 0 0 0 6.47641 0 6.18555 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A0B6VSG7 A0A0B6VSG7_PIG MHC class II antigen SLA-DRB Sus scrofa domesticus (domestic pig) adaptive immune response [GO:0002250]; antigen processing and presentation of peptide or polysaccharide antigen via MHC class II [GO:0002504] MHC class II protein complex [GO:0042613] AEPRVTVYPAK 0.99618 26.868 0 0 0 6.67835 0 7.4149 4.80735 6.28274 0 0 5.49227 0 0 0 0 6.26006 0 0 0 0 0 5.49602 6.29076 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6.02197 0 0 0 0 0 0 0 0 0 0 0 6.03131 A0A0B8RS50 A0A0B8RS50_PIG Zinc finger protein 654 ZNF654 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] DNA binding [GO:0003677]; metal ion binding [GO:0046872] AEEESDQEAER 0.98842 323.31 11.5256 11.4969 11.6848 11.639 12.527 11.6463 12.5951 11.3401 11.7659 12.6775 13.0573 11.698 13.0934 11.0133 13.1795 13.6718 13.0304 10.4894 12.89 12.7903 12.6755 13.3306 13.0927 8.52986 10.5106 11.8078 12.6367 11.5456 10.4417 11.5269 13.4855 11.2024 11.1686 12.0973 11.1186 11.0375 12.85 11.9358 12.6887 6.42141 11.3686 10.5583 12.4895 12.7268 12.1787 11.7777 12.8918 10.0224 9.04647 9.76351 11.8537 10.865 10.6556 9.97599 8.78999 9.27826 7.06005 9.96411 8.09893 7.47824 9.52863 10.7237 10.2027 A0A0B8RS51 A0A0B8RS51_PIG Zinc finger protein 140 ZNF140 Sus scrofa domesticus (domestic pig) regulation of DNA-templated transcription [GO:0006355] metal ion binding [GO:0046872] AFRCHSFLLKHQR 0.94009 239.59 9.89228 10.4234 10.7469 7.56963 10.719 8.62979 10.4042 12.4648 11.9852 9.78421 10.3477 11.5263 9.36227 11.9115 9.05017 12.0142 12.788 0 10.8982 11.7336 7.07007 0 10.5628 12.9282 9.13381 9.97914 9.48551 10.1539 10.0827 5.248 7.09445 6.25678 7.77637 9.05685 9.15059 4.29491 8.10899 8.64162 8.9083 9.95855 0 8.16481 9.62649 8.95018 6.52762 8.24374 0 6.82413 10.2736 9.94467 0 5.9464 4.00405 7.84812 9.52333 8.11098 5.80867 6.02552 4.4064 7.54928 4.57737 0 8.71294 A0A0B8RS53 A0A0B8RS53_PIG RNA uridylyltransferase (EC 2.7.7.52) ZCCHC11 Sus scrofa domesticus (domestic pig) mRNA catabolic process [GO:0006402]; mRNA destabilization [GO:0061157] nucleic acid binding [GO:0003676]; nucleotidyltransferase activity [GO:0016779]; zinc ion binding [GO:0008270] AAYRYFACPQR 0.96241 323.31 15.2346 10.7095 15.0273 14.4374 14.3394 14.5083 14.3736 13.6788 14.2371 14.1832 14.0394 14.335 18.034 18.0993 18.1748 13.874 13.6582 13.9451 14.4279 14.4026 14.4005 13.8898 12.4192 14.7685 16.6998 11.63 13.477 13.8778 13.518 14.6703 14.7896 14.2303 14.4175 14.6379 14.996 14.6396 13.3018 13.559 12.6743 13.003 11.7257 13.7938 19.1142 19.2267 12.1463 11.3815 14.4987 13.6889 12.4372 15.0968 11.5861 11.9844 11.0372 10.5905 13.7842 12.4044 11.7563 14.4077 14.0609 10.847 10.2165 12.1692 9.19648 A0A0B8RS54 A0A0B8RS54_PIG Zinc finger and BTB domain containing 17 ZBTB17 Sus scrofa domesticus (domestic pig) AAASTLSELDPAR 0.97491 314.05 7.83706 11.3496 9.40776 8.74194 11.3104 10.5617 10.1642 11.4491 11.4619 9.86995 10.518 8.16012 9.13355 8.79155 12.5524 10.5458 10.0298 11.5748 8.65921 10.9119 10.2364 6.12805 5.51942 11.6767 9.56815 10.3316 9.95053 8.3458 7.11353 6.52273 11.0871 11.9117 9.15851 0 7.40455 6.50365 10.4428 11.0477 7.79727 10.6517 0 10.2021 10.2803 10.2844 0 10.0972 10.2909 10.0426 10.6401 0 12.0933 9.47915 7.28725 10.0602 8.78686 8.13283 0 6.90893 8.10261 7.77037 7.91946 0 7.19525 A0A0B8RS56 A0A0B8RS56_PIG 5'-3' exoribonuclease 1 XRN1 Sus scrofa domesticus (domestic pig) nuclear-transcribed mRNA catabolic process [GO:0000956] 5'-3' exonuclease activity [GO:0008409]; nucleic acid binding [GO:0003676] AFDSRFSSIK 0.96604 323.31 12.7975 11.6517 11.6489 14.7347 13.2704 12.9815 14.2561 13.1288 14.0081 13.3473 13.1962 9.79943 13.6646 13.9928 12.3728 14.247 13.6262 12.6875 11.5505 12.3863 12.8522 10.7827 13.8577 14.0672 14.1887 11.8255 13.0529 12.922 12.965 10.4585 14.6927 13.8753 13.7934 12.1107 12.5158 11.8183 12.7454 13.7574 12.3159 11.5001 12.2467 12.8627 12.3094 12.8658 10.8187 11.3209 10.9936 9.35209 12.0573 12.4853 11.6727 12.6179 12.8451 11.3756 10.6937 11.6117 10.7039 10.2734 12.0723 9.96006 9.85681 11.7211 11.4806 A0A0B8RS58 A0A0B8RS58_PIG WW domain binding protein 11 WBP11 Sus scrofa domesticus (domestic pig) RNA processing [GO:0006396] nucleus [GO:0005634] ADDTSAATIEK 0.94062 244.25 9.66032 13.0978 4.69092 9.41979 9.14374 10.0091 10.6893 10.6147 10.6061 10.0386 8.8678 8.36155 11.8473 10.7998 0 8.904 8.95992 9.38472 12.9322 0 8.22482 11.2104 9.48041 0 9.65912 7.93575 9.94436 11.0784 10.7118 10.3384 12.2607 8.10035 9.99379 7.93192 10.7575 10.05 12.2472 8.6767 11.3487 11.0522 9.21313 4.29403 9.97039 12.3088 8.49329 8.38461 8.38616 6.84147 7.94146 0 13.5198 8.34207 8.3601 7.0935 8.98718 10.3861 9.90055 4.40946 9.72243 7.45022 13.4316 9.41889 9.5552 A0A0B8RS59 A0A0B8RS59_PIG Vacuolar protein sorting-associated protein 13B VPS13B Sus scrofa domesticus (domestic pig) lipid transport [GO:0006869] AEFILDAASHK 1.0159 323.31 12.8574 13.5001 13.3232 14.3152 14.8697 13.4871 13.4886 14.4528 14.5731 13.5754 14.7654 13.7585 12.3773 13.4659 14.5848 12.3802 13.4506 13.0292 13.7428 11.9033 12.0267 15.6684 12.6232 13.9586 14.7803 13.1054 14.6553 14.4543 10.9253 10.9479 14.781 13.2742 14.2693 12.6539 13.5384 13.2948 13.0081 12.129 11.2376 10.9622 12.8271 11.5033 16.9656 11.8572 11.7746 13.2348 12.474 11.0808 11.8312 12.7532 12.9223 11.3569 11.4777 13.1636 13.8856 11.3669 11.9382 12.6702 12.1647 11.022 10.0693 11.393 10.1794 A0A0B8RS61 A0A0B8RS61_PIG ubiquitinyl hydrolase 1 (EC 3.4.19.12) USP9X Sus scrofa domesticus (domestic pig) cysteine-type deubiquitinase activity [GO:0004843] AFRGKHLSFIVR 1.0079 323.31 12.3684 11.9678 14.4083 14.5633 14.1335 13.7836 15.2116 13.8098 15.0482 15.0083 13.4626 13.446 14.2346 14.1713 13.6708 14.0685 17.4824 13.3914 14.3188 14.1035 13.2247 14.3635 17.7041 14.6535 13.8424 13.775 13.5003 13.0779 12.4836 11.8734 17.6507 13.5348 12.6247 11.378 16.9842 12.7654 17.6563 17.7666 13.1369 11.0276 11.8112 11.2682 12.5743 10.4112 11.034 17.1099 17.2756 17.0879 14.6774 17.1336 14.5927 10.5507 16.0223 16.0484 16.4865 16.6934 16.8343 16.3195 10.3049 16.1779 10.3023 13.1142 10.4667 A0A0B8RS63 A0A0B8RS63_PIG UBX domain-containing protein 7 UBXN7 Sus scrofa domesticus (domestic pig) APIPQKQEILVEPEPLFGAPK 0.95238 203.78 8.97811 8.54813 7.37955 8.71788 9.34323 12.8896 0 8.63423 8.98968 7.84718 0 13.1146 11.013 13.3291 11.439 9.55442 8.95455 8.37986 9.64789 11.7962 7.79863 0 9.21033 8.19357 0 9.28084 0 7.75348 9.07436 9.79888 11.2178 13.3214 9.90817 8.34016 8.09887 7.64082 11.2354 11.2962 9.86068 4.71776 8.89412 11.919 11.2078 9.27361 8.48953 0 12.5085 8.00551 0 9.15487 10.2102 5.91602 8.55071 6.04404 12.7684 0 5.8432 0 3.34653 7.85512 0 10.4952 0 A0A0B8RS64 A0A0B8RS64_PIG E2 ubiquitin-conjugating enzyme (EC 2.3.2.23) UBE2D1 Sus scrofa domesticus (domestic pig) ATP binding [GO:0005524]; transferase activity [GO:0016740] EKYNRHAR 0.97552 39.175 0 8.70269 8.32391 0 0 0 8.05338 0 0 7.44559 7.96584 0 0 0 9.07762 0 0 0 7.4876 0 0 8.61776 11.5716 0 7.9571 0 12.8011 8.41164 6.84624 7.90875 0 0 0 0 0 0 11.4627 0 0 0 0 8.40195 0 0 0 0 4.53984 10.4692 0 4.43376 0 0 0 0 0 0 8.86165 0 0 0 0 8.08428 0 A0A0B8RS68 A0A0B8RS68_PIG Tetraspanin TSPAN17 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] AYRDDIDLQNLIDFAQEYWSCCGAR 0.96743 50.831 11.4696 11.1897 11.1983 7.1206 0 7.18982 12.1015 12.0533 12.13 0 0 0 11.8847 0 0 12.0123 9.57922 8.50088 12.1941 12.3246 6.90569 12.5913 12.7539 12.622 11.7108 11.4932 11.8794 0 0 0 0 4.64536 8.43817 0 8.99599 8.00051 0 8.4607 8.74147 3.95429 8.66238 7.66612 0 0 7.1818 0 7.19692 5.56873 2.3856 7.57259 0 5.39643 7.71528 0 9.82782 0 0 6.5704 6.75782 6.99299 0 0 0 A0A0B8RS69 A0A0B8RS69_PIG Tripartite motif containing 34 TRIM34 Sus scrofa domesticus (domestic pig) zinc ion binding [GO:0008270] AEELEADIR 0.92915 220.17 10.0519 10.9862 10.1629 9.06636 11.0681 11.43 12.5922 9.75099 11.5354 11.7534 10.8784 8.83942 11.3498 11.6637 11.5849 7.77847 12.0654 10.4752 11.8231 11.2777 11.6487 11.7402 8.98291 9.38668 7.6669 10.8604 11.3691 10.7663 8.85614 9.87969 10.7274 11.1551 11.235 8.83927 5.39146 9.98613 7.27854 10.8303 8.02934 9.52503 8.58515 7.41456 9.99577 0 8.09186 10.1252 6.52239 9.2747 10.5344 8.61923 9.46534 9.5683 0 9.56704 9.02423 8.37738 8.44431 9.1822 9.23295 9.46265 2.75715 4.74825 9.76878 A0A0B8RS71 A0A0B8RS71_PIG Torsin-1A-interacting protein 1 TOR1AIP1 Sus scrofa domesticus (domestic pig) nuclear inner membrane [GO:0005637] ATPase activator activity [GO:0001671] AAKEKVPVGR 0.9723 264.59 0 9.4207 10.5711 12.1143 11.3215 10.0053 11.1614 11.5962 11.0703 11.7087 10.3039 11.7166 12.5525 12.4199 11.7954 10.1476 10.7062 11.7301 10.8993 11.8599 9.34079 12.637 13.3403 12.4347 6.6072 9.36232 8.46508 5.86609 10.9689 8.22747 6.91013 10.7345 9.77967 9.21016 8.90842 9.60611 10.7396 11.2962 8.76401 0 9.99223 11.2074 10.4849 6.39532 0 10.9297 0 0 12.3891 8.46442 7.11333 9.68038 10.9746 9.40009 0 9.04264 10.0653 5.98564 7.04352 9.2929 4.02246 0 6.65592 A0A0B8RS73 A0A0B8RS73_PIG Transmembrane protein 69 TMEM69 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] ALRIVVTLVAFFSFVITLLVK 0.96667 94.265 12.0639 11.6425 11.9568 10.2996 8.97315 9.65499 13.3729 13.536 0 12.3323 13.274 9.61416 8.24541 13.618 0 0 8.54264 9.60479 10.5369 10.4366 8.38918 14.0895 8.66846 0 10.556 0 10.5471 10.7511 10.0761 0 8.77413 0 0 11.9134 10.1412 10.0796 11.1407 8.87166 10.7317 9.87283 10.9113 10.907 9.91467 10.7227 0 5.18654 4.6117 8.23386 9.06972 10.2681 9.96317 9.43075 10.3206 0 11.0399 10.9511 10.157 0 10.609 10.5409 9.62178 9.27968 4.64559 A0A0B8RS75 A0A0B8RS75_PIG Transmembrane emp24 domain-containing protein 10 (21 kDa transmembrane-trafficking protein) (Transmembrane protein Tmp21) (p24 family protein delta-1) TMED10 Sus scrofa domesticus (domestic pig) endoplasmic reticulum membrane [GO:0005789]; Golgi apparatus [GO:0005794]; transport vesicle membrane [GO:0030658] DTNESTNTR 0.96557 63.776 0 8.79468 10.8296 9.59552 0 9.9046 0 8.70442 7.01937 11.0902 8.4886 9.2432 9.01795 7.88533 8.03799 8.50946 9.97456 8.51104 0 9.43386 6.51253 11.2635 0 12.0577 0 9.2785 9.70867 8.93499 0 0 8.85016 9.82378 0 8.07543 0 0 8.66935 8.48289 9.09395 0 0 7.00865 6.64573 9.38769 8.48688 9.36626 8.5542 7.9607 8.80029 8.45224 0 8.09397 0 0 8.74662 8.60028 7.91253 0 6.96982 0 0 6.38562 0 A0A0B8RS77 A0A0B8RS77_PIG Tyrosine-protein kinase (EC 2.7.10.2) TEC Sus scrofa domesticus (domestic pig) adaptive immune response [GO:0002250]; intracellular signal transduction [GO:0035556]; phosphorylation [GO:0016310] cytoplasm [GO:0005737]; plasma membrane [GO:0005886] ATP binding [GO:0005524]; metal ion binding [GO:0046872]; non-membrane spanning protein tyrosine kinase activity [GO:0004715] AIREGAMCEEDFIEEAK 1.3128 323.31 10.8706 10.9988 8.96041 12.9014 13.2132 13.5618 13.2454 14.2299 12.9008 12.0824 12.7288 12.3712 12.5511 13.9124 12.6695 13.5656 14.1536 13.7406 14.1522 12.3994 12.8433 13.1822 13.3602 13.1929 12.5789 12.3569 12.0156 12.5662 11.5794 11.6933 12.8075 11.914 12.3817 11.3591 11.1925 11.8837 10.6125 9.74064 11.4121 8.95373 8.98937 10.734 10.5009 10.1972 9.96528 10.3207 10.2389 10.9756 9.69719 9.28651 10.1973 8.81263 10.3948 10.5336 10.1539 11.3648 9.86078 9.95818 9.3175 8.36102 7.9244 0 8.64314 A0A0B8RS78 A0A0B8RS78_PIG "Taspase, threonine aspartase, 1" TASP1 Sus scrofa domesticus (domestic pig) threonine-type endopeptidase activity [GO:0004298] ACQKAIEK 0.96004 123.77 10.3854 12.6286 10.6175 11.8591 12.1294 11.0421 11.9325 11.3424 11.9884 0 11.2683 12.7217 11.4408 11.6187 11.7949 10.4027 10.6203 0 10.7107 11.0693 11.5783 12.6352 11.7754 12.6505 11.0065 12.2823 10.8727 12.1279 12.1645 9.65782 9.3482 12.3505 12.4864 11.7382 11.9014 12.0799 11.6469 11.8781 12.0332 10.2413 10.1141 9.9429 11.802 9.40416 9.44801 11.3029 10.9941 11.2699 10.9712 10.9259 11.0043 10.237 11.78 10.0215 10.1965 8.98314 6.52782 9.77165 6.72233 9.62006 8.84474 8.60481 10.0323 A0A0B8RS80 A0A0B8RS80_PIG Symplekin SYMPK Sus scrofa domesticus (domestic pig) mRNA processing [GO:0006397] nucleus [GO:0005634] AALEQLLK 1.3061 323.31 11.1822 10.1902 10.8426 12.6126 12.5803 13.0018 13.4432 13.8496 13.6899 12.636 12.6267 12.8052 13.8613 13.1935 12.26 13.2089 12.9497 12.8462 11.0707 10.937 10.5911 12.8422 13.0153 12.7487 11.6554 10.5522 11.2616 11.0399 10.9968 10.6624 11.5544 9.65224 11.7103 10.0769 8.45713 9.31334 11.1749 11.5486 10.4609 9.2987 11.1565 8.43413 12.5054 12.1475 11.3794 11.4527 11.2002 9.84757 11.8037 12.3037 11.6371 10.7243 9.88899 9.30788 9.27817 10.4228 9.85601 10.2491 9.82109 0 0 9.73288 10.1693 A0A0B8RS82 A0A0B8RS82_PIG Transcription elongation factor spt6 SUPT6H Sus scrofa domesticus (domestic pig) positive regulation of transcription elongation by RNA polymerase II [GO:0032968]; transcription elongation-coupled chromatin remodeling [GO:0140673] nucleus [GO:0005634]; organelle membrane [GO:0031090] DNA binding [GO:0003677]; translation elongation factor activity [GO:0003746] ACSRKLYNWLR 1.2995 323.31 11.896 12.24 12.5246 13.9073 14.4 14.2516 15.0298 14.0506 14.5123 13.0482 12.8585 13.1653 14.8262 12.735 12.8638 12.7949 13.1614 12.3392 13.6066 13.3069 13.2985 14.438 14.2737 13.607 12.3611 10.8988 13.2693 11.3477 12.6547 11.2855 13.0725 13.3411 14.2136 11.6861 12.1451 11.254 12.1952 11.1124 11.5185 12.4137 10.8976 11.6356 13.0303 13.1003 13.0156 12.3379 12.7749 12.3117 12.4409 10.047 13.1899 12.4515 12.2568 11.9207 11.7399 12.0934 10.1585 10.3123 12.5304 9.21667 11.1158 11.659 11.5573 A0A0B8RS83 A0A0B8RS83_PIG Serine/threonine kinase 38 STK38 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674] ADMLEKEQVGHIR 0.92842 226.58 9.24643 10.4249 10.1662 10.5191 9.76843 10.1904 12.3717 0 11.0158 10.4718 10.4135 7.9321 9.37959 11.25 9.71721 8.6363 12.223 13.4428 5.21047 9.78568 6.51954 9.04691 6.08066 14.2356 9.5372 10.0301 11.542 11.9217 7.01201 7.26435 9.13245 9.89414 9.0717 0 10.3463 9.12265 8.52634 11.3344 0 9.90737 10.8968 0 7.89609 7.48696 9.32596 9.45806 9.78966 7.81513 9.38759 0 9.08961 9.62167 8.49693 8.80151 9.10027 6.27557 7.45418 7.97085 8.59898 8.32962 6.41996 8.55712 9.23331 A0A0B8RS85 A0A0B8RS85_PIG "Type 2 lactosamine alpha-2,3-sialyltransferase (CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI) (ST3Gal VI) (Sialyltransferase 10)" ST3GAL6 Sus scrofa domesticus (domestic pig) protein glycosylation [GO:0006486] Golgi membrane [GO:0000139] sialyltransferase activity [GO:0008373] DIIEKNFVINLTQD 0.95385 100.52 0 0 0 0 5.63288 0 8.94278 7.28198 5.06596 0 7.77749 0 0 7.50993 7.47978 7.17871 9.94473 6.2435 9.99166 0 10.4025 10.263 8.12438 9.4817 6.03025 6.88789 6.41148 7.05159 9.64735 5.14086 0 6.0744 0 8.22598 0 0 0 3.29992 7.15046 6.50909 0 7.33074 0 0 0 6.58442 0 0 0 8.28489 5.92495 5.86488 9.1581 5.5152 0 0 0 8.81028 9.90895 0 9.04398 0 5.43483 A0A0B8RS87 A0A0B8RS87_PIG Signal recognition particle 54 kDa protein (EC 3.6.5.-) SRP54 Sus scrofa domesticus (domestic pig) SRP-dependent cotranslational protein targeting to membrane [GO:0006614] "endoplasmic reticulum [GO:0005783]; nuclear speck [GO:0016607]; signal recognition particle, endoplasmic reticulum targeting [GO:0005786]" 7S RNA binding [GO:0008312]; ATP hydrolysis activity [GO:0016887]; GTP binding [GO:0005525]; GTPase activity [GO:0003924] AFKDKVDVASVIVTK 0.9404 302.79 9.59969 11.5295 14.4429 10.8791 9.64924 11.9545 10.2199 9.21009 11.4766 11.0118 9.82268 11.3011 11.8996 9.97556 13.3873 11.4428 9.66724 11.5868 10.3768 10.5295 11.0273 10.9296 9.72751 10.3277 11.4653 9.00042 10.6025 9.15629 9.84273 9.97183 11.1377 8.63691 10.5941 9.19852 7.72397 9.82211 8.65277 11.1018 8.22959 8.89081 0 0 7.47832 10.227 12.3405 11.149 9.23649 9.37049 8.74735 8.6792 8.34185 6.93463 12.8764 8.22593 7.99124 7.71678 7.65828 5.69658 13.9147 5.86406 4.74157 9.30111 5.2857 A0A0B8RS88 A0A0B8RS88_PIG Spastic paraplegia 11 (Autosomal recessive) SPG11 Sus scrofa domesticus (domestic pig) ACECPAEKGWSNTEER 1.2864 323.31 12.8067 11.322 12.8174 12.1295 9.56874 14.2067 12.2025 13.263 11.9241 12.2238 12.6189 11.5914 12.3306 10.5888 12.8043 14.7557 10.3669 11.3596 11.2076 13.564 11.5625 12.7889 11.5248 10.0608 10.9051 12.8849 13.2192 12.4593 12.6746 12.5566 11.331 9.91712 14.3072 11.6141 10.814 11.2411 11.4397 12.7862 10.1306 12.1644 11.5939 11.3986 14.1457 14.0878 11.1837 12.2996 13.7971 11.879 10.2304 13.0224 13.4633 10.8442 11.5835 11.4924 10.9037 10.1416 12.4271 12.3028 8.41604 9.95694 9.14924 9.85289 7.9851 A0A0B8RS90 A0A0B8RS90_PIG Son of sevenless-like 2 SOS2 Sus scrofa domesticus (domestic pig) small GTPase mediated signal transduction [GO:0007264] guanyl-nucleotide exchange factor activity [GO:0005085]; protein heterodimerization activity [GO:0046982] ACSEEQEDR 1.28 323.31 12.3555 14.5098 12.0524 16.346 12.5545 12.3866 12.7059 12.588 12.73 15.1805 12.4697 12.8124 13.0511 15.4381 12.8126 12.8237 12.337 10.8387 12.9665 12.3808 12.4125 12.3572 13.5511 13.5851 12.8905 13.0392 12.8123 12.704 12.1434 8.72615 11.66 12.1247 11.7852 11.0835 10.6004 11.7009 12.3714 10.6939 10.5342 10.1934 10.684 11.8185 11.4238 11.5661 12.068 11.3308 9.99265 10.3395 8.59496 11.959 9.7433 12.5032 10.7289 11.7544 10.5647 8.64598 8.35098 8.15659 7.78686 13.9089 8.72738 9.58135 8.30716 A0A0B8RS92 A0A0B8RS92_PIG HECT-type E3 ubiquitin transferase (EC 2.3.2.26) SMURF2 Sus scrofa domesticus (domestic pig) protein ubiquitination [GO:0016567] ubiquitin-protein transferase activity [GO:0004842] AHTCFNR 0.92899 280.72 10.7729 9.98755 0 8.17423 12.2219 10.5063 10.6462 14.0982 9.37758 8.99147 11.1856 7.51617 11.1732 10.7419 11.3819 9.57082 8.31818 7.35641 10.0551 9.29866 10.2829 9.12722 10.2959 0 9.92707 6.9697 10.2351 9.99901 9.32562 5.3953 8.84134 11.3276 9.53306 6.02041 4.84222 9.34316 6.6946 8.31007 10.1733 8.73576 9.62845 3.83744 0 0 10.2201 9.55764 9.43294 10.2211 8.89887 10.2678 7.54257 8.1817 0 8.69394 5.0757 0 9.8513 7.62702 5.56605 10.255 9.41435 7.49121 0 A0A0B8RS94 A0A0B8RS94_PIG "SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1" SMARCC1 Sus scrofa domesticus (domestic pig) chromosome [GO:0005694] AALEEFSRVR 1.3989 323.31 13.3053 14.0578 12.6862 12.7503 15.7217 16.0497 15.8572 12.5988 15.6109 15.1325 13.9846 13.3313 12.6682 11.616 15.5467 16.1049 15.6396 15.6073 14.4944 15.149 15.2552 13.531 15.9495 14.3221 9.65155 12.4619 13.6924 14.9307 14.968 14.7015 15.0415 13.0706 13.6356 12.4369 13.4648 11.7728 12.8123 12.8138 13.3305 12.0321 11.7813 11.3245 12.2388 12.1571 11.7514 12.3058 13.8334 12.5868 13.441 13.4885 11.8963 12.9434 11.3269 11.2629 9.78118 12.9831 11.2746 13.7303 13.2551 13.5151 12.6306 11.92 12.5543 A0A0B8RS96 A0A0B8RS96_PIG Sodium/calcium exchanger 1 (Na(+)/Ca(2+)-exchange protein 1) (Solute carrier family 8 member 1) SLC8A1 Sus scrofa domesticus (domestic pig) cell communication [GO:0007154] plasma membrane [GO:0005886] calcium:sodium antiporter activity [GO:0005432]; calmodulin binding [GO:0005516]; metal ion binding [GO:0046872] DQDDEEAR 0.93159 219.46 9.19815 11.1313 11.6893 11.1568 10.2215 11.2441 11.3273 12.1857 10.9766 9.99563 10.6007 10.2815 10.982 0 8.0641 10.504 8.48317 9.89326 9.56754 9.9642 9.78712 10.9316 10.7938 11.0247 9.07068 9.51144 7.53052 9.47622 10.457 7.76354 7.97367 11.2276 9.79069 10.6629 7.83952 8.12469 11.3041 9.16644 8.75736 9.46734 8.12065 0 4.83005 10.0454 7.91809 8.98937 7.33762 8.36001 9.81031 11.1967 8.2897 0 9.97828 7.90563 7.08151 8.35279 8.42417 7.27417 8.78686 8.15071 3.77631 6.71012 7.2502 A0A0B8RS97 A0A0B8RS97_PIG "Solute carrier family 39 (Zinc transporter), member 1" SLC39A1 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] zinc ion transmembrane transporter activity [GO:0005385] AMELCLALLLHK 0.97178 56.273 0 9.04849 0 7.35014 0 0 0 0 0 3.0953 0 7.80781 3.62562 0 0 0 8.03127 0 0 0 0 7.65184 8.724 13.0384 0 11.1333 8.1443 0 0 9.62016 0 6.66761 0 8.5635 10.2422 0 9.82798 0 6.7301 0 0 9.50343 0 0 0 0 0 0 6.55727 0 4.24138 0 0 0 6.04205 0 10.2833 3.2888 0 0 6.10188 0 0 A0A0B8RS99 A0A0B8RS99_PIG "Solute carrier family 35 (CMP-sialic acid transporter), member A1" SLC35A1 Sus scrofa domesticus (domestic pig) carbohydrate transport [GO:0008643] Golgi membrane [GO:0000139] pyrimidine nucleotide-sugar transmembrane transporter activity [GO:0015165] ASLRENVLGSPK 0.96557 65.185 10.1111 0 0 0 9.59464 0 7.81743 8.35861 7.25965 0 6.87308 0 10.0815 10.3965 0 9.37437 0 0 0 0 6.12441 0 0 7.32957 8.63052 0 8.56434 8.73613 8.80755 7.68363 0 6.57322 0 7.10003 0 0 0 0 0 0 6.23967 7.4132 6.56852 0 0 6.43586 0 8.16722 10.0294 0 0 7.88289 0 0 11.9181 0 4.36653 0 10.5911 0 6.57871 0 0 A0A0B8RSA0 A0A0B8RSA0_PIG Mitochondrial glutamate carrier 1 (Glutamate/H(+) symporter 1) (Solute carrier family 25 member 22) SLC25A22 Sus scrofa domesticus (domestic pig) transmembrane transport [GO:0055085] mitochondrial inner membrane [GO:0005743] AEKQISLPAK 0.95564 146.89 11.1384 0 11.0661 7.60437 4.90352 10.0261 11.5893 13.1232 0 12.9599 10.2766 8.46152 13.6436 9.25751 9.1642 9.33327 12.9917 9.86963 5.85992 7.53496 0 12.7132 7.10538 13.0851 0 6.56009 10.5119 11.1634 10.5896 9.0773 9.01181 10.0728 9.51574 0 8.23774 5.30108 11.9063 9.47806 5.00724 5.97781 8.83105 9.39178 7.72451 9.43559 9.16279 10.8089 8.92615 8.98624 11.295 9.96537 9.51973 0 10.2574 8.22386 7.99418 10.3749 8.24008 0 9.25602 9.38491 8.32409 6.52665 5.75523 A0A0B8RSA1 A0A0B8RSA1_PIG SLAM family member 7 SLAMF7 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] ALIIVTQQR 0.96776 69.512 6.92232 4.19322 0 0 0 0 6.77545 0 6.9344 0 10.2439 0 8.75027 8.7486 0 0 0 0 0 0 0 0 0 8.34864 0 8.16239 0 0 5.4614 10.2346 0 7.12753 8.84427 0 0 9.22089 8.40752 7.53597 0 9.42849 0 0 0 0 6.36905 7.0445 0 5.47057 6.80542 10.2065 0 0 4.50799 0 4.44142 7.37547 0 7.93026 0 0 6.84975 0 2.76689 A0A0B8RSA2 A0A0B8RSA2_PIG SH3-domain kinase binding protein 1 SH3KBP1 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] kinase activity [GO:0016301] DCIDVGWWEGELNGR 0.97143 313.86 13.4115 13.163 13.2612 12.3883 14.8307 14.8697 13.6201 14.134 15.9998 12.8433 10.9035 11.7241 16.2298 13.0965 13.2692 16.229 13.816 15.7091 11.01 14.8912 12.7643 13.1409 15.9107 12.4863 13.951 13.0371 13.1271 12.879 12.7355 12.4957 14.1271 14.2602 14.1773 11.5433 9.06277 11.218 12.6018 13.0599 11.9902 11.5875 11.7864 10.9498 12.006 12.1752 12.2706 12.7832 12.755 12.5546 13.9538 14.0743 13.6908 12.4012 12.2808 12.529 12.7757 12.4859 12.8616 13.3491 13.0717 13.6459 11.9461 11.791 11.3882 A0A0B8RSA4 A0A0B8RSA4_PIG "Serpin peptidase inhibitor, clade B (Ovalbumin), member 8" SERPINB8 Sus scrofa domesticus (domestic pig) extracellular space [GO:0005615] serine-type endopeptidase inhibitor activity [GO:0004867] ADFSGMSVR 0.93145 219.71 10.9853 7.78202 10.9532 10.3276 6.16591 7.28114 13.6068 12.5594 13.6072 11.5671 11.3201 6.832 9.39609 9.64339 11.1596 8.98385 7.77946 10.189 10.3595 6.99322 10.1277 9.55758 12.2881 10.8826 9.23482 9.13368 3.88733 13.4612 9.077 8.04095 7.17423 8.18284 10.302 12.4473 10.6862 13.5694 11.7018 8.7811 13.6176 0 13.1651 8.72697 10.9034 11.2209 8.81609 11.8355 13.1116 13.2381 13.4345 11.8407 10.4112 12.9128 7.41726 7.7161 10.1482 6.19965 0 7.62461 0 11.0694 7.77558 10.5202 3.15872 A0A0B8RSA5 A0A0B8RSA5_PIG Vesicle-trafficking protein SEC22b (SEC22 vesicle-trafficking protein homolog B) SEC22B Sus scrofa domesticus (domestic pig) "endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; protein transport [GO:0015031]; retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum [GO:0006890]" endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; Golgi apparatus [GO:0005794]; melanosome [GO:0042470] SNAP receptor activity [GO:0005484] ANNLSSLSKK 0.97168 120.31 11.5578 10.7112 11.6099 11.9158 11.9438 8.39827 13.1966 12.0011 11.9778 12.024 0 10.4908 12.3688 11.9276 11.9379 12.8235 0 11.2239 11.4869 11.3281 12.2786 11.8579 11.8222 11.6937 7.92392 13.7237 7.76812 10.6544 8.29508 10.8073 11.2172 10.1335 7.37998 7.02857 0 0 7.5292 11.2065 0 10.0783 10.2342 10.2564 10.2398 16.4598 9.86412 11.2453 10.4588 11.6902 6.48597 11.3083 10.2839 5.96505 9.38256 9.47362 11.4271 11.3141 11.2431 11.6617 11.1544 10.2521 11.0966 10.8081 11.2193 A0A0B8RSA6 A0A0B8RSA6_PIG SAM and SH3 domain containing 3 SASH3 Sus scrofa domesticus (domestic pig) ARVHTDFTPSPYDHDSLK 0.95928 117.91 10.0249 6.90677 8.5072 10.2099 6.49302 7.66021 10.5355 10.4626 10.0669 8.03067 7.48985 6.77768 9.63352 11.4067 8.43875 10.43 7.198 7.18001 8.67994 6.5767 7.71966 9.2731 10.0059 6.14468 6.80297 8.67754 7.79396 7.28568 6.00423 8.57414 7.6756 8.72479 11.026 6.73335 8.65417 7.84699 8.79679 7.63372 8.64043 0 5.77884 6.78188 0 12.3533 12.7131 8.47314 7.49745 7.53426 0 7.87866 7.69502 0 6.89857 8.3458 0 0 8.45644 6.84361 7.44783 6.6427 8.07195 8.53372 5.13873 A0A0B8RSA8 A0A0B8RSA8_PIG Ribosomal L1 domain containing 1 RSL1D1 Sus scrofa domesticus (domestic pig) AAPAPSVDDAAAK 1.5422 323.31 16.1467 11.9021 16.5013 17.2576 17.478 12.8501 17.0367 18.3641 17.2579 12.1155 11.8971 17.0955 17.5302 17.1954 9.93072 17.4625 17.4414 17.2895 11.9787 11.8567 12.4977 18.1792 12.6294 11.6507 11.1727 11.4914 10.5745 16.7321 16.4836 16.523 17.2213 16.9363 17.1128 11.8795 11.6529 16.7342 11.5916 13.5777 17.1834 11.6432 11.2973 11.2728 12.5992 12.2187 12.7376 12.0815 12.7771 12.663 12.7623 10.0062 13.5158 12.0243 11.5072 17 11.3228 12.0796 12.4871 11.2866 11.3595 11.6233 11.0805 9.39823 11.3556 A0A0B8RSA9 A0A0B8RSA9_PIG 60S ribosomal protein L7a RPL7A Sus scrofa domesticus (domestic pig) ribosome biogenesis [GO:0042254] cytosolic large ribosomal subunit [GO:0022625] RNA binding [GO:0003723] AAGKGDVPTKRPPVLR 0.9697 163.75 0 9.49578 8.58146 8.62994 0 0 9.73028 9.34904 7.42727 7.17023 9.46655 8.16345 0 11.1045 10.9484 8.91943 0 8.06464 7.19672 10.3038 10.3508 0 10.6877 7.10852 8.84637 7.10832 7.92125 8.57732 8.82594 7.0542 8.30268 9.46487 7.39051 9.75175 0 0 9.82528 7.51657 8.69206 8.55002 8.02142 0 10.4286 8.64609 5.89542 8.69652 7.75429 8.46312 9.2563 9.52489 9.41253 5.12193 0 6.73335 6.35977 5.76243 5.82947 0 7.04286 0 0 0 7.01324 A0A0B8RSB1 A0A0B8RSB1_PIG E3 ubiquitin protein ligase (EC 2.3.2.27) RNF20 Sus scrofa domesticus (domestic pig) chromatin organization [GO:0006325]; protein ubiquitination [GO:0016567] nucleus [GO:0005634] metal ion binding [GO:0046872]; ubiquitin-protein transferase activity [GO:0004842] AELEDLRQR 1.5238 323.31 12.8015 13.469 13.076 14.9427 14.2628 13.9209 15.1409 12.4819 15.8447 14.6455 13.8152 13.4732 13.8104 13.032 13.836 14.6976 14.3471 14.4296 13.4202 14.9945 12.0929 13.5333 14.1788 15.723 13.5853 12.3542 12.6545 13.7395 13.1863 13.8617 14.1115 14.013 13.9364 10.7169 13.1353 13.1334 13.8624 13.4214 13.3997 13.0791 11.9678 11.2099 11.7949 11.4207 13.0454 11.8955 13.2873 12.5511 12.9636 11.3002 13.2636 13.1368 11.8421 12.3749 10.5863 11.644 10.6359 10.264 10.5787 8.74917 9.47395 10.3608 10.9055 A0A0B8RSB3 A0A0B8RSB3_PIG Protein RIC1 homolog RIC1 Sus scrofa domesticus (domestic pig) intracellular protein transport [GO:0006886] membrane [GO:0016020]; Ric1-Rgp1 guanyl-nucleotide exchange factor complex [GO:0034066] AARVDNFVLALKR 1.5148 323.31 10.1614 12.4248 9.59025 10.9941 10.9218 10.1824 0 10.2976 10.2008 8.40701 10.856 8.23539 0 14.1067 11.0731 14.3375 8.4759 9.29698 11.2531 10.3446 11.2515 11.1087 11.3444 11.7505 9.94357 6.86678 11.1243 11.9553 7.43754 10.4783 11.1049 4.69181 10.6166 8.9174 0 0 10.8605 9.34997 9.76419 5.31107 8.84822 9.31467 12.0172 9.52058 11.1104 9.89698 9.02051 10.5887 13.5858 10.0877 5.85699 6.22957 0 6.50965 0 7.37391 0 8.0404 10.4044 8.92529 6.01279 13.4794 5.20481 A0A0B8RSB4 A0A0B8RSB4_PIG RNA binding motif protein 28 RBM28 Sus scrofa domesticus (domestic pig) RNA binding [GO:0003723] AAEGVSAADMAKRER 1.4971 323.31 17.9577 17.9557 12.3606 9.75747 18.5606 12.6594 13.0821 11.8852 18.2305 18.5351 12.056 10.9787 18.4804 11.5322 10.9049 18.5222 18.3586 9.66621 10.9636 11.0654 10.2099 12.592 18.7596 18.621 18.4731 11.4826 10.5807 11.0247 11.0377 11.1034 11.5066 18.607 12.0661 10.3281 10.5679 8.36838 12.4483 10.5739 9.93832 17.2329 11.0556 9.70454 12.4616 11.6718 8.80487 10.2817 17.9835 18.2957 10.0507 11.0587 10.0215 16.9049 16.8418 8.98305 10.2717 9.26847 8.25323 17.2485 8.42551 17.3425 16.2105 10.7136 16.1489 A0A0B8RSB7 A0A0B8RSB7_PIG RAS guanyl-releasing protein 1 RASGRP1 Sus scrofa domesticus (domestic pig) cell differentiation [GO:0030154]; small GTPase mediated signal transduction [GO:0007264] endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]; plasma membrane [GO:0005886] calcium ion binding [GO:0005509]; guanyl-nucleotide exchange factor activity [GO:0005085] ADNNALK 0.95904 306.29 9.45759 6.00711 9.15459 9.75484 9.11949 10.4955 10.4283 9.13085 10.3817 9.87882 10.0149 10.093 9.18948 11.9356 10.0208 11.7298 9.53543 11.1425 10.9421 6.59641 8.72996 9.15492 7.68342 10.8667 9.5264 9.60149 8.6279 10.8619 9.46856 0 9.57979 12.4143 7.98094 6.86617 10.3552 0 9.43663 8.63633 9.93999 10.225 0 7.70646 9.94521 9.15043 8.77959 11.3975 0 0 8.56339 0 6.89239 10.8428 7.50303 10.0062 9.04377 7.13586 6.39652 4.42492 9.96303 6.71946 0 8.93443 0 A0A0B8RSB9 A0A0B8RSB9_PIG RAB GTPase activating protein 1-like RABGAP1L Sus scrofa domesticus (domestic pig) AMEEILR 0.96552 307.46 12.8769 11.3379 9.95593 12.9689 11.3507 8.65116 11.969 6.12695 13.2543 11.0679 11.7731 11.4023 11.2963 12.4683 14.1483 9.75076 14.8042 13.1447 12.9367 12.614 11.0641 11.327 12.3142 11.9595 9.63746 12.9922 11.5086 11.8571 9.64712 11.0895 10.6824 10.8721 10.3181 8.77564 9.96015 9.05121 10.3672 10.5707 10.6877 9.74128 0 8.59664 8.29297 0 0 11.3374 10.3468 9.22014 8.89448 10.7272 12.8285 9.22188 10.0802 9.173 8.41337 7.71129 9.96953 7.83517 7.58924 8.12609 8.35993 0 8.60392 A0A0B8RSC2 A0A0B8RSC2_PIG Ras-related protein Rab-2A (EC 3.6.5.2) RAB2A Sus scrofa domesticus (domestic pig) protein transport [GO:0015031] acrosomal vesicle [GO:0001669]; endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; Golgi membrane [GO:0000139]; melanosome [GO:0042470] GTP binding [GO:0005525]; GTPase activity [GO:0003924] AYAYLFK 0.96415 97.085 9.70183 9.27931 8.7038 7.22988 8.99611 9.58116 0 11.5403 11.6101 9.9867 10.8885 7.60755 8.31352 11.2611 12.1586 10.7613 0 0 10.4169 10.8113 10.4797 11.9858 6.55641 10.1533 6.44941 9.1005 6.79948 10.3823 0 3.78816 9.06703 9.07433 8.30163 3.69933 9.63387 6.44951 8.33445 7.76593 0 10.0393 9.48784 0 8.64872 0 8.92861 0 9.67532 10.0727 11.5265 10.5298 5.87873 0 9.43091 9.43141 9.4622 8.02259 8.11489 3.02724 5.8628 0 0 0 9.41032 A0A0B8RSC4 A0A0B8RSC4_PIG Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase (EC 4.2.1.134) PTPLB Sus scrofa domesticus (domestic pig) fatty acid biosynthetic process [GO:0006633] endoplasmic reticulum membrane [GO:0005789] very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase activity [GO:0102158] AAAAVTAATKGNGAGGGR 0.96593 64.279 9.3012 0 7.52857 8.99565 0 10.9421 0 9.99958 7.67786 10.0997 10.1022 0 10.1049 9.91241 10.0088 10.3142 5.67288 0 0 8.73478 8.2651 10.3154 10.6364 10.2787 0 10.3201 10.4016 0 4.92998 9.72393 6.08608 6.10022 10.8126 9.75994 9.68799 5.91363 6.7494 7.31343 9.80729 10.26 0 0 0 8.09851 6.53006 5.82873 8.67726 4.73227 8.64573 0 7.39968 5.7771 0 0 4.9792 5.91655 0 7.46033 6.16938 0 7.34837 6.89942 7.11187 A0A0B8RSC7 A0A0B8RSC7_PIG "Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3" PSMD3 Sus scrofa domesticus (domestic pig) regulation of protein catabolic process [GO:0042176] proteasome complex [GO:0000502] enzyme regulator activity [GO:0030234] AAAAAAEHSQR 1.4884 323.31 13.8524 9.73008 14.4696 13.9318 13.2427 13.8933 15.5402 15.6543 15.5305 10.7375 14.3562 15.2694 15.4107 15.2047 14.6124 13.7688 13.5894 14.3411 14.9048 14.6194 14.098 14.5498 15.4923 14.1302 14.0818 13.2121 13.8113 9.76674 12.1369 12.3117 13.4719 14.6168 14.3957 12.3542 12.789 12.6392 12.5383 12.8881 10.8969 12.9091 12.9974 13.0559 12.455 12.1775 12.525 13.3207 13.0036 13.0831 14.1285 13.6098 14.3624 13.3419 13.3142 13.0003 12.2854 11.8826 12.2166 12.7475 10.9543 12.8457 10.5849 11.0458 11.2513 A0A0B8RSC9 A0A0B8RSC9_PIG Protein arginine N-methyltransferase (EC 2.1.1.321) PRMT7 Sus scrofa domesticus (domestic pig) cell differentiation [GO:0030154]; methylation [GO:0032259]; spliceosomal snRNP assembly [GO:0000387] cytosol [GO:0005829]; nucleus [GO:0005634] histone H4R3 methyltransferase activity [GO:0044020]; protein-arginine omega-N monomethyltransferase activity [GO:0035241] AAVSRVKDR 0.95702 169.11 10.0006 10.1303 8.86854 10.1398 5.31904 15.9498 15.331 11.4248 10.6105 10.0943 10.0799 7.76255 10.801 10.7283 9.75914 8.7075 11.5329 9.06153 9.2572 8.92929 9.74841 9.6518 10.919 10.7209 8.60626 9.97742 8.91277 10.9154 8.0124 5.12932 0 8.76931 6.5081 11.671 8.62786 7.09149 0 8.16143 8.26181 8.51132 9.0036 8.82858 9.42909 8.98652 4.86676 9.38967 7.53768 7.9289 8.98945 8.92508 5.3211 9.61126 7.96411 10.1154 6.20116 0 6.72192 0 8.72151 8.74096 0 7.8132 9.27933 A0A0B8RSD1 A0A0B8RSD1_PIG "Phosphatidylinositol-3,4, 5-trisphosphate-dependent Rac exchange factor 1" PREX1 Sus scrofa domesticus (domestic pig) intracellular signal transduction [GO:0035556] guanyl-nucleotide exchange factor activity [GO:0005085] AFEETKHFPMDHSLQEFK 1.4629 323.31 13.5211 13.4357 13.6841 14.2943 15.3249 14.4231 15.4953 14.5933 15.6129 15.3661 15.3291 14.1405 15.6192 15.4639 15.5804 14.4366 14.5114 15.6644 14.6611 15.3699 13.6316 14.5355 15.4226 14.9736 13.7625 13.6188 14.461 15.029 14.9582 14.9458 15.139 14.5522 14.511 12.769 12.6724 12.649 14.4904 13.1095 14.0726 13.5684 13.133 13.7259 13.1253 13.4217 13.744 14.0508 14.2774 13.2018 14.7128 15.1527 14.9962 13.8158 13.5792 13.8832 11.7613 12.765 9.57739 11.763 12.3781 12.1658 10.8604 10.3671 11.3002 A0A0B8RSD2 A0A0B8RSD2_PIG DNA-directed RNA polymerase III subunit POLR3GL Sus scrofa domesticus (domestic pig) transcription by RNA polymerase III [GO:0006383] RNA polymerase III complex [GO:0005666] ASRSGGR 0.97071 86.711 8.11572 7.21286 8.69143 9.69683 4.86141 7.71356 9.47923 9.81361 8.9722 0 0 8.03243 10.095 8.98894 0 8.53722 11.6103 0 9.93306 9.2007 5.18721 0 9.38976 9.01221 0 7.55972 8.38901 0 6.52868 8.4245 0 9.72095 9.13175 0 0 7.1236 7.85524 7.40096 6.54134 7.47525 0 9.289 0 0 0 0 8.61132 6.94848 7.20173 0 0 0 8.8568 8.68163 3.8531 0 3.10623 7.17722 10.4554 0 9.92504 8.64274 6.44867 A0A0B8RSD5 A0A0B8RSD5_PIG "Pleckstrin homology domain containing, family B (Evectins) member 2" PLEKHB2 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] DCMLQIVCR 0.96064 59.449 0 0 0 0 0 0 7.96625 5.67322 0 7.77755 6.69014 6.23816 0 0 6.0274 4.70443 5.62161 0 8.56262 0 5.89521 7.29637 0 6.89809 8.99932 5.24557 7.54713 0 5.49688 0 0 5.90104 0 0 0 0 0 7.71713 0 9.88483 0 0 0 0 4.19834 0 0 0 0 0 7.47444 8.64364 7.26725 0 0 6.41854 0 5.67638 7.21043 0 0 0 0 A0A0B8RSD8 A0A0B8RSD8_PIG Urokinase plasminogen activator surface receptor PLAUR Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] membrane [GO:0016020] kinase activity [GO:0016301] APFFPRSR 0.96561 82.736 10.1245 10.007 10.4867 12.4187 11.7899 12.0265 12.5607 12.1604 12.3822 11.4886 11.4409 13.4251 12.2988 12.1769 11.9176 12.0775 12.2357 11.9406 11.4932 11.4371 11.5239 12.4425 11.7053 11.8775 11.4525 7.79636 11.6894 10.3436 10.6887 10.0794 11.164 10.7211 11.2491 10.6977 0 9.5217 10.6864 10.5804 10.6972 9.59147 7.87529 5.68271 9.45271 10.4534 9.40331 10.4605 10.4835 10.9126 11.2735 11.035 10.9223 10.2414 10.4637 10.4177 9.23328 9.22673 0 5.64818 8.9407 9.22783 0 7.46752 0 A0A0B8RSE1 A0A0B8RSE1_PIG RING-type E3 ubiquitin transferase (EC 2.3.2.27) PJA2 Sus scrofa domesticus (domestic pig) metal ion binding [GO:0046872] AAWPKSAGGYQTITGRR 0.95285 151.25 11.07 13.158 13.1367 9.71906 10.3141 11.3075 10.4081 10.5983 10.1816 12.7469 10.4687 12.676 10.0137 12.9732 12.3068 12.6841 10.8733 12.6709 7.15684 11.7226 11.3448 9.88405 10.1898 9.19185 10.7889 10.609 10.2671 13.2263 13.2703 12.0743 9.75243 10.8036 10.5223 12.5505 7.54133 12.0825 12.7258 8.42438 9.8638 11.893 9.20178 9.49255 10.036 0 10.389 9.94609 9.8948 12.541 10.9273 10.9851 10.7389 9.45028 7.83162 9.70939 9.99095 10.6115 9.79394 9.23091 10.0672 9.39285 9.88698 8.2674 8.23007 A0A0B8RSE4 A0A0B8RSE4_PIG "Protein inhibitor of activated STAT, 3" PIAS3 Sus scrofa domesticus (domestic pig) protein sumoylation [GO:0016925]; regulation of macromolecule metabolic process [GO:0060255] transferase activity [GO:0016740]; zinc ion binding [GO:0008270] AELGELKHMVMSFR 0.95363 152.68 11.1614 5.17433 0 11.1838 10.8296 0.902189 9.91243 11.2594 10.9321 13.0649 10.7323 13.0675 11.3955 8.87504 11.9389 8.42643 0 11.6426 6.74052 9.48109 7.56978 11.9087 9.53893 9.74192 9.74391 7.01636 6.04319 8.64742 0 11.042 11.0239 11.7299 11.2963 10.6448 0 5.95928 0 2.85607 6.43588 6.15295 9.57486 9.84271 0 7.92955 10.3577 4.64241 8.15127 7.26501 10.4903 0 7.39154 9.26538 11.5991 10.343 10.0032 0 10.1008 9.96622 6.50149 0 8.4335 8.54767 0 A0A0B8RSE8 A0A0B8RSE8_PIG GPI inositol-deacylase (EC 3.1.-.-) PGAP1 Sus scrofa domesticus (domestic pig) protein transport [GO:0015031] endoplasmic reticulum membrane [GO:0005789] "hydrolase activity, acting on ester bonds [GO:0016788]" AEDIDFK 0.95924 262.12 10.9981 11.3201 4.87322 7.37686 9.99859 9.81834 11.0629 11.0039 11.1266 8.59246 11.4816 8.61894 10.2553 10.4999 8.45232 9.51625 8.14904 9.70779 9.06037 9.9647 0 10.5313 0 11.2701 3.57785 9.15119 7.34172 6.64302 10.8928 10.1183 9.46553 7.29232 8.80958 8.92804 9.52246 6.4582 9.92236 5.49946 11.0855 10.9189 9.08127 0 9.75586 11.94 9.71953 0 11.7354 0 10.8606 11.0369 9.13689 7.78005 11.0318 7.37851 10.506 10.4001 5.97 5.61606 10.8037 0 7.94433 0 10.7835 A0A0B8RSF3 A0A0B8RSF3_PIG Pyruvate dehydrogenase phosphatase regulatory subunit PDPR Sus scrofa domesticus (domestic pig) oxidoreductase activity [GO:0016491] AALLEQKQNGVYK 1.0323 323.31 9.88041 10.5375 10.2869 12.1223 12.078 11.444 11.766 11.1635 10.6875 9.61749 10.8384 11.7182 12.4648 12.2414 11.9577 9.87733 10.117 10.9573 11.2527 11.038 0 11.4025 10.9952 11.1387 10.8568 6.32964 9.32396 9.41918 9.42557 10.9237 10.4531 10.8292 10.3829 10.8735 10.7314 9.59796 10.3604 10.7544 7.52286 0 10.3061 9.95487 11.3381 10.1944 11.0804 11.2174 10.5082 10.4185 8.76901 10.8057 10.3105 7.83656 8.33293 7.69077 8.77531 8.94512 8.87073 10.5549 8.86527 7.99645 0 7.84292 8.95032 A0A0B8RSF7 A0A0B8RSF7_PIG Poly(RC) binding protein 4 PCBP4 Sus scrofa domesticus (domestic pig) RNA binding [GO:0003723] AERQKFSPY 0.96814 62.735 0 0 0 7.17283 10.9685 5.94587 0 7.75241 0 10.3481 0 7.79175 0 0 13.2198 8.18205 0 0 8.27533 9.47427 8.90521 0 9.48506 10.1364 0 0 3.63238 8.34029 8.55578 11.3276 0 8.56358 0 10.412 8.31456 0 10.405 10.386 11.0498 12.2011 11.6485 10.3936 10.4372 7.89893 0 0 12.2695 7.64559 6.32884 9.81194 0 9.40633 1.64925 9.20543 0 0 5.58658 0 0 8.5713 0 0 0 A0A0B8RSG1 A0A0B8RSG1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha (Lissencephaly-1 protein) (LIS-1) (PAF acetylhydrolase 45 kDa subunit) (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha) PAFAH1B1 LIS1 Sus scrofa domesticus (domestic pig) cell differentiation [GO:0030154]; cell division [GO:0051301]; establishment of mitotic spindle orientation [GO:0000132]; lipid catabolic process [GO:0016042]; microtubule sliding [GO:0051012]; nervous system development [GO:0007399] centrosome [GO:0005813]; cytoplasm [GO:0005737]; microtubule [GO:0005874]; microtubule associated complex [GO:0005875]; nuclear membrane [GO:0031965]; spindle [GO:0005819] dynein complex binding [GO:0070840]; hydrolase activity [GO:0016787] AIADYLR 0.92931 223.75 0 8.99274 9.29251 10.1912 10.5223 10.8231 10.6576 11.6201 9.02142 7.87719 11.1165 9.66286 11.2708 10.399 10.9191 9.69213 10.3692 8.10523 9.67932 8.61136 10.2516 10.7891 11.722 11.2944 9.92754 9.54154 11.0583 9.63639 8.92443 9.06299 11.2165 6.58099 8.31922 9.4396 10.4964 8.8989 11.1652 9.74445 10.7159 7.54466 0 8.78849 9.5974 8.2094 9.35889 8.67342 9.8435 8.44456 9.43991 9.33302 0 8.94793 9.10056 10.2687 9.93047 4.19298 8.65743 7.53807 0 7.05028 5.20836 7.27324 8.13561 A0A0B8RSG5 A0A0B8RSG5_PIG "Purinergic receptor P2Y, G-protein coupled, 14" P2RY14 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] G protein-coupled purinergic nucleotide receptor activity [GO:0045028] ARHDLETSK 0.9636 118.93 10.7807 10.8066 10.9936 0 8.61187 8.59044 11.9468 9.17577 12.167 9.74908 10.7342 11.5618 11.4667 10.1797 13.9578 9.43786 11.5039 10.3793 10.6198 10.4488 12.0639 10.7903 12.4473 11.3542 6.72656 7.7086 9.46646 12.0239 11.9837 11.8427 12.9209 12.5358 10.253 10.7403 11.0992 0 11.5262 11.3415 8.10711 6.81263 8.44779 9.31694 5.98648 9.08255 14.5458 10.3192 8.09307 10.7956 10.3385 7.91588 10.9782 10.446 8.20638 10.4162 11.2093 11.2565 11.1911 10.2627 8.08071 9.92594 7.03232 2.95895 5.8253 A0A0B8RSG9 A0A0B8RSG9_PIG Oxysterol-binding protein OSBPL11 Sus scrofa domesticus (domestic pig) lipid transport [GO:0006869] lipid binding [GO:0008289] ATDAKERQHWVSR 0.94098 300.14 11.73 11.7287 11.2556 12.423 12.9851 12.4747 14.186 13.3507 13.132 11.9637 12.2998 11.7381 13.5974 12.6149 13.1828 11.7229 11.2268 10.6775 11.3428 11.5225 10.7427 12.7844 12.1422 12.7177 11.2072 6.71246 6.04601 12.0806 12.219 12.1559 11.5496 11.232 11.8562 9.03579 10.4793 10.2431 11.7165 11.6099 11.9678 12.143 11.2625 11.1714 10.9489 10.8784 11.323 12.4388 11.9526 11.3713 9.98627 10.2364 10.5421 10.8823 8.36628 9.87862 12.5828 12.6168 12.3189 12.546 12.3631 12.0808 12.5338 11.7693 11.791 A0A0B8RSH2 A0A0B8RSH2_PIG Opioid growth factor receptor-like 1 OGFRL1 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] opioid growth factor receptor activity [GO:0140625] APKTPAPPSSGHHSQMSMHKK 0.95044 277.43 12.0815 10.5779 11.3701 11.4707 11.9425 12.2267 11.9784 11.8487 12.5795 10.541 12.0681 11.5266 9.25588 10.7947 10.9683 13.6328 13.0894 11.2498 12.1329 11.2434 10.5346 10.2759 10.8097 11.5863 10.4665 8.5299 11.3627 10.4063 10.2713 11.2005 10.7557 10.8831 13.4611 10.9181 7.43346 9.32396 5.25746 13.3004 0 10.157 0 9.8759 11.6239 10.6974 9.7468 9.62406 10.0961 12.2467 6.98698 11.5176 9.30916 10.4001 10.0246 9.24596 9.88 0 8.57096 10.2153 9.58325 10.281 8.33333 0 7.05289 A0A0B8RSH5 A0A0B8RSH5_PIG Nuclear mitotic apparatus protein 1 NUMA1 Sus scrofa domesticus (domestic pig) intracellular organelle [GO:0043229]; membrane-bounded organelle [GO:0043227] AAAAVVK 1.0847 323.31 13.7037 14.0408 12.8882 14.6432 14.3658 14.2398 18.3246 14.4272 14.1429 13.3098 12.5006 13.3191 15.4629 13.6467 13.6805 14.3693 13.2245 13.2597 13.2938 12.9907 13.0949 14.4658 15.6746 15.0133 13.4642 10.808 12.7339 11.4425 13.1705 11.5792 13.8506 13.6838 12.2984 10.2035 12.4626 12.3276 12.2706 12.609 12.5521 17.7297 12.4326 10.4604 12.5662 12.622 11.3175 12.4879 13.2587 11.6271 12.4552 12.913 12.478 11.7642 11.3488 11.4139 12.0016 12.556 12.1932 12.5693 12.8845 12.6386 11.6296 11.293 11.0621 A0A0B8RSH9 A0A0B8RSH9_PIG Glucocorticoid receptor (Nuclear receptor subfamily 3 group C member 1) NR3C1 Sus scrofa domesticus (domestic pig) chromatin organization [GO:0006325] centrosome [GO:0005813]; mitochondrion [GO:0005739]; nucleus [GO:0005634]; spindle [GO:0005819] DNA-binding transcription factor activity [GO:0003700]; nuclear glucocorticoid receptor activity [GO:0004883]; sequence-specific DNA binding [GO:0043565]; steroid binding [GO:0005496]; zinc ion binding [GO:0008270] AFPKTHSDGAPEQPNVK 0.93439 237.78 12.5274 10.0464 13.672 10.1084 11.896 11.5925 10.9829 10.5141 11.4885 12.3354 10.6383 10.6235 14.5057 11.2549 10.734 8.83961 9.51165 10.6441 12.3977 11.4782 8.13919 11.8147 11.0146 10.5913 7.89263 8.78215 6.41868 11.0015 9.45298 9.81861 11.4197 10.167 11.2678 10.7868 9.31023 12.3657 9.65601 9.60777 11.5661 5.70105 8.75305 11.0907 9.58926 8.44857 8.82416 11.7397 9.41768 10.2438 9.63398 6.51652 8.87695 10.3662 10.2233 12.1392 6.64688 8.73819 10.1933 9.53393 9.66865 9.4215 9.55267 0 7.00641 A0A0B8RSI3 A0A0B8RSI3_PIG NOP58 ribonucleoprotein NOP58 Sus scrofa domesticus (domestic pig) ribosome biogenesis [GO:0042254] box C/D RNP complex [GO:0031428]; nucleolus [GO:0005730]; small-subunit processome [GO:0032040] snoRNA binding [GO:0030515] AEKYEHKSEVK 0.92473 230.21 9.39442 11.2913 8.05859 9.79045 12.359 6.48444 10.6137 10.5094 11.0849 12.3689 10.5828 12.8669 13.7945 11.7745 8.85524 3.65558 11.6874 11.8034 10.8633 10.0622 11.1096 11.8007 11.0899 10.3612 11.1975 9.51051 11.6899 8.72342 7.48018 10.0978 13.2788 13.5892 13.2765 11.3596 11.5907 11.3256 12.4478 11.9048 12.7186 10.8674 10.5291 9.10211 11.5157 11.1331 9.07004 9.35387 6.2107 6.50526 12.1253 11.8718 11.3829 10.0488 11.1527 6.89118 11.0666 11.317 11.3435 6.99073 10.7465 10.6094 8.20657 6.9197 0 A0A0B8RSI9 A0A0B8RSI9_PIG Nuclear factor 1 NFIC Sus scrofa domesticus (domestic pig) DNA replication [GO:0006260]; positive regulation of DNA-templated transcription [GO:0045893] nucleus [GO:0005634] DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700] AFAYTWFNLQAR 0.97949 190.71 11.5132 0 9.20477 11.0676 7.03826 9.29976 10.5496 10.2775 5.42418 12.1491 6.01473 10.5448 10.6668 11.4444 12.5294 0 8.07916 11.5648 0 10.176 11.5891 11.4237 12.1758 10.6443 7.43721 10.0965 0 9.60266 0 10.2146 9.3842 6.04954 11.4599 4.60383 10.3016 9.2516 7.56301 11.106 11.067 9.76374 9.37832 0 11.0894 9.09173 10.7329 9.63496 10.2306 9.3932 10.3726 5.46385 10.655 7.89524 10.7114 7.60711 7.95751 9.97413 0 8.87995 6.91719 3.9314 3.25876 10.8375 5.88024 A0A0B8RSJ1 A0A0B8RSJ1_PIG Protein NDRG1 (N-myc downstream-regulated gene 1 protein) NDRG1 Sus scrofa domesticus (domestic pig) ISGWTQALPDMVVSHLFGK 0.96307 72.448 8.69971 9.52166 8.43966 9.72506 10.7654 10.1068 7.18696 9.72658 9.54402 0 9.73386 0 0 10.7546 11.3602 0 10.8083 9.31225 8.64771 8.72356 8.48059 0 6.96 8.7341 7.94345 0 0 8.98142 9.02092 9.10792 10.0027 0 9.40193 0 10.5482 0 6.82566 6.13044 9.41576 0 0 8.00428 0 0 9.15823 0 8.17637 9.01352 8.37704 0 7.96642 7.75201 7.53013 7.75569 8.51033 0 0 7.65335 0 9.32335 0 0 6.72397 A0A0B8RSJ6 A0A0B8RSJ6_PIG NEDD8-activating enzyme E1 regulatory subunit NAE1 Sus scrofa domesticus (domestic pig) protein neddylation [GO:0045116] NEDD8 activating enzyme activity [GO:0019781] AKKDAAAVGNHVAK 0.95212 204.74 10.0863 9.91973 0 11.6656 11.1457 11.6237 12.1293 12.0267 11.1008 11.2886 10.4078 12.4744 9.17505 8.65982 12.3923 11.2448 10.6453 0 6.98117 9.36102 11.8063 10.7557 11.6576 11.1478 11.7387 0 11.1382 10.7941 11.5636 11.5934 11.239 12.0523 11.4588 11.121 11.6041 11.2748 11.2882 11.6573 0 11.4253 10.9975 10.7409 10.6306 10.9562 10.2288 9.94056 0 8.99574 11.8723 0 11.3735 10.7779 0 9.81509 10.6427 10.9111 10.3996 9.60331 6.3951 9.69145 9.47271 9.49797 9.47123 A0A0B8RSK1 A0A0B8RSK1_PIG Myosin IE MYO1E Sus scrofa domesticus (domestic pig) myosin complex [GO:0016459] actin binding [GO:0003779]; ATP binding [GO:0005524]; cytoskeletal motor activity [GO:0003774] AAPPPPGYHQNGVLK 1.0711 323.31 11.4068 12.0831 10.4816 13.647 14.2786 13.4722 14.4614 12.5653 13.1696 13.767 12.9761 14.2956 13.438 13.5567 13.2713 13.2296 13.4506 13.4464 12.4217 12.3752 10.3305 14.0058 13.8972 13.3171 12.1398 9.86442 11.6574 11.7331 12.6781 12.6106 12.9836 12.728 13.062 11.6992 13.1978 7.95123 11.7734 13.0745 11.7394 11.6301 12.034 11.4173 11.4898 12.1721 12.2396 12.0299 11.8793 10.4153 11.287 11.7988 13.0397 11.7796 11.5589 12.5144 11.0842 10.5293 11.9052 12.298 11.2612 11.3245 11.3343 9.62319 11.36 A0A0B8RSK4 A0A0B8RSK4_PIG Serine/threonine-protein kinase mTOR (EC 2.7.11.1) MTOR Sus scrofa domesticus (domestic pig) negative regulation of autophagy [GO:0010507]; phosphorylation [GO:0016310]; positive regulation of protein metabolic process [GO:0051247]; regulation of cellular component organization [GO:0051128]; response to chemical [GO:0042221] TORC1 complex [GO:0031931] ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; protein-containing complex binding [GO:0044877] AAKCRAYAK 1.0622 323.31 12.5526 10.2312 12.4751 12.8597 12.8735 12.3225 12.9226 12.6124 14.2148 11.6665 13.919 13.2368 12.5998 12.5396 12.075 12.9109 12.208 11.4881 13.395 11.8691 10.1561 10.4685 13.6828 13.1448 11.141 11.2845 13.2284 14.1658 13.4281 14.0308 12.4738 11.4401 12.7244 13.1974 11.6341 12.4855 13.2808 11.4052 11.7326 10.7436 8.77949 11.8043 11.0978 11.7709 9.11132 10.491 10.5558 11.3281 12.114 12.4275 11.5622 9.41092 11.696 11.687 10.579 11.846 10.9905 10.5662 8.50716 9.84571 8.9697 10.0677 9.41109 A0A0B8RSK8 A0A0B8RSK8_PIG MAX network transcriptional repressor MNT Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] protein dimerization activity [GO:0046983] AHLKECFETLK 0.95091 203.15 10.2511 9.84634 5.56209 8.20379 9.96924 0 0 8.44191 6.02908 10.047 11.2822 4.96933 9.10111 9.07719 10.0444 9.22018 9.76906 7.27445 11.7327 8.67105 9.50152 10.5874 9.2507 6.7126 9.76316 11.0567 0 6.01977 11.783 12.6518 10.1219 8.68731 9.85957 0 0 0 9.72262 10.2466 9.36765 6.14027 8.31963 0 8.24997 9.02592 8.94363 0 10.7734 6.5174 0 0 8.76527 9.41614 5.76331 9.06218 6.61122 3.53232 11.1396 9.72236 8.63143 10.4743 9.82069 10.2501 8.90608 A0A0B8RSL1 A0A0B8RSL1_PIG Microphthalmia-associated transcription factor MITF Sus scrofa domesticus (domestic pig) regulation of DNA-templated transcription [GO:0006355] nucleus [GO:0005634] DNA binding [GO:0003677]; protein dimerization activity [GO:0046983] AESECPSMNTHSR 0.94487 209.06 10.1604 12.486 11.0593 10.2514 8.61934 9.4433 11.1067 9.53823 11.6924 11.0916 9.50779 11.1629 11.1793 11.6867 10.0974 7.88649 10.2819 10.2448 10.3921 10.9446 10.1047 12.8449 11.8831 11.8242 10.0279 0 10.4076 9.62302 9.84497 11.4189 11.8166 11.0649 11.457 6.03798 5.41075 11.4111 11.2584 11.0395 10.5952 10.4129 7.22477 9.52186 0 9.8314 9.8559 10.2544 9.25727 9.07911 9.94623 8.90824 10.2482 7.83611 5.5008 7.50422 0 9.77919 10.6553 7.81922 11.0325 5.71576 6.22635 0 5.77681 A0A0B8RSL6 A0A0B8RSL6_PIG Methyltransferase like 7A METTL7A Sus scrofa domesticus (domestic pig) methylation [GO:0032259] S-adenosylmethionine-dependent methyltransferase activity [GO:0008757] ALERASFSTLK 0.95711 102.9 6.13105 9.82454 11.9583 6.13087 10.0142 10.8192 0 6.27808 6.67666 10.9727 11.6047 9.22976 0 11.2379 12.4678 9.48653 5.26228 0 9.78629 8.69498 9.68897 11.0028 8.52583 8.78051 7.12887 8.36929 6.49166 6.54051 6.2578 8.36838 11.92 7.19643 10.0192 5.24667 8.71833 0 5.36503 6.15733 10.181 7.04253 9.71471 0 7.26744 0 9.0373 0 7.77564 9.88501 8.48969 0 0 8.85894 7.56674 5.99508 8.25418 0 0 7.47484 0 7.81948 9.6746 0 0 A0A0B8RSM0 A0A0B8RSM0_PIG Metallo-beta-lactamase domain-containing protein 1 (Endoribonuclease MBLAC1) MBLAC1 Sus scrofa domesticus (domestic pig) cytosol [GO:0005829] DGDEDSWQALSEDPVAQK 0.96256 45.707 0 7.21839 0 0 0 5.06035 0 0 0 6.75596 0 0 0 7.18319 0 0 0 6.99899 0 6.8824 7.52748 0 0 0 4.55784 0 0 4.99901 7.507 0 0 0 0 4.08389 0 8.4793 0 0 0 7.60578 0 0 5.43293 8.21451 0 7.39669 0 0 0 0 0 0 0 0 5.99014 0 0 0 0 5.66346 0 7.77505 6.74039 A0A0B8RSM3 A0A0B8RSM3_PIG non-specific serine/threonine protein kinase (EC 2.7.11.1) MAP4K5 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; MAP kinase kinase kinase kinase activity [GO:0008349]; protein serine kinase activity [GO:0106310] AERTASEINFDK 1.0492 323.31 9.99435 9.55524 10.3744 10.561 10.0737 10.7958 11.6943 9.12272 11.003 9.02876 7.60615 11.0921 9.03807 10.7348 10.4814 9.55612 11.6119 9.19935 10.3677 10.8443 7.13873 9.49649 10.7686 10.2529 9.65539 11.3044 10.8103 9.58214 10.922 8.73067 10.7243 11.5518 6.12329 9.94411 9.26334 10.4537 11.5771 11.118 9.55771 8.64285 9.07138 4.92719 7.68173 0 11.0715 7.97739 8.29907 8.99081 11.9605 10.4138 11.1184 11.3457 9.33456 10.6011 5.22489 9.15894 9.50506 8.04767 8.94348 8.32782 10.5972 8.14878 8.38935 A0A0B8RSM6 A0A0B8RSM6_PIG Mitogen-activated protein kinase kinase kinase 2 MAP3K2 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674] APTNWRLGK 0.95203 205.19 7.91181 9.89639 8.59242 5.22574 9.8515 0 10.6587 0 9.66327 8.81746 8.84712 9.38828 9.473 10.1503 8.79695 0 7.77959 8.65764 6.57413 6.83908 9.4434 8.12588 10.7049 10.596 7.84762 5.90489 4.98308 9.05504 9.47871 10.1657 11.9279 9.05384 11.1233 11.3754 10.0411 8.30355 9.97398 10.5489 10.7752 10.5098 9.51041 0 9.58336 9.98342 9.10016 9.45998 6.00452 0 6.96498 11.7451 0 6.25516 9.52579 9.03417 8.83668 7.32021 8.82706 8.16108 6.64573 0 9.8357 0 8.17931 A0A0B8RSM9 A0A0B8RSM9_PIG Insulin-like growth factor 2 receptor M6PR Sus scrofa domesticus (domestic pig) protein targeting to lysosome [GO:0006622] endosome [GO:0005768]; Golgi apparatus [GO:0005794]; membrane [GO:0016020] protein domain specific binding [GO:0019904] AVVMISCNR 0.96065 124.91 12.3067 12.1742 12.6647 13.879 13.3264 13.3518 13.3153 13.179 11.3355 13.6357 13.0434 2.68592 11.4789 9.65206 8.88255 12.157 13.1553 13.4327 12.058 13.0858 9.55501 13.4951 13.6327 11.5492 10.1387 12.3075 11.1201 13.1982 12.8286 11.7136 13.848 11.5795 12.095 12.1774 0 12.2446 12.4311 12.3475 11.532 11.1914 10.6778 10.7379 12.0108 11.8848 11.5648 10.2351 9.18517 11.2996 11.6246 12.3211 8.92071 12.3641 11.1731 11.7778 10.8349 10.842 10.8473 10.3079 11.4998 11.2056 8.85817 10.5562 11.2913 A0A0B8RSN2 A0A0B8RSN2_PIG U6 snRNA-associated Sm-like protein LSm4 LSM4 Sus scrofa domesticus (domestic pig) AVAAVACSSR 0.96434 94.779 0 0 8.80103 7.93227 0 7.52066 6.71218 9.98399 8.79172 9.28757 0 0 9.68731 0 0 0 0 0 6.78934 7.67016 6.92837 9.11158 9.02467 9.09603 7.01491 0 5.17576 7.45779 0 0 10.2024 10.3199 10.5623 11.3675 10.1872 0 10.3218 8.69401 4.54757 9.58312 0 0 6.07015 10.9936 8.55547 0 8.3258 6.03259 9.73186 7.68138 0 10.2531 9.19618 0 9.31102 0 0 0 8.53146 5.04518 0 0 8.71723 A0A0B8RSN6 A0A0B8RSN6_PIG Low-density lipoprotein receptor-related protein LRP6 Sus scrofa domesticus (domestic pig) anatomical structure morphogenesis [GO:0009653]; canonical Wnt signaling pathway [GO:0060070]; endocytosis [GO:0006897] plasma membrane [GO:0005886] Wnt receptor activity [GO:0042813]; Wnt-protein binding [GO:0017147] AAMDGSER 1.0407 323.31 10.0133 9.97828 7.35306 10.8307 10.7938 10.7768 14.4712 9.45683 11.0064 9.6351 9.57524 10.9638 10.1279 10.5727 10.9902 10.279 9.51704 10.9821 11.2233 10.932 9.77624 9.99563 11.1938 11.9915 10.3772 11.5875 10.8513 8.55378 8.49901 10.2698 12.41 8.90072 9.48492 8.31402 9.96076 12.933 10.3875 7.3779 12.7876 9.33702 10.5398 11.4107 8.77261 0 9.06601 7.64017 8.57035 8.5601 10.0045 10.9113 9.62147 8.68916 9.22202 13.5444 9.6893 9.86406 9.44578 8.78774 5.23818 7.44294 6.36547 2.72977 8.59861 A0A0B8RSN9 A0A0B8RSN9_PIG BLOC-1-related complex subunit 5 LOH12CR1 Sus scrofa domesticus (domestic pig) lysosome localization [GO:0032418] lysosomal membrane [GO:0005765] AKMDDIVVVAQGSQASR 0.9634 95.498 0 5.31216 9.11977 13.0001 4.93763 7.97154 8.74618 4.32495 8.09903 9.3856 7.94281 8.71239 0 5.67497 6.78464 7.82451 7.49993 5.42031 7.87652 12.3902 13.1722 0 0 0 6.36697 0 0 9.16687 9.55057 9.68349 9.82353 6.0274 4.9314 0 4.35417 0 8.33441 10.386 0 5.85372 0 0 10.2398 12.3008 0 7.37955 5.20328 5.77009 7.48744 8.91982 7.1821 0 6.98687 0 5.69162 5.71957 3.39451 9.29825 1.42664 0 0 0 5.6826 A0A0B8RSP0 A0A0B8RSP0_PIG "Legumain (EC 3.4.22.34) (Protease, cysteine 1)" LGMN Sus scrofa domesticus (domestic pig) proteolysis involved in protein catabolic process [GO:0051603] cysteine-type endopeptidase activity [GO:0004197] ASSPISLPPVQHLDLTPSPEVPLTIMKR 0.96137 132 9.59528 9.61268 9.94815 11.0315 10.9559 11.6027 11.2939 14.5177 10.1939 10.2313 0 10.5602 12.7574 11.3942 11.0743 11.0572 10.926 11.3711 10.6345 11.822 9.79168 12.0167 12.2195 14.5202 10.0604 10.5972 10.7356 9.62055 9.0555 9.9187 11.5358 9.37771 9.91548 4.51027 10.1084 9.67545 10.2947 10.1644 11.0666 5.89421 8.34034 0 6.54987 5.69399 8.0634 9.66194 9.47725 9.45053 10.5808 11.3671 0 10.5017 9.20369 12.8181 11.2675 10.4557 10.0375 0 8.99932 10.6987 7.90653 5.99415 7.48655 A0A0B8RSP3 A0A0B8RSP3_PIG Importin subunit alpha KPNA4 Sus scrofa domesticus (domestic pig) protein import into nucleus [GO:0006606] cytoplasm [GO:0005737] nuclear import signal receptor activity [GO:0061608] ADSEKLDNQR 0.95949 131.54 6.31386 8.22603 0 9.86895 9.98271 8.05246 9.15284 8.22405 0 6.01109 14.4235 5.2681 0 0 4.78759 0 10.7991 9.30656 0 11.53 0 9.96766 9.37842 9.76129 0 9.98185 0 8.06167 0 9.73201 8.60877 8.63125 9.24301 0 7.81743 0 0 7.9441 0 4.67615 5.76163 0 7.33324 11.4248 11.7466 8.92701 8.04871 0 8.13694 8.79627 8.34873 8.12272 6.73579 7.38163 7.55028 0 10.9408 0 10.8848 7.20144 0 9.07066 7.40786 A0A0B8RSP6 A0A0B8RSP6_PIG Kelch domain-containing protein 10 KLHDC10 Sus scrofa domesticus (domestic pig) CHSCVQIK 0.96583 77.197 0 6.29232 6.44611 0 11.4898 0 0 8.2183 5.15433 8.07237 8.488 4.45431 0 9.79336 9.37463 0 6.89239 8.53543 7.79064 8.75849 0 8.46025 0 0 0 5.99173 0 7.27006 13.9695 5.37504 0 6.56637 10.5804 7.81909 4.02715 8.539 5.76455 9.08818 6.95303 0 0 6.13467 10.856 10.7017 10.5524 7.54743 6.77939 0 0 7.28494 6.26416 0 6.31092 0 8.19357 0 0 7.41329 8.93543 0 7.60718 7.60199 0 A0A0B8RSP8 A0A0B8RSP8_PIG Transmembrane protein 131-like KIAA0922 Sus scrofa domesticus (domestic pig) ACLSSPVVQGYFR 1.0364 323.31 11.5344 11.9676 11.4861 11.4157 13.7596 11.8706 11.3904 10.7101 12.1472 10.3498 10.8001 11.4071 12.1837 12.5757 13.4558 11.9453 12.81 12.9037 10.9595 12.1433 12.0306 13.5161 11.8086 10.9944 12.3423 9.85186 11.0978 11.4527 11.7528 11.9566 12.1274 12.48 12.6446 11.3188 11.5173 11.032 11.4437 11.3518 10.2438 9.93519 11.1444 10.8949 10.7453 11.1173 10.3855 11.7943 11.7385 12.4678 11.8595 11.6725 11.4799 10.6402 10.8296 12.1969 8.52325 11.0865 10.8913 10.6344 10.5205 9.72606 8.2197 9.18708 9.01156 A0A0B8RSQ1 A0A0B8RSQ1_PIG Lysine (K)-specific demethylase 7A KDM7A Sus scrofa domesticus (domestic pig) chromatin organization [GO:0006325]; methylation [GO:0032259] nucleus [GO:0005634] dioxygenase activity [GO:0051213]; metal ion binding [GO:0046872]; methyltransferase activity [GO:0008168] AKDNDLR 1.1228 323.31 12.8126 8.59768 12.8225 10.8163 10.489 8.74547 12.0046 11.2976 11.6943 7.0765 10.7179 11.0503 12.5366 12.113 9.51706 9.56312 10.1454 10.0638 11.0638 10.7899 10.518 11.2586 10.9391 10.9294 10.0363 7.35482 8.82795 9.35495 11.9398 11.6103 12.1131 10.3997 12.7232 11.414 10.0895 12.2838 11.1006 12.2071 7.72192 12.7598 9.56449 9.1849 10.9665 9.92394 10.3704 10.2103 9.56872 10.9646 10.2472 9.24101 10.5344 9.54799 9.9252 10.4814 6.35177 9.18522 9.24764 11.2362 11.0963 8.96855 11.4391 10.6644 7.95385 A0A0B8RSQ5 A0A0B8RSQ5_PIG Lysine-specific demethylase (EC 1.14.11.65) KDM3A Sus scrofa domesticus (domestic pig) demethylation [GO:0070988]; methylation [GO:0032259] cytoplasm [GO:0005737]; histone deacetylase complex [GO:0000118] histone H3K9 demethylase activity [GO:0032454]; metal ion binding [GO:0046872]; methyltransferase activity [GO:0008168] AFLVEHNLVLAER 1.1327 323.31 12.0108 9.51696 10.9267 13.0527 11.4409 11.9523 11.548 12.1849 10.7591 11.7292 11.8129 11.1206 12.0681 12.3557 13.9363 11.5718 11.7237 11.6979 11.276 9.36724 9.35733 11.518 11.6408 12.8691 10.7394 10.2594 10.4358 9.91589 9.3972 9.99138 10.1972 10.6441 11.5475 9.57575 8.55398 12.0301 10.8365 12.0792 9.73033 9.5674 11.5341 11.1962 9.33013 9.71435 9.03287 9.19668 9.7863 10.3989 10.1379 10.5553 10.9195 10.6837 9.8133 9.67214 9.75866 9.99803 8.12148 11.03 9.5843 10.8894 10.0522 10 6.141 A0A0B8RSQ6 A0A0B8RSQ6_PIG JRK-like JRKL Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] DNA binding [GO:0003677] AGLLQNNLEEGNDLK 0.925 224.4 8.03403 11.1008 0 9.02495 0 9.552 10.6553 11.257 11.7777 10.0712 10.9774 9.16779 9.69589 9.5053 9.49775 9.56594 10.2514 9.63608 10.5588 10.0511 8.02619 11.2994 9.29918 7.25946 8.66014 5.48871 8.11962 0 6.17495 9.91287 8.05967 9.88247 6.97143 8.04352 9.49343 10.255 8.97802 9.89775 10.5477 9.41559 8.53962 9.36063 7.45385 8.64292 9.91495 9.70803 9.1205 8.61956 11.8497 9.50581 10.815 9.34021 9.12332 7.48688 5.99431 6.96232 10.4904 7.89512 7.00663 7.56742 6.65464 9.37391 11.0402 A0A0B8RSQ9 A0A0B8RSQ9_PIG "Integrin, alpha 5 (Fibronectin receptor, alpha polypeptide)" ITGA5 Sus scrofa domesticus (domestic pig) cell adhesion [GO:0007155]; integrin-mediated signaling pathway [GO:0007229] integrin complex [GO:0008305] AGASLWSGLR 0.97906 194.64 12.1357 11.0676 10.3171 10.8595 10.5334 11.8565 10.4666 10.9434 11.7402 12.5164 10.5973 5.09081 12.7462 12.6491 10.7527 13.4164 11.289 9.21718 11.275 10.7888 11.7756 7.00394 10.6641 9.79159 9.72055 8.24441 9.9491 10.2664 11.6017 9.60774 16.81 10.8699 6.62417 11.1959 11.5158 11.086 10.8616 9.3656 11.3344 10.1303 13.9123 11.0169 8.51262 13.2134 10.8082 15.5011 9.89145 15.3994 10.1611 10.6853 10.8895 8.81625 10.4393 10.5094 14.941 9.63354 10.3392 14.3266 8.28794 8.23237 4.85808 6.4129 12.9094 A0A0B8RSR1 A0A0B8RSR1_PIG Interleukin-1 receptor-associated kinase-like 2 IRAK2 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310]; signal transduction [GO:0007165] ATP binding [GO:0005524]; protein kinase activity [GO:0004672] DLLLNEIPSSTVSLCSR 0.95973 161.37 0 5.59747 0 9.333 0 11.1606 7.35738 0 10.5125 8.81474 8.06679 3.9331 10.5644 8.50898 10.4816 10.7136 0 7.78784 10.4021 0 10.4485 11.0501 11.155 11.6493 0 7.59432 10.9915 5.09651 0 9.30351 6.46285 9.01181 8.35262 6.37624 9.28353 0 6.68047 5.44956 0 0 7.97212 0 4.82706 8.47273 9.44708 5.86945 11.8604 0 9.98897 8.79484 6.30593 0 0 0 0 9.49281 0 0 0 6.05834 2.99682 0 8.78732 A0A0B8RSR5 A0A0B8RSR5_PIG "Interleukin enhancer binding factor 3, 90kDa" ILF3 Sus scrofa domesticus (domestic pig) defense response to virus [GO:0051607] cytoplasm [GO:0005737]; nucleus [GO:0005634] DNA binding [GO:0003677]; double-stranded RNA binding [GO:0003725] AEPPQAMNALMR 0.94444 239.73 12.5615 13.5741 13.284 13.7488 7.34908 10.3518 12.4653 13.583 13.6233 7.29398 13.7829 7.57274 11.085 13.8996 13.8894 14.9139 4.34021 5.79317 12.7796 10.4795 12.2304 12.7537 6.16497 12.9052 10.8689 7.02824 12.3341 12.8022 11.0299 12.6027 13.8005 13.831 10.6439 12.2024 12.7799 11.6569 10.0246 6.97418 10.5913 12.5765 12.503 11.8607 6.84122 11.2837 11.2873 11.3689 0 10.518 11.0056 7.4402 5.36503 10.4639 13.1677 11.2586 11.1005 11.0898 11.1273 11.1895 11.5493 12.9096 10.9943 10.9088 10.9438 A0A0B8RSR7 A0A0B8RSR7_PIG "Interleukin 10 receptor, alpha" IL10RA Sus scrofa domesticus (domestic pig) membrane [GO:0016020] AASANGLEEESSSTDGLGPK 0.96021 97.694 8.90014 9.309 0 11.0142 7.71727 9.82367 0 9.61574 0 7.66768 9.007 8.4947 0 8.90872 8.71552 0 10.5577 0 11.7803 5.91951 10.1445 0 8.66196 11.3698 0 7.99746 5.84604 9.38465 4.23304 0 8.71562 7.64378 7.7703 8.35187 7.58646 4.615 6.50603 0 6.20676 10.1909 6.80516 6.54802 0 0 0 4.86943 0 5.62565 0 6.32438 0 9.19913 0 0 0 0 0 8.32557 0 0 6.27702 0 0 A0A0B8RSR9 A0A0B8RSR9_PIG Interferon induced transmembrane protein 3 IFITM3 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] DRKMVGDIIGAQSYASTAK 0.99346 9.0608 0 0 0 0 0 0 0 0 9.27228 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 9.05325 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.9154 0 0 0 0 0 0 0 A0A0B8RSS2 A0A0B8RSS2_PIG Heat shock transcription factor 2 HSF2 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565] DGPVEFQHPYFK 0.98173 186.48 8.95204 8.62746 9.56653 10.9819 6.62555 6.67821 10.4034 17.0023 9.69171 13.0048 9.94933 8.40186 9.41787 9.67492 17.0707 8.64061 4.69371 7.40531 14.9206 8.05859 8.19441 0 9.70872 7.89245 0 8.95091 7.45014 6.55405 0 8.86845 10.9873 9.94879 12.2942 6.64414 0 12.4588 0 7.85985 0 11.6221 8.03881 0 4.73655 8.14323 9.29255 0 4.87012 0 6.45432 0 7.61537 7.24498 7.36955 5.70764 6.21447 0 8.09577 0 8.32576 0 0 0 6.18945 A0A0B8RSS6 A0A0B8RSS6_PIG Homeodomain interacting protein kinase 3 HIPK3 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; DNA binding [GO:0003677]; protein kinase activity [GO:0004672] AYECFQHR 1.2367 323.31 10.2181 11.4285 10.5876 11.4565 8.22183 12.2299 12.0369 10.8219 9.38042 5.45108 9.25967 10.4143 12.2243 10.2861 11.7119 11.6558 9.4574 11.5706 10.5752 10.9491 10.1329 11.8198 10.9127 12.815 10.7899 7.78077 11.1736 10.5449 11.2559 10.1802 9.58935 10.8315 10.5392 10.7784 9.93842 11.5636 10.1407 10.9336 10.474 8.77821 11.7728 10.4793 8.88292 9.37463 9.28265 9.84464 10.0933 8.93009 8.57535 10.7208 9.63836 9.153 9.74019 11.3686 8.5435 11.0739 11.3219 9.27729 9.82206 7.88166 9.17225 7.75409 9.30704 A0A0B8RST0 A0A0B8RST0_PIG Hemochromatosis HFE Sus scrofa domesticus (domestic pig) iron ion transport [GO:0006826] plasma membrane [GO:0005886] AASGDYVLAECE 0.9635 119.29 11.4906 11.3193 13.832 12.3594 12.753 11.5718 13.704 13.913 11.8076 13.682 13.6309 13.4906 13.9272 11.8886 14.0566 11.972 13.782 11.7606 13.9753 11.7272 7.66406 9.2669 12.0387 11.9235 14.0686 11.705 11.9306 13.6636 11.3728 11.5989 11.8098 13.8899 13.6801 8.06862 13.3898 11.5004 11.9965 12.042 12.2042 12.8984 11.1877 11.0177 9.64825 12.0108 10.494 11.7548 11.539 8.30888 11.7689 11.8411 13.633 12.8088 12.7459 10.9281 12.9219 11.3462 11.209 10.7456 10.1888 10.6875 8.72615 5.50561 11.7052 A0A0B8RSU5 A0A0B8RSU5_PIG Hepatoma-derived growth factor HDGF Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] ADAAEGDGDK 0.97638 178.82 11.2106 10.6948 10.8683 12.0781 11.3564 9.14055 11.6661 10.5356 13.1379 9.90537 11.4396 10.7787 10.9515 10.6883 11.3269 10.7038 10.472 9.18401 10.648 10.8118 10.4483 10.1163 11.1215 10.9764 10.9007 12.1856 7.15482 11.4993 10.7405 11.1546 12.2959 12.4581 11.8767 11.3728 11.8184 10.9602 11.193 9.84007 11.773 10.5194 11.1158 11.4048 10.8108 10.9906 11.1184 10.7458 10.542 11.1582 10.0256 10.7772 10.5816 10.7345 10.3774 10.6473 10.2343 10.0291 9.94246 9.1719 9.70091 9.04636 9.03092 9.56953 9.4884 A0A0B8RSV0 A0A0B8RSV0_PIG Proheparin-binding EGF-like growth factor HBEGF Sus scrofa domesticus (domestic pig) membrane [GO:0016020] growth factor activity [GO:0008083] APSCICHPGYHGER 0.97069 86.763 10.5911 10.8412 10.8783 11.6484 11.6879 11.8187 12.124 11.0183 12.0737 11.1968 11.2951 12.0142 12.5628 11.7636 12.6589 11.3453 11.7993 9.86545 11.6049 10.6847 9.25486 10.1971 12.0009 12.1882 10.9162 11.6448 11.0056 8.11187 8.13602 10.1403 11.1364 10.1834 9.92874 0 7.27919 9.71656 10.2091 8.96967 8.60196 10.5114 9.68073 9.805 9.83249 8.43442 9.25689 10.4704 10.3243 9.51033 10.0211 10.876 10.7907 10.1088 9.67352 9.4516 9.62209 9.53508 9.42105 9.2636 8.95175 8.63702 7.51893 9.17537 7.75629 A0A0B8RSV3 A0A0B8RSV3_PIG General transcription factor 3C polypeptide 1 GTF3C1 Sus scrofa domesticus (domestic pig) transcription initiation at RNA polymerase III promoter [GO:0006384] nucleus [GO:0005634]; transcription factor TFIIIC complex [GO:0000127] DNA binding [GO:0003677] AAGKWDRPDNFSFK 1.2308 323.31 12.0587 13.5358 13.3725 13.3644 14.1361 13.3699 12.8794 12.4884 14.5928 11.9439 14.1583 13.6992 13.5365 15.6825 14.8984 14.6175 11.7258 13.0453 12.3023 13.0582 12.8911 14.6362 14.1753 12.8808 11.2727 10.3386 13.7587 11.9233 11.7426 11.3652 12.2574 12.9116 12.9885 12.1269 11.831 11.1928 11.5287 13.156 11.5817 12.7963 10.9422 11.0566 12.0514 12.6773 11.6975 11.5462 11.1995 12.0996 13.738 11.9987 14.0423 12.741 11.7792 12.8062 10.9487 11.958 11.7105 12.0544 12.1531 12.0411 11.1204 10.527 10.8867 A0A0B8RSV6 A0A0B8RSV6_PIG G protein pathway suppressor 1 GPS1 Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737]; nucleus [GO:0005634] AEALKMALSFVQR 0.93235 227.22 12.5698 12.5047 12.248 10.3745 11.4815 11.5548 11.5344 12.3591 11.3157 11.4229 11.129 10.4956 8.95417 12.3358 12.0758 12.1749 11.5878 12.1892 11.3031 11.2948 11.1478 11.2658 9.34203 11.0879 9.65075 9.66375 0 10.1357 4.96818 13.867 6.39965 0 10.4634 11.8702 10.6066 0 0 10.2401 11.3983 10.7903 10.4337 9.87497 0 6.52809 11.5368 0 10.5445 10.3194 11.6398 11.5919 11.2309 9.68605 10.6738 11.2765 11.8088 11.8088 11.7637 12.4805 12.3536 12.0557 12.6608 12.5805 12.2958 A0A0B8RSV8 A0A0B8RSV8_PIG GC-rich promoter binding protein 1-like 1 GPBP1L1 Sus scrofa domesticus (domestic pig) DNA-templated transcription [GO:0006351]; positive regulation of DNA-templated transcription [GO:0045893] nucleus [GO:0005634] DNA binding [GO:0003677]; RNA binding [GO:0003723] AELEDSDTETSSSETSDDDAWK 0.95149 206.33 9.5769 11.9192 9.44907 11.2256 10.4382 11.1232 9.58269 11.3834 9.94178 11.4773 11.8658 9.60535 11.2848 12.4983 10.1173 13.9008 8.54005 11.1752 12.7684 10.5875 8.01998 9.45487 10.3872 7.99605 6.82477 12.8547 8.85284 6.75101 11.239 5.97198 7.79837 10.1215 9.5112 7.07991 6.69822 11.4288 6.65076 10.6509 10.8786 8.01881 11.5808 11.5851 0 3.94963 10.9905 6.61156 10.4398 7.51025 7.91862 10.568 9.69756 9.77949 6.86938 11.9399 7.58338 0 6.62727 8.6546 7.4208 0 0 0 9.58785 A0A0B8RSW0 A0A0B8RSW0_PIG N-acetylglucosamine-6-sulfatase (EC 3.1.6.14) (Glucosamine-6-sulfatase) GNS Sus scrofa domesticus (domestic pig) glycosaminoglycan metabolic process [GO:0030203] lysosome [GO:0005764] metal ion binding [GO:0046872]; N-acetylglucosamine-6-sulfatase activity [GO:0008449] FDPRLMFSNHGTVR 0.95369 152.23 10.0673 11.627 11.6149 11.5297 14.2698 13.8838 13.9697 13.9859 14.3569 13.1829 13.0768 13.0835 14.0069 14.2627 14.1816 13.632 13.6214 13.7618 11.6389 13.0694 11.871 6.14916 11.0219 14.134 12.0934 11.2896 11.3528 9.39023 11.2659 9.86273 11.3254 12.8719 5.87036 10.091 7.34598 8.80858 12.1585 11.0237 10.5711 9.79085 10.2369 9.44956 11.5776 11.4756 11.8903 11.971 11.2112 11.5238 11.9223 12.2741 12.6538 9.94889 11.3718 10.3349 10.7348 8.05268 4.2966 10.0268 10.1591 9.99464 10.7181 9.02198 10.6216 A0A0B8RSW3 A0A0B8RSW3_PIG Cytokine-like nuclear factor N-PAC (Glyoxylate reductase 1 homolog) (Nuclear protein NP60) (Putative oxidoreductase GLYR1) GLYR1 Sus scrofa domesticus (domestic pig) chromosome [GO:0005694] NAD binding [GO:0051287]; NADP binding [GO:0050661]; oxidoreductase activity [GO:0016491] AKALDQSDNDMSAVYR 0.97207 265.95 9.28563 9.14407 10.8543 11.6827 11.4078 9.33208 10.9717 11.4077 12.2345 11.5413 9.93114 10.5511 10.9825 11.0839 12.5359 11.0349 10.607 0 10.7433 11.5975 10.8938 10.2404 7.67306 10.8011 9.64301 9.39725 5.19562 10.4703 9.78224 10.4235 8.60466 10.3921 12.0981 10.3652 8.18016 11.0477 10.387 8.4385 9.302 9.80379 10.7023 10.1576 7.17772 9.31175 10.5787 9.61346 9.77619 9.48051 8.74628 9.88813 6.7185 8.90713 0 9.52517 5.83862 9.02954 8.94656 5.69474 0 0 10.2467 7.63764 7.97189 A0A0B8RSW6 A0A0B8RSW6_PIG Putative glycerol kinase 5 (EC 2.7.1.30) (ATP:glycerol 3-phosphotransferase 5) GK5 Sus scrofa domesticus (domestic pig) glycerol catabolic process [GO:0019563]; phosphorylation [GO:0016310] glycerol kinase activity [GO:0004370] AAGIEMNQIVGLGISTQR 0.95046 204.38 9.18698 10.1008 8.76025 7.46009 8.4475 0 10.5511 8.60537 0 10.4273 8.88203 10.7498 11.4287 9.55121 10.4907 8.69943 8.17058 10.6069 0 9.32348 9.73276 8.67218 10.5234 10.1844 9.2182 8.364 5.06039 9.47703 8.15927 9.63505 10.2188 0 0 0 7.78392 0 9.21733 8.84709 8.73342 7.36737 0 7.66484 9.26376 0 3.32783 7.42425 9.25141 0 7.42072 7.47946 8.00675 0 8.44394 9.3105 6.34295 6.75128 6.7736 8.54234 6.73877 5.83988 8.12179 5.63334 0 A0A0B8RSW9 A0A0B8RSW9_PIG "Guanylate binding protein family, member 6" GBP6 Sus scrofa domesticus (domestic pig) GTP binding [GO:0005525]; GTPase activity [GO:0003924] AADLYSEQMAQR 0.94824 205.42 10.2764 9.28422 8.81484 8.13858 11.6896 10.9046 12.5567 10.4988 10.7964 10.84 10.9691 11.4015 11.2693 11.6164 10.7219 8.96049 9.28154 9.0502 9.60294 10.8066 8.76404 8.2384 0 12.184 10.4209 0 11.7121 10.1449 9.82923 10.9471 12.0879 10.8645 10.8859 8.21936 11.2449 10.9142 11.9761 8.18997 11.1115 11.2973 9.0894 10.3557 11.3688 11.0906 10.9075 6.97108 11.972 12.2929 0 12.5704 8.90286 11.0402 10.521 4.9674 5.51156 9.9446 6.54478 9.0204 10.5491 0 10.058 10.5542 10.0293 A0A0B8RSX3 A0A0B8RSX3_PIG furin (EC 3.4.21.75) (Dibasic-processing enzyme) (Paired basic amino acid residue-cleaving enzyme) FURIN Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] endosome membrane [GO:0010008]; Golgi apparatus [GO:0005794]; plasma membrane [GO:0005886] serine-type endopeptidase activity [GO:0004252] ASVCVPCHASCATCQGPAPTDCLTCPSHASLDPVEQTCSR 0.96794 176.34 10.776 10.0254 9.69305 12.306 11.4804 11.5812 11.1597 11.9037 10.4237 8.28536 7.70936 10.016 11.3251 11.1701 8.80838 10.1334 9.97212 11.6 9.61901 11.7455 7.41878 8.06813 10.4409 10.7859 6.79662 6.52932 6.79455 9.83756 0 7.76308 9.55344 10.5957 9.94675 10.3348 9.94357 8.66455 7.51767 10.9006 10.4652 10.4727 9.46962 9.81105 0 4.60164 9.15327 9.47675 0 7.13965 9.00739 10.8897 9.74848 10.2696 7.24745 9.73684 5.88426 9.72412 8.02774 10.0631 6.78097 8.9567 5.31237 9.42746 8.95815 A0A0B8RSX6 A0A0B8RSX6_PIG "Filamin A, alpha" FLNA Sus scrofa domesticus (domestic pig) actin cytoskeleton organization [GO:0030036] intracellular non-membrane-bounded organelle [GO:0043232] actin filament binding [GO:0051015] AEAGVPAEFSIWTR 1.1852 323.31 12.9362 13.0021 12.478 11.7726 12.8258 12.4751 11.6385 12.9376 13.5223 11.1097 12.2261 12.595 13.0609 15.8292 12.0819 16.1365 11.5458 10.9424 12.6982 11.9893 12.4251 12.9978 12.8993 12.6743 12.8999 11.4985 12.0295 11.7699 12.1557 13.6258 14.7439 13.9075 13.2258 12.376 12.7536 12.6566 10.584 11.7642 11.1947 10.4462 11.4016 11.321 12.7628 11.9596 11.7652 11.6857 10.92 12.0643 12.4409 12.1965 12.4955 12.112 12.4551 10.9447 10.5785 10.0591 10.9425 12.0076 10.0518 13.051 9.90085 10.468 9.84046 A0A0B8RSX9 A0A0B8RSX9_PIG F-box protein 42 FBXO42 Sus scrofa domesticus (domestic pig) AGATLVVYK 0.96822 138.6 9.8212 9.08558 0 9.00526 9.78625 0 9.06969 0 11.8701 9.37326 0 10.5602 12.5348 12.0111 0 9.10308 0 9.07567 8.66789 8.91325 9.66564 10.2095 9.788 8.39797 6.91719 8.29866 0 5.8284 8.68092 8.83124 9.73662 12.0974 12.3051 0 9.15856 8.48647 0 0 7.24688 9.43235 3.70554 8.37165 9.04505 9.3222 7.66342 0 10.4916 7.43646 9.5508 11.0745 10.9169 10.7755 10.5286 9.7703 6.9743 6.61105 6.71918 7.31424 0 0 0 5.75521 5.32477 A0A0B8RSY3 A0A0B8RSY3_PIG "Fanconi anemia, complementation group B" FANCB Sus scrofa domesticus (domestic pig) interstrand cross-link repair [GO:0036297] Fanconi anaemia nuclear complex [GO:0043240] ACNSSFPGIKCQNR 1.1378 323.31 14.4154 11.8053 10.7932 11.317 14.8856 11.5286 10.3168 10.3806 12.1743 10.8234 10.3301 10.2031 12.435 13.2233 11.5328 14.4306 11.6964 10.4644 12.0822 11.6207 9.74228 12.1487 11.7063 10.7818 8.12231 7.67709 6.20451 11.3259 8.04139 15.2314 11.4963 10.289 13.6607 9.78115 9.23204 10.5281 12.3257 10.621 8.84919 11.2328 10.6837 8.67338 8.70798 10.5737 8.94421 10.7113 10.9994 11.0097 11.1626 10.8636 12.9876 10.4375 10.0247 10.7316 9.47934 9.82915 11.6996 9.92404 8.59999 9.78779 5.9656 7.48293 7.79474 A0A0B8RSY4 A0A0B8RSY4_PIG Niban-like protein 1 FAM129B Sus scrofa domesticus (domestic pig) AELAPRLK 0.94479 284.56 7.84021 9.37617 5.00126 7.4042 10.3826 11.8467 6.21519 11.3347 9.52107 6.46594 9.3338 9.48824 11.2701 9.7401 11.7675 10.0274 9.56243 8.46262 11.3826 8.91465 10.1178 9.65152 9.87776 10.9516 9.95861 10.4376 7.53784 9.09916 6.95652 10.3219 9.72977 7.29646 6.10423 6.89324 9.2432 9.19483 10.9355 0 7.72567 10.5429 8.55942 9.78807 0 9.3006 9.33706 5.81129 7.13484 9.58945 9.86589 8.17906 8.6702 9.14886 6.904 8.71211 5.36419 9.17075 9.86936 8.81215 8.29462 4.84594 10.3184 9.7599 8.56807 A0A0B8RSY5 A0A0B8RSY5_PIG Protein C-ets-2 ETS2 Sus scrofa domesticus (domestic pig) regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565] ATFSGFK 0.96082 112.42 0 10.8257 0 0 9.74049 10.3812 0 10.7824 0 9.23499 7.59141 7.52403 8.56643 10.6181 9.98142 10.1468 10.1848 8.47934 0 10.1217 10.8146 7.96503 10.2819 9.14366 8.9847 0 10.2546 0 0 9.13389 10.6346 4.51866 0 0 8.37751 0 11.1288 7.5716 9.86126 0 10.8788 9.92979 9.82663 10.5867 8.85125 6.2194 10.6891 0 7.13432 9.97456 10.2095 9.25998 6.66463 9.38806 2.80118 0 0 6.80323 10.7899 6.69808 0 0 0 A0A0B8RSY9 A0A0B8RSY9_PIG phosphopyruvate hydratase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) ENO1 Sus scrofa domesticus (domestic pig) glycolytic process [GO:0006096] phosphopyruvate hydratase complex [GO:0000015] magnesium ion binding [GO:0000287]; phosphopyruvate hydratase activity [GO:0004634] AAVPSGASTGIYEALELR 1.1636 323.31 7.56773 10.2944 8.73647 14.177 15.2433 15.144 8.83077 8.97418 12.8648 9.26264 11.2761 11.3861 10.7118 10.2649 10.1823 15.2859 14.6755 15.2499 10.2431 10.5297 10.1477 11.523 10.233 11.9557 14.6917 14.6411 15.0063 10.5614 10.1399 11.757 13.3942 13.9617 12.9166 7.87104 5.84654 10.1101 16.6881 16.6015 16.5582 9.8398 9.99449 8.33257 14.4023 14.3833 14.5009 8.64003 10.3259 8.60837 15.6787 15.7437 15.124 8.7415 8.68961 0 13.4717 13.4184 13.5366 12.2091 11.9994 11.5091 11.9727 12.2566 11.9146 A0A0B8RSZ4 A0A0B8RSZ4_PIG Zinc finger protein 592 ZNF592 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] metal ion binding [GO:0046872] CAFCPMAFK 1.148 323.31 9.60968 11.1064 10.7026 12.1122 11.2982 11.3615 11.97 12.5111 12.475 10.7841 11.4874 11.642 12.148 12.6735 12.5397 12.0036 11.7228 12.2452 11.5353 11.3671 11.7883 13.1226 12.5605 11.8732 11.4919 12.0201 10.3576 11.5238 10.259 11.648 11.9321 11.3745 11.1365 6.96209 11.3473 10.9685 13.0501 9.30761 12.0752 10.3967 6.17578 6.47789 12.7737 12.4801 10.4836 11.9274 10.4635 8.41608 11.3362 11.5281 9.17837 10.5205 9.90103 8.78077 10.1977 9.39056 12.4602 9.59124 9.4851 6.99447 5.99634 6.60746 9.2347 A0A0B8RSZ5 A0A0B8RSZ5_PIG non-specific serine/threonine protein kinase (EC 2.7.11.1) EIF2AK4 Sus scrofa domesticus (domestic pig) DNA damage checkpoint signaling [GO:0000077] ATP binding [GO:0005524]; eukaryotic translation initiation factor 2alpha kinase activity [GO:0004694]; translation initiation factor activity [GO:0003743] AILLHCGIPEDK 1.1429 323.31 11.9293 11.8069 12.1544 13.0692 14.2647 13.1353 13.1529 13.3548 13.6637 13.2581 12.3882 11.2105 13.8616 13.2226 12.7013 13.44 12.2307 13.2791 13.2942 14.4459 13.4409 13.4743 14.9574 14.0549 13.3306 12.7051 13.2874 12.2379 11.5138 9.15803 11.7445 12.8897 12.5491 12.1275 8.96659 9.6702 12.4571 12.0083 11.9568 11.0133 10.6773 10.6624 10.3058 11.2678 10.2226 12.3049 12.0971 11.6814 12.4412 11.4905 9.11655 13.477 9.56222 12.0843 10.4445 12.932 11.3692 10.6274 9.87712 11.3934 7.6074 7.93711 9.80253 A0A0B8RSZ6 A0A0B8RSZ6_PIG "Zinc finger, MIZ-type containing 2" ZMIZ2 Sus scrofa domesticus (domestic pig) regulation of macromolecule metabolic process [GO:0060255] zinc ion binding [GO:0008270] AAGMAPLYAGQR 0.95918 105.18 0 9.52892 0 14.5932 10.3247 8.79585 0 0 0 9.62277 0 0 7.39137 10.856 0 9.91792 0 0 0 3.94935 8.63441 0 0 0 0 8.6512 9.78668 0 8.43392 8.59846 10.4829 10.6334 10.1568 9.55697 0 0 10.1511 0 9.47543 9.11267 0 9.89297 9.10816 9.70447 8.01067 9.54574 0 6.40827 7.77472 0 0 0 0 0 9.65976 0 5.94682 8.15254 0 8.89409 0 0 0 A0A0B8RSZ7 A0A0B8RSZ7_PIG "Zinc finger, C4H2 domain containing" ZC4H2 Sus scrofa domesticus (domestic pig) ACLSCHQQIHR 0.95493 166.63 8.07489 8.79054 9.09395 12.7173 12.1089 12.3464 11.4809 9.62702 10.0486 10.0254 11.1228 8.66527 12.9053 10.2248 11.2085 8.84787 11.2555 7.73003 8.05284 10.6319 9.09265 11.0984 11.0594 13.1323 0 6.09656 4.79202 0 10.5975 0 9.00703 10.6702 8.06259 8.1205 10.3505 9.31154 7.65306 0 8.08741 5.90386 9.12301 8.56392 8.27947 5.86777 6.55968 0 8.24911 7.38776 9.6544 9.72761 10.3582 6.50707 9.65091 8.75395 7.62571 7.14313 8.1822 0 0 4.92932 6.32769 8.96498 0 A0A0B8RSZ8 A0A0B8RSZ8_PIG Extracellular matrix protein 1 ECM1 Sus scrofa domesticus (domestic pig) signal transduction [GO:0007165] extracellular region [GO:0005576] AAFIDNLCGPR 0.99627 4.9343 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5.93626 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6.71576 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A0B8RSZ9 A0A0B8RSZ9_PIG "Zinc finger, BED-type containing 6" ZBED6 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] DNA binding [GO:0003677]; metal ion binding [GO:0046872]; protein dimerization activity [GO:0046983] AERGRFLIK 0.92325 232.7 0 0 6.97854 10.8422 8.66267 8.08879 10.0183 7.95565 8.10198 12.0072 9.42859 9.35643 9.62806 9.7709 11.2974 7.37912 10.6451 7.84423 9.74816 11.9535 6.69446 11.0812 10.6054 9.83148 10.069 4.47385 10.2115 8.82101 9.82948 9.73127 7.81263 9.2328 0 8.34136 8.2426 0 8.59608 9.27263 10.2743 7.00405 8.40654 8.82429 10.9252 8.04111 0 7.79675 7.38457 6.87258 7.85312 8.34904 0 0 11.9006 5.854 2.68702 0 7.28827 6.16235 0 0 13.3811 13.2011 0 A0A0B8RT00 A0A0B8RT00_PIG Wntless Wnt ligand secretion mediator WLS Sus scrofa domesticus (domestic pig) Wnt signaling pathway [GO:0016055] cytoplasmic vesicle membrane [GO:0030659]; Golgi membrane [GO:0000139] Wnt-protein binding [GO:0017147] AGAIIENMSTK 0.96689 139.53 0 10.9072 0 6.11437 10.9137 10.8053 9.06523 10.9949 10.6613 10.5323 9.7733 4.73769 10.5294 9.56007 14.1487 0 10.3607 0 0 11.2709 10.1893 11.3438 0 10.233 0 0 9.87003 10.4669 0 9.6801 11.3384 0 8.7488 0 11.1087 0 10.7153 7.07596 9.44712 10.557 9.81626 5.88514 5.13122 9.76172 9.69679 0 9.53029 8.42559 0 7.31388 0 9.19955 0 6.17271 8.68857 9.56898 0 8.43642 0 5.21525 2.85913 0 0 A0A0B8RT01 A0A0B8RT01_PIG E3 ubiquitin-protein ligase (EC 2.3.2.27) DTX3 Sus scrofa domesticus (domestic pig) Notch signaling pathway [GO:0007219]; protein ubiquitination [GO:0016567] cytoplasm [GO:0005737] ligase activity [GO:0016874]; metal ion binding [GO:0046872]; ubiquitin protein ligase activity [GO:0061630] AAPLLPPGARGLPPPPPPLPPPLPPR 0.95238 131.24 0 5.52816 11.3274 5.28433 0 10.2054 12.8766 12.0043 12.5545 7.39652 9.66238 0 10.4171 0 11.206 8.77238 11.136 10.36 0 0 9.52988 11.4471 11.844 11.1229 10.6055 11.107 7.35279 8.55677 10.5015 7.39575 10.3619 0 0 8.06323 0 0 9.31809 6.74308 8.54859 0 0 6.61362 9.89163 10.295 5.74615 8.02658 6.86962 0 9.02838 10.2824 8.32966 7.98931 10.0638 0 7.58368 4.15599 7.83599 0 6.17674 9.33965 0 7.26388 0 A0A0B8RT02 A0A0B8RT02_PIG Wiskott-Aldrich syndrome WAS Sus scrofa domesticus (domestic pig) actin filament organization [GO:0007015] cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; nucleus [GO:0005634] actin binding [GO:0003779] ADIGAPSGFK 0.95167 151.19 10.4634 10.9267 9.03587 9.43698 10.0408 11.3351 11.9888 11.1403 9.64357 11.1422 9.15097 11.1323 13.0521 8.69857 10.2124 11.1821 11.3376 11.6591 10.1026 10.8032 11.583 11.9691 11.3772 12.0045 11.5867 9.34964 10.54 0 10.9526 7.72281 11.1848 10.2569 10.953 9.60027 10.5423 8.43975 9.94018 0 10.3585 7.6744 7.56552 0 0 0 0 9.01692 9.07195 7.99718 8.53349 0 0 9.91983 10.9669 4.82482 9.12616 9.03675 10.7849 8.49414 0 9.91064 8.23539 8.44468 6.59367 A0A0B8RT03 A0A0B8RT03_PIG Disks large homolog 1 DLG1 Sus scrofa domesticus (domestic pig) chemical synaptic transmission [GO:0007268] bicellular tight junction [GO:0005923]; neuromuscular junction [GO:0031594]; neuron projection [GO:0043005]; plasma membrane [GO:0005886] kinase binding [GO:0019900] ALFDYDK 0.95578 305.44 7.85854 10.6438 10.348 12.2955 12.2007 10.5044 10.5541 13.3829 8.04368 11.6299 10.5187 9.73142 10.7828 10.5508 10.7746 10.0564 10.7898 8.41189 11.064 11.2113 12.1807 10.5358 9.69556 14.3028 10.6685 10.0377 10.6831 12.0908 9.81023 10.6796 10.0217 11.4546 10.4222 10.7742 5.69975 0 9.14639 10.3658 9.83021 7.86802 9.13871 9.90165 12.4237 12.3973 10.0341 11.0664 10.2607 10.9731 12.782 9.14213 6.29824 10.9422 6.79168 10.8439 8.65914 9.4019 6.91612 8.36698 8.6196 0 6.47941 9.06167 7.58444 A0A0B8RT04 A0A0B8RT04_PIG Dehydrogenase/reductase (SDR family) member 9 DHRS9 Sus scrofa domesticus (domestic pig) ARGRVINVSSIGGR 0.95683 111.61 0 5.43523 9.48774 12.5409 12.2173 11.3071 0 6.75849 13.1874 4.10333 0 8.09397 15.5429 0 12.3067 0 12.1055 11.5452 7.78699 11.0757 7.68832 10.049 12.891 11.2078 0 8.49374 8.69582 11.0517 10.9281 9.83494 11.8809 9.5963 12.253 10.1062 8.99483 9.68498 0 0 0 8.53325 10.264 8.74829 0 0 0 10.6844 0 10.734 9.47476 11.4919 10.5266 8.49825 9.0384 0 0 0 9.82244 9.20279 0 7.54535 8.0133 0 0 A0A0B8RT06 A0A0B8RT06_PIG Spermatogenesis-defective protein 39 homolog (VPS33B-interacting protein in apical-basolateral polarity regulator) (VPS33B-interacting protein in polarity and apical restriction) VIPAS39 Sus scrofa domesticus (domestic pig) intracellular protein transport [GO:0006886] early endosome [GO:0005769]; protein-containing complex [GO:0032991] AFTFDDEDDELSQLKESK 0.96359 268.67 4.95243 9.94124 8.04286 10.4015 9.56451 11.2244 10.2957 7.50144 11.0971 10.4599 3.66221 10.5625 11.2572 6.00977 9.9514 9.18661 4.7094 9.50404 0 6.92005 6.11433 10.5604 9.20249 8.90427 10.0221 10.3625 0 8.58583 9.57586 12.4372 11.9456 7.6409 7.36098 12.3543 9.66509 4.89855 13.0162 7.23237 9.10213 8.83703 9.56957 4.88938 9.29744 11.4825 7.57766 8.14507 7.21121 9.30387 9.46767 10.9701 6.44064 3.37587 4.88767 4.75125 8.83181 0 8.30979 9.97799 8.84147 9.33269 9.18609 7.74692 8.39938 A0A0B8RT07 A0A0B8RT07_PIG DEK proto-oncogene DEK Sus scrofa domesticus (domestic pig) chromatin organization [GO:0006325] nucleus [GO:0005634] DNA binding [GO:0003677] ADSSTTK 0.95911 321.98 12.4527 12.0972 11.5099 12.0246 11.7621 10.9214 14.9069 8.86174 11.7102 10.9894 11.607 11.9147 13.7678 14.0523 13.6763 11.2298 11.8628 12.6823 12.1363 6.66945 12.2415 13.133 12.282 11.523 13.3978 13.0164 12.7455 12.5183 11.262 11.0096 11.1802 11.4032 6.0023 13.7868 13.3604 12.6297 11.9358 11.0276 11.4834 12.063 10.5928 12.4086 10.9267 14.3026 14.3817 11.3738 6.65306 11.3682 11.5841 12.1458 11.4378 11.288 10.4009 11.5031 11.9275 12.2076 11.9426 11.2976 12.1144 11.3647 10.9919 6.68692 11.0902 A0A0B8RT08 A0A0B8RT08_PIG Ubiquitin carboxyl-terminal hydrolase 16 (EC 3.4.19.12) (Deubiquitinating enzyme 16) (Ubiquitin thioesterase 16) (Ubiquitin-specific-processing protease 16) USP16 Sus scrofa domesticus (domestic pig) cell division [GO:0051301]; chromatin organization [GO:0006325]; histone deubiquitination [GO:0016578]; mitotic nuclear division [GO:0140014]; protein homotetramerization [GO:0051289]; proteolysis [GO:0006508]; regulation of cell cycle [GO:0051726] nucleus [GO:0005634] cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; histone binding [GO:0042393]; transcription coactivator activity [GO:0003713]; ubiquitin binding [GO:0043130]; zinc ion binding [GO:0008270] AEEHQRVSK 1.1584 323.31 11.8019 8.69693 5.53739 10.2586 10.5295 11.4568 10.7019 11.5897 11.057 11.6872 10.7228 9.63201 12.4937 14.9051 11.6788 12.5218 8.31207 8.73718 11.5838 10.152 11.5767 11.7982 10.7388 11.8249 9.83864 11.8279 9.86422 11.9072 11.9164 9.54251 12.4556 10.9572 10.0406 8.76202 8.5635 9.23676 10.9821 7.17543 9.78952 6.19669 10.0418 0 10.0366 11.4222 11.8016 10.2154 12.2087 7.68047 10.9594 11.7275 9.26929 12.1124 9.46934 10.1907 8.73664 0 11.8211 9.03947 9.35072 8.52763 6.73525 10.1049 9.46201 A0A0B8RT09 A0A0B8RT09_PIG DDHD domain containing 2 DDHD2 Sus scrofa domesticus (domestic pig) metal ion binding [GO:0046872] DCNGRVVPTDGGR 0.92629 218.59 11.9324 7.02547 11.4547 10.0871 9.85292 11.3716 10.9202 10.7809 11.0521 11.1198 12.3184 12.9838 12.4232 12.979 11.1606 10.6195 9.4199 8.59857 10.29 10.6963 12.745 11.2092 13.3508 7.99605 8.46928 10.6521 7.59634 9.45096 9.12787 9.98 9.2891 0 7.38033 10.0887 10.1163 7.20584 0 11.7805 5.07168 10.3386 9.93609 10.0108 7.69126 9.41555 11.6713 8.54052 10.0298 0 9.98085 9.55317 9.6844 10.4179 10.9914 10.7339 8.07735 9.48874 6.74039 9.64514 9.29918 9.45012 10.7105 10.611 9.84797 A0A0B8RT10 A0A0B8RT10_PIG E3 ubiquitin-protein ligase (EC 2.3.2.27) UBR3 Sus scrofa domesticus (domestic pig) protein ubiquitination [GO:0016567]; ubiquitin-dependent protein catabolic process via the N-end rule pathway [GO:0071596] ligase activity [GO:0016874]; ubiquitin protein ligase activity [GO:0061630]; zinc ion binding [GO:0008270] AALQSRMNK 1.1689 323.31 11.489 11.4713 12.295 14.8349 14.5119 14.4779 13.5221 14.0608 13.3665 13.1837 14.2648 13.1263 13.4337 13.5916 13.2583 14.0214 14.4444 14.1853 11.8708 11.9084 11.1565 13.9069 12.9351 13.207 12.3555 10.5108 11.2368 10.3264 11.7917 10.1892 13.1912 11.6002 13.1362 11.29 10.2432 9.71884 10.2626 12.313 11.8528 11.6232 10.6426 11.5229 10.6094 12.0805 10.6761 10.7118 9.50176 9.70779 10.4332 12.038 10.9683 11.38 13.0949 11.5073 10.9047 10.2098 10.4883 10.553 9.90832 11.6911 10.2586 9.67115 10.1188 A0A0B8RT12 A0A0B8RT12_PIG Cholesterol 7-alpha-monooxygenase (EC 1.14.14.23) CYP7A1 Sus scrofa domesticus (domestic pig) bile acid biosynthetic process [GO:0006699]; cellular response to glucose stimulus [GO:0071333]; cholesterol catabolic process [GO:0006707]; cholesterol homeostasis [GO:0042632] endoplasmic reticulum membrane [GO:0005789] cholesterol 7-alpha-monooxygenase activity [GO:0008123]; heme binding [GO:0020037]; iron ion binding [GO:0005506] AASEEVNKTLEKAGQK 0.97007 135.46 9.26878 8.76891 8.47849 11.7977 3.32351 7.92778 11.8486 11.513 11.7642 9.30225 9.61086 9.19227 10.7492 6.90917 11.4803 11.8402 10.0983 0 11.0938 8.09117 8.40314 0 10.0868 9.50454 8.15147 9.15393 0 8.53185 9.62289 12.8305 0 9.41526 11.8847 0 0 10.6 0 10.367 9.99053 6.6585 0 9.12275 11.4644 11.4607 11.6598 0 0 8.25583 9.1813 9.43754 4.63657 0 8.54601 11.8002 8.02436 8.29117 0 11.2561 9.43217 11.2546 7.63081 7.10622 0 A0A0B8RT13 A0A0B8RT13_PIG Ubiquitin C UBC Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737]; nucleus [GO:0005634] AKIQDKEGIPPDQQR 1.1797 323.31 15.0022 13.4329 12.9219 15.8094 16.0694 14.4877 15.9383 14.2009 13.9926 14.0008 14.0636 13.5089 16.1363 15.8588 14.1684 16.0825 15.6064 15.4047 13.7776 13.3257 14.254 15.245 15.1955 14.9421 14.0238 12.8939 13.6634 13.891 13.7213 13.8309 14.9895 15.1064 14.2507 12.8993 13.5672 13.1241 14.0295 14.1965 13.0033 13.1927 13.1658 13.0464 12.4109 12.53 12.2457 14.0274 13.3523 13.3455 13.6178 13.6153 13.2922 14.2912 14.2263 14.3241 13.9149 13.1836 13.0385 13.139 12.7366 13.6479 12.1149 13.3562 12.6564 A0A0B8RT14 A0A0B8RT14_PIG C-X-C motif chemokine CXCL3 Sus scrofa domesticus (domestic pig) defense response [GO:0006952]; immune response [GO:0006955] extracellular space [GO:0005615] chemokine activity [GO:0008009] IINKMLNNGRVN 0.96411 46.108 0 0 0 0 4.87642 3.96717 9.92053 7.51712 13.5087 8.79837 0 0 9.50279 0 4.08738 4.68089 0 4.52344 0 0 7.46809 3.62842 13.501 0 0 3.71425 7.53294 9.57048 0 6.09887 0 0 0 0 5.8763 7.66249 0 4.64345 0 0 0 4.478 0 0 0 0 0 0 6.30814 0 6.34712 0 5.37747 5.93664 3.794 0 6.19393 6.24373 0 0 4.73525 0 0 A0A0B8RT16 A0A0B8RT16_PIG Taxilin alpha TXLNA Sus scrofa domesticus (domestic pig) syntaxin binding [GO:0019905] AEGAQAK 1.5901 323.31 18.1916 18.164 18.3602 18.6802 18.4126 18.653 18.7877 18.7463 13.0162 11.8213 18.5429 12.6979 18.8013 18.7146 18.834 18.7434 18.7076 18.548 11.8723 18.518 18.5558 18.7662 18.767 18.8566 18.839 18.6637 18.809 18.5053 18.3644 18.487 18.7966 18.6915 18.4416 18.5628 18.2578 12.3088 18.8996 18.6182 12.5572 12.2685 17.7594 17.7317 17.2564 17.1741 17.21 18.2982 18.4187 11.3904 18.5519 18.5101 18.3811 17.6681 17.6214 17.5845 17.7805 18.0312 17.9103 17.0631 11.4993 17.066 16.4016 16.3178 16.4152 A0A0B8RT17 A0A0B8RT17_PIG CCCTC-binding factor (Zinc finger protein) CTCF Sus scrofa domesticus (domestic pig) CDQCDYACR 1.1963 323.31 12.5967 8.25767 11.0667 5.17548 9.58479 11.8892 11.1596 12.3474 9.88684 10.4717 10.9046 11.5968 11.6584 11.9998 11.4429 11.2447 8.85764 10.3243 11.6123 11.216 11.5943 11.4462 10.9216 10.7702 10.605 10.4451 8.22429 9.79925 9.13835 11.6866 7.60807 9.84439 11.6576 10.5085 9.58035 7.77419 10.1158 12.9036 6.80297 5.57328 0 0 10.7628 10.3599 7.29618 6.08004 9.40737 5.02321 9.11902 10.6046 8.81089 9.90149 7.50772 5.0552 8.73525 8.72642 0 8.81775 6.15638 7.17483 9.6153 3.5846 8.38159 A0A0B8RT18 A0A0B8RT18_PIG Tuberous sclerosis 1 TSC1 Sus scrofa domesticus (domestic pig) AAALEEHNAAMK 1.2075 323.31 11.7093 11.0741 14.4761 16.9229 16.7711 16.6936 16.7607 16.4259 16.4122 11.6673 11.8009 11.1354 15.9073 15.7388 11.8708 12.5134 16.362 16.3636 14.6611 10.9734 10.8961 15.9807 15.7965 15.58 10.548 11.0513 12.007 10.3924 12.8129 9.98214 14.7624 14.4472 11.4121 11.8144 9.96809 9.6312 10.9184 12.3219 11.7143 8.86 9.05379 13.1748 13.2171 13.3355 10.6204 10.22 12.6621 11.7121 10.5573 10.2485 12.9345 11.0518 14.5915 14.7288 13.2327 13.2849 11.5772 13.6905 9.18906 6.52257 13.3018 13.0699 12.9456 A0A0B8RT20 A0A0B8RT20_PIG RING-type E3 ubiquitin transferase (EC 2.3.2.27) TRIM23 Sus scrofa domesticus (domestic pig) GTP binding [GO:0005525]; GTPase activity [GO:0003924]; transferase activity [GO:0016740]; zinc ion binding [GO:0008270] AALVVNRPGAGLDSGRQGSR 0.9801 186.43 8.39716 6.13393 0 11.0078 10.5699 10.3663 0 0 11.5485 9.74393 10.255 9.71649 10.6295 0 9.05001 0 9.95539 10.4174 10.9506 6.07099 10.6746 5.86631 10.6897 9.94171 10.7023 11.472 0 10.749 4.62749 10.5285 12.1816 11.5867 10.1058 9.34983 11.5869 9.20237 9.0676 12.255 9.32204 6.90147 10.9236 0 7.31198 7.88746 8.50819 9.91358 10.6767 7.91731 0 9.35116 0 8.20775 7.74698 8.98482 10.3849 0 10.7266 6.94732 9.81554 0 5.60987 0 0 A0A0B8RT21 A0A0B8RT21_PIG Cytotoxic and regulatory T cell molecule CRTAM Sus scrofa domesticus (domestic pig) membrane [GO:0016020] AHVIWKK 0.9695 182.54 9.09307 8.95405 0 10.3274 9.10079 0 10.8945 9.74153 9.68426 9.81048 9.21415 9.56249 11.7032 10.4541 9.62591 8.14073 11.2846 9.16895 10.7899 10.2142 9.08449 9.45796 10.088 9.69401 8.90782 10.4853 8.00416 8.63768 9.5484 8.76152 10.8282 4.25467 7.89033 8.75285 9.25439 7.26332 8.43521 3.48349 7.59149 6.87848 0 5.73544 9.67119 8.67642 9.33983 8.60151 8.6237 8.33096 9.74995 7.68257 0 10.6571 10.2674 10.1741 9.48176 9.56704 9.58047 9.09392 9.25972 10.4227 8.99893 10.9368 9.13157 A0A0B8RT23 A0A0B8RT23_PIG DNA topoisomerase I (EC 5.6.2.1) (DNA topoisomerase 1) TOP1 Sus scrofa domesticus (domestic pig) DNA topological change [GO:0006265]; rhythmic process [GO:0048511] chromosome [GO:0005694]; nucleus [GO:0005634] "DNA binding [GO:0003677]; DNA topoisomerase type I (single strand cut, ATP-independent) activity [GO:0003917]" AEEVATFFAKMLDHEYTTK 1.2249 323.31 13.379 13.1782 13.7378 9.04311 13.0569 14.7954 13.1146 12.4805 12.4182 10.2849 12.0176 12.9081 13.9894 15.1981 15.3671 12.7476 13.761 11.523 14.7386 11.85 11.1853 15.5434 13.9528 12.2891 13.6349 13.5453 15.3773 10.384 14.5897 13.5146 16.1141 12.5027 15.838 10.419 11.5973 11.481 12.1221 11.7087 12.6578 10.6156 9.96382 11.4305 10.6984 13.0316 15.146 12.0431 10.2879 10.9786 11.5676 14.41 12.673 12.7108 15.305 15.1823 11.4995 11.5486 10.8663 13.3015 10.8329 9.61752 11.228 10.952 11.2435 A0A0B8RT24 A0A0B8RT24_PIG Canopy FGF signaling regulator 4 CNPY4 Sus scrofa domesticus (domestic pig) CEVCKLLSLELQEELSR 0.95639 128.99 8.67666 5.48543 7.37069 9.75315 0 11.7547 0 9.86912 8.73288 8.12516 7.70646 5.42455 9.47895 10.5571 9.62923 8.44303 8.89224 6.99966 9.12311 8.91328 6.92825 0 10.5774 10.3102 6.10794 5.41102 0 8.44997 8.5844 8.30373 8.55455 10.1264 8.41219 6.82744 6.57469 0 9.40393 0 6.64573 8.97174 0 0 0 0 6.70238 5.03162 7.3753 0 6.81801 6.88874 8.88136 6.9751 6.90869 0 6.02547 6.84887 0 0 0 0 5.74238 6.27607 7.06383 A0A0B8RT26 A0A0B8RT26_PIG Transmembrane protein 214 TMEM214 Sus scrofa domesticus (domestic pig) endoplasmic reticulum membrane [GO:0005789] AAGSLELFFDHCLFTMLQELDK 0.96928 176.9 9.68083 1.06095 0 12.5425 11.1043 12.2315 10.4579 9.89291 9.57429 9.55672 11.7106 10.1137 11.1694 10.0841 9.80914 12.1845 8.08688 11.6344 12.4513 11.158 9.77134 0 10.8921 13.9966 12.1407 7.78444 11.9183 8.08119 0 9.66283 10.1407 9.04641 11.2107 9.22229 0 7.79714 9.71865 0 0 8.60248 0 7.29195 12.6743 0 9.59302 3.51538 5.55671 8.15239 10.0668 0 10.3381 0 0 5.76051 9.76143 7.02636 0 6.66931 4.3844 0 0 3.00101 4.43982 A0A0B8RT27 A0A0B8RT27_PIG Toll-like receptor 3 TLR3 Sus scrofa domesticus (domestic pig) inflammatory response [GO:0006954]; innate immune response [GO:0045087]; toll-like receptor signaling pathway [GO:0002224] membrane [GO:0016020] transmembrane signaling receptor activity [GO:0004888] CTVRHEIADCSHLK 0.96021 258.73 7.8198 9.56064 9.27701 11.9462 11.9795 6.49291 7.31179 11.6543 10.5603 11.8462 7.53823 0 9.24374 11.5666 11.4839 10.6098 11.6635 9.85596 9.48615 0 10.7766 10.6188 12.3472 12.5709 10.6073 10.9447 10.6013 10.2739 10.2681 10.5499 10.5732 11.6462 11.3549 9.75892 0 9.15795 11.0848 10.4816 11.0217 5.46405 5.80511 7.47768 11.5355 6.66235 9.34806 9.27729 9.33854 10.0154 9.29329 9.20046 10.2357 7.76779 6.27888 9.96051 10.3883 8.4088 9.82267 8.47598 7.84568 8.20359 0 8.55574 10.0844 A0A0B8RT28 A0A0B8RT28_PIG Circadian locomoter output cycles protein kaput (EC 2.3.1.48) CLOCK Sus scrofa domesticus (domestic pig) circadian regulation of gene expression [GO:0032922]; DNA damage response [GO:0006974] cytosol [GO:0005829]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667] "DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; protein dimerization activity [GO:0046983]" CHEHLMQYGKGK 0.96703 263.08 6.5183 11.364 0 10.0242 14.309 12.1775 14.5169 14.8729 12.8008 11.8709 12.3281 6.50418 11.8353 14.241 12.2683 8.49414 14.3641 9.53019 10.2877 14.5943 14.6397 12.9248 9.33269 13.806 14.0464 8.17896 12.485 6.26394 11.5147 9.54903 12.4703 11.4501 12.7965 11.8348 12.0592 0 10.8883 7.84549 10.4876 10.9371 9.66194 12.2383 9.02998 8.20281 9.1243 10.7302 11.3847 11.3029 7.32571 10.1741 9.29641 9.37504 6.49094 8.63369 8.54462 7.66334 6.17628 7.88716 9.19545 0 7.02115 6.1291 7.54496 A0A0B8RT29 A0A0B8RT29_PIG Tudor domain-containing protein 7 TDRD7 Sus scrofa domesticus (domestic pig) cell differentiation [GO:0030154] cytoplasm [GO:0005737] RNA binding [GO:0003723] ADIPLVVLYDTSGEDDININATCLK 1.1907 323.31 11.4583 9.05791 11.1568 13.5957 11.0922 11.1821 11.4062 13.451 11.5601 12.0486 11.6677 10.1546 11.2462 11.7989 14.2771 13.8629 12.2827 9.29018 10.2501 8.78656 8.89127 12.2352 12.1546 11.412 12.9973 13.1239 12.6907 13.1928 11.9511 11.0726 12.6447 12.4493 11.9427 9.32254 10.2275 10.4142 12.1373 10.5014 10.2244 6.82591 10.7882 9.8352 10.5768 12.8027 12.9093 10.1539 10.2569 7.84109 12.5915 10.6149 12.0289 9.76275 7.47776 9.05088 10.1299 7.43538 11.0109 9.34629 8.67462 9.69575 7.55259 10.1458 7.06803 A0A0B8RT31 A0A0B8RT31_PIG "C-type lectin domain family 12, member B" CLEC12B Sus scrofa domesticus (domestic pig) plasma membrane [GO:0005886] carbohydrate binding [GO:0030246]; signaling receptor regulator activity [GO:0030545] CKPCPKTWHWHR 0.96223 123.08 9.24279 8.3651 0 8.67059 5.48265 10.4863 9.28658 6.31645 11.6958 11.0697 5.95796 0 9.65569 8.74103 10.7529 9.7894 9.70912 9.70606 8.66484 7.26162 8.75352 8.53138 10.392 0 9.76835 7.72656 8.99331 0 9.53642 0 10.4941 9.59725 0 6.33002 9.51716 9.42647 5.6006 9.37088 10.5205 6.22348 10.6751 8.7385 0 8.97401 9.34875 9.2866 4.58946 8.91833 6.22918 8.73829 9.98627 8.51171 7.15168 10.1561 7.55075 5.38671 6.32774 8.57035 0 7.44501 0 7.80832 0 A0A0B8RT32 A0A0B8RT32_PIG ABC-type antigen peptide transporter (EC 7.4.2.14) TAP1 Sus scrofa domesticus (domestic pig) adaptive immune response [GO:0002250]; peptide transport [GO:0015833] membrane [GO:0016020] ABC-type transporter activity [GO:0140359]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; peptide transmembrane transporter activity [GO:1904680] ALIRKPR 0.9525 152.17 10.1343 7.97659 9.4245 10.3497 8.87922 10.3296 10.1509 9.64465 11.8227 5.89995 9.55155 10.3753 12.0046 7.85044 12.6158 0 10.4301 7.4465 9.46608 9.9523 10.8346 10.5514 10.8067 11.4006 9.19057 11.8761 11.1011 11.2348 10.6646 11.1149 0 9.72886 10.0337 8.71311 9.50395 9.04152 6.42321 10.0942 12.0437 0 0 11.2997 11.2398 11.9403 9.57877 9.77175 9.92035 9.40293 11.3475 11.8301 8.11504 9.29914 8.21476 8.77673 9.39913 3.92514 7.64631 9.14603 8.72431 0 4.30108 6.27454 7.81673 A0A0B8RT34 A0A0B8RT34_PIG Choline dehydrogenase (EC 1.1.99.1) CHDH Sus scrofa domesticus (domestic pig) glycine betaine biosynthetic process from choline [GO:0019285] choline dehydrogenase activity [GO:0008812]; flavin adenine dinucleotide binding [GO:0050660] ADSAYHPSCTCK 0.95726 168.19 0 10.0193 0 10.2303 11.6032 0 8.43467 12.3861 8.28448 11.0695 8.69338 10.7335 10.7004 10.2469 11.5136 9.43885 0 11.6335 13.3132 8.7909 11.5994 9.36999 10.2011 9.92584 10.0896 0 5.14274 8.30688 5.32023 0 12.5694 9.66777 9.61839 10.6626 8.86759 4.84112 0 8.25267 0 9.35889 11.0672 8.88615 0 8.80216 9.02738 8.76414 6.95606 8.03881 8.68422 8.91573 9.35306 8.70536 8.94366 7.5982 7.98539 0 6.82043 8.74366 7.55267 8.35913 0 0 6.68622 A0A0B8RT35 A0A0B8RT35_PIG Rho GTPase-activating protein SYDE1 SYDE1 Sus scrofa domesticus (domestic pig) signal transduction [GO:0007165] AAPEGSVISR 0.95065 256.34 11.7286 12.9105 9.95258 9.80307 11.7084 5.65022 11.0775 8.56902 7.2446 13.2899 11.2662 11.0398 11.7886 11.616 14.8372 9.03207 12.9785 10.2392 7.59126 12.0567 12.4202 12.7884 11.9748 11.3243 9.54599 10.7616 8.83036 5.53225 9.45117 9.95694 12.6188 8.88454 11.4451 8.0316 9.48394 9.87957 11.5092 0 11.8131 9.34563 9.90195 10.109 11.3082 9.45828 11.3557 9.42639 10.8978 9.59766 6.61449 6.41491 8.5803 5.21241 9.27903 11.6879 9.24707 7.37513 9.04562 9.52268 0 0 0 0 8.28202 A0A0B8RT38 A0A0B8RT38_PIG Sad1 and UNC84 domain containing 2 SUN2 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] AASLAASLTR 0.92123 232.46 11.0307 8.66263 11.1186 10.8892 10.5919 11.1898 10.1727 8.04691 9.13863 10.6274 10.5997 10.5668 11.5855 0 10.5606 10.5948 9.40561 0 10.8179 11.3375 7.93186 11.9324 11.73 12.598 10.7369 10.5787 10.5351 11.3705 10.8401 10.0182 11.5741 11.1147 11.6569 11.1244 10.4401 7.33423 10.1934 10.5036 11.1886 10.7203 10.6629 7.73525 11.3756 10.7046 10.9158 9.13843 10.5565 0 6.74994 8.46001 8.05534 9.99986 9.93353 8.96417 10.2136 0 9.39515 10.2559 9.19451 9.83215 8.68524 7.51467 8.215 A0A0B8RT39 A0A0B8RT39_PIG Centrosomal protein of 120 kDa CEP120 Sus scrofa domesticus (domestic pig) AALELEMWK 1.1278 323.31 11.8665 17.945 11.2467 12.9683 18.572 14.7812 10.467 18.4789 11.474 12.4955 18.4783 12.902 11.4331 10.853 12.8448 14.255 12.6624 18.4673 11.1751 9.43281 11.3701 11.1408 12.7748 10.4469 18.4762 8.82216 18.2725 17.8885 11.9617 18.2567 18.4627 13.8674 13.0185 11.9862 11.4521 11.1492 11.6497 9.57815 11.8084 7.16902 10.0381 12.0786 10.9819 11.0697 7.49913 10.6517 9.05726 10.874 11.9409 12.7328 12.1317 12.2775 11.6515 11.2357 8.04603 17.5406 8.89312 17.2816 11.691 11.5404 6.26795 10.3687 10.3774 A0A0B8RT41 A0A0B8RT41_PIG Serine/threonine kinase 17b STK17B Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674] AEILHEIAVLELAK 0.96679 82.86 0 7.93216 8.90926 10.0375 10.7307 0 10.5783 11.3715 10.4575 9.17537 11.392 8.81724 12.2407 10.038 10.1799 10.184 10.2047 7.65492 8.6388 9.36875 8.90247 11.5058 10.7323 9.25692 7.53846 7.13175 8.45002 0 0 8.62498 8.95146 5.96139 8.98854 7.16912 0 0 7.83668 0 0 7.9814 0 8.39116 9.07764 8.0148 0 9.31531 7.75982 0 0 0 9.28817 8.69181 7.01725 3.99123 5.26157 7.35315 8.64028 7.48253 8.32616 6.58224 11.0535 10.5504 6.99084 A0A0B8RT42 A0A0B8RT42_PIG Tetraspanin CD9 Sus scrofa domesticus (domestic pig) single fertilization [GO:0007338] extracellular region [GO:0005576]; plasma membrane [GO:0005886] DDPQRETLK 0.97349 57.43 6.85674 0 8.38987 0 10.3616 9.58461 0 0 0 8.24892 4.37414 7.38698 8.60381 7.69669 0 0 4.73704 0 6.86481 0 6.24935 5.02365 0 5.96837 8.57225 10.0957 10.5329 0 8.7485 0 9.22038 9.09408 8.68356 0 0 0 9.1745 5.58748 0 0 0 6.58555 0 0 6.46535 7.23898 0 8.43692 5.76431 8.18319 0 0 0 0 0 8.11956 0 0 0 0 0 0 5.17672 A0A0B8RT44 A0A0B8RT44_PIG Tumor necrosis factor receptor superfamily member 5 (B-cell surface antigen CD40) (CD40L receptor) CD40 Sus scrofa domesticus (domestic pig) B cell activation [GO:0042113]; regulation of immune response [GO:0050776] external side of plasma membrane [GO:0009897] signaling receptor activity [GO:0038023] AGTNKTDVVCGFQSR 0.96637 63.384 8.31719 7.19348 0 0 0 9.15472 9.49931 7.64277 7.3753 7.72199 0 0 9.48154 9.91898 9.70295 6.63715 0 7.61552 8.03952 9.39066 8.99427 0 0 9.02301 8.56586 3.32351 0 0 10.3551 9.50508 0 0 0 0 5.84777 9.0659 9.20024 0 9.28239 0 4.18729 0 0 0 0 8.49137 7.9276 8.20168 8.3789 10.3423 10.1524 5.11224 0 0 7.87092 9.46399 0 8.08002 5.63767 5.92439 7.08268 7.10633 0 A0A0B8RT47 A0A0B8RT47_PIG Programmed cell death 1 ligand 1 CD274 Sus scrofa domesticus (domestic pig) regulation of immune system process [GO:0002682] membrane [GO:0016020] AQLLKDQLFLGKASLQITDVK 0.96875 136.61 0 8.67299 8.08311 6.15269 9.19817 8.73528 8.832 10.6977 9.81372 5.70755 9.77596 9.27195 8.73671 10.0307 9.99067 14.0115 10.7153 0 9.10837 9.02331 0 0 9.6923 0 8.49837 0 9.49831 10.1798 8.78702 4.44758 6.51019 11.4283 9.72101 8.78113 10.7093 0 9.63641 0 4.40061 7.98197 7.45623 10.6652 8.70936 10.6698 7.37374 7.3906 9.27387 5.91891 9.08026 9.84365 0 10.0731 8.80342 8.31814 3.61577 8.43991 0 5.20144 6.9357 8.40314 4.82833 0 6.80465 A0A0B8RT48 A0A0B8RT48_PIG Serglycin SRGN Sus scrofa domesticus (domestic pig) CSGLVLALAIILILDSSVQGSPVR 0.96411 47.763 0 0 0 0 6.37952 0 5.12858 7.424 0 7.29444 0 0 0 0 10.2824 0 0 5.90446 8.88686 8.69349 0 0 0 0 0 5.4661 0 0 0 7.31768 9.44012 9.03949 9.19436 0 6.78777 0 9.21556 0 8.33083 0 0 0 0 0 0 6.97235 0 0 0 8.30957 8.07419 0 0 0 0 0 0 0 6.78044 0 0 5.89023 0 A0A0B8RT50 A0A0B8RT50_PIG Spen family transcriptional repressor SPEN Sus scrofa domesticus (domestic pig) intracellular membrane-bounded organelle [GO:0043231] RNA binding [GO:0003723] AAAADASEGLSAGDR 1.0449 323.31 12.6144 12.2827 12.8897 15.0362 13.8079 13.8937 15.1894 13.7975 13.3581 12.7097 14.6849 13.2241 15.2838 15.0339 13.9801 14.8102 15.9566 13.871 14.821 13.7274 13.035 14.1841 14.6641 14.4225 13.5129 12.1736 13.4815 12.3486 12.848 11.8606 12.9904 13.2224 13.17 13.8196 11.8986 11.6006 12.6384 13.3685 14.1588 11.1111 12.1781 12.365 10.8638 12.4533 12.5941 13.7878 12.4402 13.373 12.8685 13.909 12.9766 12.693 13.5729 11.343 10.7639 11.238 12.4193 10.6542 12.6501 10.2445 11.0153 12.5308 10.8097 A0A0B8RT51 A0A0B8RT51_PIG Cyclin I CCNI Sus scrofa domesticus (domestic pig) AHPKYLSCIAISCFFLAAK 0.97855 186 9.11679 0 8.26421 0 9.7501 9.73895 10.3394 11.9537 10.0058 3.2728 5.7094 10.2696 8.78992 8.71836 10.7964 7.50319 0 5.46676 7.40096 9.33958 9.51011 11.2602 9.74497 8.63615 4.85325 0 9.58885 8.49261 9.29271 10.3002 10.4278 7.3319 10.8143 10.213 0 0 10.7776 9.45884 8.46152 3.3799 7.55267 8.33561 9.92147 10.6848 9.88119 0 9.74635 7.67624 10.2245 9.41032 6.72042 10.858 8.14776 11.0581 8.50438 8.76235 8.29338 8.33834 0 6.60569 0 6.91874 6.56855 A0A0B8RT53 A0A0B8RT53_PIG Son of sevenless-like 1 SOS1 Sus scrofa domesticus (domestic pig) small GTPase mediated signal transduction [GO:0007264] guanyl-nucleotide exchange factor activity [GO:0005085]; protein heterodimerization activity [GO:0046982] AFMAEIRQYIR 1.0535 323.31 10.9947 15.4123 10.9004 12.4887 12.4036 11.0443 11.9614 12.0258 11.4634 14.8638 17.4993 9.81628 11.7981 10.5852 18.1514 12.3613 17.7918 9.93239 17.1697 16.84 11.2022 18.1052 17.8583 17.6422 16.7592 12.0045 16.6614 15.3936 8.63833 10.9707 10.9871 17.0539 16.912 15.0134 8.90923 9.35751 13.2799 13.065 10.9449 14.4912 10.5718 14.3759 10.3422 11.0318 14.8708 10.6669 9.76266 16.1792 7.53939 8.55712 11.4196 8.44621 9.24003 10.2396 9.3555 9.79516 0 9.20721 14.5566 9.8487 7.32966 7.38224 6.00376 A0A0B8RT54 A0A0B8RT54_PIG Coiled-coil domain containing 71 CCDC71 Sus scrofa domesticus (domestic pig) AARAQAK 0.94136 285.45 11.4171 11.3415 12.8232 11.938 11.9871 11.7515 10.8916 12.268 11.1069 14.2887 11.9255 14.0125 12.9506 11.6382 12.8003 11.8259 13.5135 12.9544 11.5471 12.7544 8.50629 12.5153 13.1767 13.0556 11.4569 7.49538 11.9702 11.2857 10.5781 11.4472 12.2921 12.2304 12.0578 10.2423 7.98288 11.5693 11.1393 11.6644 10.4037 11.893 10.7601 11.1736 10.7798 11.863 11.7001 10.0819 6.72288 11.1257 10.9516 8.45327 11.7069 10.2037 12.4324 10.6419 9.64787 9.81301 9.98939 9.56567 7.55121 5.71935 10.2551 10.0584 10.6332 A0A0B8RT56 A0A0B8RT56_PIG "Caspase 4, apoptosis-related cysteine peptidase" CASP4 Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508]; regulation of apoptotic process [GO:0042981] cysteine-type endopeptidase activity [GO:0004197] AQMPTIER 0.94076 243.98 9.31861 9.03337 0 8.88536 12.1863 13.2317 9.13658 12.5445 7.73525 11.0299 10.1728 10.5443 11.3211 11.626 11.2162 9.49349 8.16103 9.65825 8.78918 9.80532 11.8727 12.064 11.1919 0 0 9.16792 0 8.2149 9.93441 11.4783 12.6605 12.1601 8.58248 10.0362 10.3736 8.96159 11.9616 10.8541 10.1688 11.3395 10.5811 8.95893 10.6506 8.67592 9.07975 10.566 7.46369 8.91004 6.99333 0 0 9.76072 9.12384 10.0304 8.95026 10.0307 7.07211 3.41495 7.37191 8.64111 8.08114 3.5097 0 A0A0B8RT59 A0A0B8RT59_PIG Cullin-associated NEDD8-dissociated protein 1 (Cullin-associated and neddylation-dissociated protein 1) CAND1 Sus scrofa domesticus (domestic pig) SCF complex assembly [GO:0010265] cytoplasm [GO:0005737]; nucleus [GO:0005634] AADIDQEVKER 1.0579 323.31 9.9472 11.1411 10.2922 12.6985 12.8076 8.71328 11.2306 12.804 12.8015 10.799 12.2488 11.029 10.2486 11.8616 10.5437 10.4553 10.8143 11.3405 11.0335 10.6403 12.2397 9.97799 12.3485 12.4631 9.58169 10.519 10.8261 11.4218 10.6904 8.99489 10.8751 12.9382 11.5616 10.9591 0 10.472 11.7615 13.6667 11.2814 10.0072 10.7553 9.10037 11.0796 10.0761 10.6328 8.1815 8.4837 12.1045 9.48384 12.7572 9.65626 9.95862 12.1025 9.82098 10.9674 10.5162 8.72707 11.0511 8.58331 11.2221 8.42118 9.23611 9.15216 A0A0B8RT60 A0A0B8RT60_PIG Mothers against decapentaplegic homolog (MAD homolog) (Mothers against DPP homolog) (SMAD family member) SMAD5 Sus scrofa domesticus (domestic pig) regulation of DNA-templated transcription [GO:0006355] cytoplasm [GO:0005737]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667] metal ion binding [GO:0046872] ALSSPGQPSK 0.96526 175 14.748 0 14.0681 9.63619 15.8771 15.6957 8.30044 9.77946 11.6459 8.22101 7.19505 7.82725 6.65148 14.468 11.0606 14.7771 4.38433 10.1477 12.7164 12.6912 12.8314 10.8319 8.03777 10.3402 8.60555 9.64176 8.88545 13.8088 8.53749 4.2228 10.3023 8.17223 8.65507 9.89222 0 11.0206 9.02909 6.81044 0 14.1036 14.0238 11.1212 10.2251 6.18321 8.00084 9.09207 0 6.72506 13.5937 11.1722 14.1581 11.4446 6.19194 13.6287 11.4562 14.4426 6.92695 9.60465 7.51665 0 8.11114 0 13.7853 A0A0B8RT62 A0A0B8RT62_PIG N/A C7H6orf106 Sus scrofa domesticus (domestic pig) DPGGSGFDSISK 0.9657 77.557 0 8.19972 6.60791 16.2059 8.24982 10.4257 6.49624 9.48533 7.81788 0 14.8468 0 0 0 0 16.0316 0 16.2682 0 6.41645 10.2009 10.7554 0 9.98228 5.94352 0 7.36781 0 0 0 7.89688 0 7.81909 9.63751 0 6.81442 7.89142 0 0 0 0 4.97049 5.17221 0 0 13.8069 0 7.64328 0 8.8622 0 13.7193 0 7.37513 0 0 0 0 0 5.28625 0 6.93322 8.03996 A0A0B8RT63 A0A0B8RT63_PIG "Solute carrier family 5 (Sodium/myo-inositol cotransporter), member 3" SLC5A3 Sus scrofa domesticus (domestic pig) myo-inositol transport [GO:0015798] membrane [GO:0016020] glucose:sodium symporter activity [GO:0005412] APECDQPDERPGFIK 0.96449 139.88 9.8333 9.31635 4.48033 9.48414 9.1608 10.7919 12.2084 7.18597 5.23446 7.31768 5.14241 0 8.79041 10.6044 9.68301 9.88039 8.32706 8.13848 12.1355 8.46765 9.40322 9.49613 0 5.04369 0 8.47925 6.08829 10.3716 10.6675 9.65926 9.92541 10.074 10.9459 7.89657 9.26838 6.52489 0 5.82176 9.49955 0 8.42823 8.68979 8.94512 8.37825 9.42752 7.81628 0 7.63568 12.1452 8.25616 8.27202 0 7.672 8.2555 7.61721 8.17822 0 6.99729 0 0 0 8.15497 6.7707 A0A0B8RT65 A0A0B8RT65_PIG Basigin BSG Sus scrofa domesticus (domestic pig) membrane [GO:0016020] EDALPDLR 0.96189 113.69 10.0201 8.69825 0 11.1331 11.04 7.66825 0 0 7.60844 0 0 0 6.31888 9.42473 0 5.17732 8.85062 11.2512 7.91803 8.6576 0 11.1831 9.23266 11.0424 0 9.67837 11.7586 10.404 9.48156 0 10.1186 0 9.99944 7.02303 5.62114 0 0 9.38219 0 10.382 2.05123 8.57255 12.1895 0 8.05729 5.13229 9.07591 0 6.21593 9.07959 9.73508 10.5121 0 0 6.09597 4.82283 0 8.75215 0 0 0 0 4.89093 A0A0B8RT66 A0A0B8RT66_PIG Sodium-coupled neutral amino acid transporter 7 (Solute carrier family 38 member 7) SLC38A7 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] AQVSINNDPGEWGLSTDSGER 0.96982 62.136 8.84937 8.81702 8.73288 9.93858 9.63968 9.15048 0 0 9.35293 6.66619 0 8.88701 11.5384 8.93381 9.67617 0 8.60118 0 0 8.86137 0 0 0 5.95694 0 7.27966 0 0 8.29444 6.78424 0 0 0 0 0 7.95646 8.76537 0 5.19342 8.95303 0 0 7.9987 9.75148 0 0 8.21597 0 8.15629 8.29783 11.8244 0 0 0 8.24208 8.11234 0 0 0 6.76208 7.24355 6.8107 0 A0A0B8RT70 A0A0B8RT70_PIG Zinc transporter SLC30A7 Sus scrofa domesticus (domestic pig) intracellular zinc ion homeostasis [GO:0006882] Golgi apparatus [GO:0005794]; membrane [GO:0016020]; sarcoplasmic reticulum [GO:0016529] zinc ion transmembrane transporter activity [GO:0005385] AEVLAGFVNGLFLIFTAFFIFSEGVERALAPPDVHHER 0.96786 66.128 0 9.73588 0 0 9.3755 9.54581 8.53784 0 8.30888 8.22366 7.72969 9.64739 8.41848 8.84075 0 0 8.93876 8.22077 0 8.66924 7.12298 0 0 0 0 9.75602 9.17013 0 9.60528 6.30593 0 0 0 9.96212 9.99704 7.60162 8.71864 0 0 7.70833 0 0 10.8189 8.49109 5.38764 0 3.87283 8.39703 0 0 0 7.73254 0 0 0 4.97141 8.73169 0 7.84687 4.0089 0 0 0 A0A0B8RT71 A0A0B8RT71_PIG BCL2-antagonist/killer 1 BAK1 Sus scrofa domesticus (domestic pig) apoptotic process [GO:0006915]; regulation of apoptotic process [GO:0042981] membrane [GO:0016020] ASGQGPGPPR 0.96582 73.794 4.6339 0 0 7.70079 9.69338 7.17981 8.22347 9.08236 0 0 0 6.05903 0 7.26454 7.54767 6.85587 4.34674 9.81255 0 9.2197 0 7.55873 8.95997 0 9.80158 7.8874 3.74233 9.48321 9.43031 6.2273 0 10.1602 9.40007 0 0 0 7.08884 7.49201 0 6.82998 0 0 7.49017 7.29112 7.84329 9.00902 7.4582 0 8.88252 4.79815 8.14103 0 0 0 5.66072 6.31651 0 9.10591 4.34056 0 5.03417 3.51084 0 A0A0B8RT73 A0A0B8RT73_PIG Mitochondrial 2-oxoglutarate/malate carrier protein (Solute carrier family 25 member 11) SLC25A11 Sus scrofa domesticus (domestic pig) lipid transport [GO:0006869] membrane [GO:0016020] antiporter activity [GO:0015297] AATASPGAGGMDAKPR 0.95872 128.23 0 0 10.7666 0 9.23156 8.38461 9.48309 0 10.301 4.54788 9.29446 8.51258 10.6881 9.72562 8.0456 0 8.94169 0 10.1563 10.1563 8.43808 10.4872 9.88509 10.8405 5.78005 0 0 7.42568 9.25977 8.60032 12.4744 6.8268 5.42085 0 10.7474 5.88484 0 8.28452 7.98037 4.66135 7.50978 0 6.46669 0 4.16027 9.57507 0 8.51928 8.44004 7.15886 8.6755 9.89061 0 3.39999 4.79841 0 7.385 8.25569 7.45886 6.71754 7.38016 0 0 A0A0B8RT74 A0A0B8RT74_PIG "ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b" ATP6V0B Sus scrofa domesticus (domestic pig) "clathrin-coated vesicle membrane [GO:0030665]; proton-transporting V-type ATPase, V0 domain [GO:0033179]" "proton-transporting ATPase activity, rotational mechanism [GO:0046961]" ILIVEIFGSAIGLFGVIVAILQTSR 0.9966 4.9348 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5.72099 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A0B8RT76 A0A0B8RT76_PIG SLAM family member 6 SLAMF6 Sus scrofa domesticus (domestic pig) AQSPLIHVTDPK 0.96479 50.638 0 8.10528 0 7.39549 0 0 0 0 9.27573 7.70259 7.61883 0 0 8.42882 8.65105 8.93407 6.94451 0 0 0 0 7.61346 8.22588 0 0 6.16267 0 0 0 7.61006 0 0 0 0 0 0 0 9.03521 5.75261 0 11.9016 0 0 0 0 0 0 0 0 5.07322 0 0 0 0 7.84449 8.21091 6.81609 4.12656 9.03634 0 4.9357 0 0 A0A0B8RT78 A0A0B8RT78_PIG Sodium/potassium-transporting ATPase subunit beta ATP1B3 Sus scrofa domesticus (domestic pig) potassium ion transport [GO:0006813]; sodium ion transport [GO:0006814] apical plasma membrane [GO:0016324]; basolateral plasma membrane [GO:0016323]; sodium:potassium-exchanging ATPase complex [GO:0005890] DKFLGRVAFK 0.96115 115.58 0 0 0 10.7905 10.1872 10.2904 10.6365 10.9993 7.00495 8.5074 10.2059 9.27831 12.2385 11.0945 8.49213 0 9.94943 6.69572 6.48982 5.73606 8.25974 13.9637 9.73781 9.73885 9.95791 6.86047 8.85303 8.8475 9.89351 8.92716 8.72639 11.1948 10.2825 9.22395 0 7.97183 8.60759 9.04144 7.59126 8.82623 0 8.46058 11.2855 10.8244 6.4002 8.98647 8.36089 10.7075 7.68124 10.8537 9.43396 0 8.61416 4.21715 8.8398 8.29112 9.23633 0 7.69738 7.12856 0 8.9733 9.42196 A0A0B8RT80 A0A0B8RT80_PIG Sphingosine-1-phosphate phosphatase 1 SGPP1 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] AEAPLAGEPRHRER 0.95817 102.35 10.7532 0 0 5.24195 13.3541 11.8428 9.78303 6.38797 11.2423 11.2074 11.01 12.3957 4.17113 9.92331 0 0 0 6.2502 5.95273 2.91299 9.33123 0 0 10.5513 9.05683 10.2613 9.60129 0 0 0 0 11.9203 8.60002 2.37148 0 8.16234 0 2.72058 0 0 4.23588 0 0 8.83017 5.46189 0 8.18602 4.852 7.81051 9.63401 0 0 3.6207 7.84229 6.32859 0 0 7.71528 6.5517 6.49728 7.17013 8.76838 3.03138 A0A0B8RT81 A0A0B8RT81_PIG Glial cell derived neurotrophic factor ATF1 Sus scrofa domesticus (domestic pig) response to stimulus [GO:0050896] nucleus [GO:0005634] DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700] CLENRVAVLENQNK 0.96799 83.173 0 3.52005 3.87362 8.70235 10.6455 0 0 4.56322 8.26388 10.3296 0 0 10.6134 7.94965 10.9386 10.0065 0 7.91241 10.1989 0 9.79134 10.5692 10.5457 11.1865 0 4.43409 3.46819 0 7.78718 0 0 10.0643 0 0 10.5156 0 9.01039 0 0 8.62374 0 0 9.13771 9.18572 7.87172 7.76288 8.63074 7.84204 8.21767 0 7.81538 9.22371 8.11905 6.6072 0 3.9748 0 0 0 0 0 10.1152 0 A0A0B8RT83 A0A0B8RT83_PIG SERPINE1 mRNA binding protein 1 SERBP1 Sus scrofa domesticus (domestic pig) regulation of translation [GO:0006417] RNA binding [GO:0003723] AIQNKDRAK 0.92946 223.17 10.8294 9.86222 10.3192 10.0244 10.4314 11.1995 11.0947 11.1531 11.8231 10.3942 9.02006 11.64 11.6823 12.9964 12.1203 9.59835 10.5804 10.3514 9.80792 11.8066 9.59324 11.4955 11.2717 11.4409 0 9.85251 10.0001 10.5622 9.42234 10.5654 10.9905 11.0244 12.1158 11.3866 11.0662 10.112 11.2239 11.1651 11.1436 6.124 9.4051 7.56811 15.6049 8.75859 12.0106 10.0928 8.99639 10.4668 9.68196 10.5585 10.3807 7.56072 8.71063 11.0485 0 9.32634 10.215 0 9.6581 8.83813 0 6.37792 7.9194 A0A0B8RT85 A0A0B8RT85_PIG ADP-ribosylation factor guanine nucleotide-exchange factor 2 (Brefeldin A-inhibited) ARFGEF2 Sus scrofa domesticus (domestic pig) protein transport [GO:0015031]; regulation of ARF protein signal transduction [GO:0032012] Golgi apparatus [GO:0005794] guanyl-nucleotide exchange factor activity [GO:0005085] ACQVALDEIKAEIEK 1.0756 323.31 10.7693 10.8826 11.2912 15.3222 15.3122 14.8474 12.4836 13.8613 13.277 12.6023 14.0535 12.3108 12.5802 11.473 12.4808 12.5773 14.6479 14.4087 13.5171 11.8478 12.4919 13.6617 13.0792 12.9931 12.3766 11.487 10.8832 15.6679 15.62 15.6889 12.5292 12.8418 12.3382 10.9951 10.5464 9.88377 11.1032 11.3136 11.9064 9.75444 9.23479 10.6117 12.4356 13.3176 10.5395 10.8191 11.1207 10.9003 9.26573 13.7475 11.2563 10.7886 10.4589 12.0404 4.09592 9.90727 9.61642 12.3192 10.7676 9.37817 11.0628 10.0279 9.82629 A0A0B8RT86 A0A0B8RT86_PIG "Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (EC 1.3.5.1)" SDHA Sus scrofa domesticus (domestic pig) electron transport chain [GO:0022900]; tricarboxylic acid cycle [GO:0006099] mitochondrial inner membrane [GO:0005743] flavin adenine dinucleotide binding [GO:0050660]; fumarate reductase (menaquinone) [GO:0102040]; succinate dehydrogenase (ubiquinone) activity [GO:0008177] AFGGQSLK 0.93366 248.88 9.90197 8.57652 0 9.48876 10.1579 10.6874 10.5451 10.8852 10.9939 10.0056 8.86 8.50926 11.9982 11.3768 11.3175 0 7.82668 11.0318 7.7097 9.56765 10.3167 8.45059 0 10.8577 7.41126 8.26369 6.06944 10.5441 9.40856 9.36672 10.5661 9.48858 10.6873 0 9.72409 8.88127 9.87555 7.64292 8.52223 7.35826 10.4048 0 5.8516 9.57977 7.56407 9.35385 10.4221 10.6353 9.61686 9.10431 10.8778 7.52317 7.67969 8.55259 0 6.33153 8.09887 12.5251 0 5.49086 9.6871 8.72021 0 A0A0B8RT88 A0A0B8RT88_PIG AP-3 complex subunit mu-1 (AP-3 adaptor complex mu3A subunit) (Adaptor-related protein complex 3 subunit mu-1) (Mu-adaptin 3A) (Mu3A-adaptin) AP3M1 Sus scrofa domesticus (domestic pig) intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192] clathrin adaptor complex [GO:0030131]; Golgi apparatus [GO:0005794] AADVENVPPVISTPHHYLISIYR 0.96843 137.87 6.74819 8.12335 9.92059 10.4857 8.63041 9.7707 9.67417 11.2077 8.76348 7.31814 11.0381 6.70113 11.3353 6.10863 0 6.74443 0 10.2676 9.49811 0 7.75529 10.4092 5.62743 11.9427 10.6059 7.94679 7.43904 10.3259 10.0784 7.82934 6.74093 9.8975 0 11.3146 0 0 7.87455 9.52806 7.29774 0 0 0 8.283 8.5575 6.88289 8.97373 10.3942 7.53924 6.84009 10.9835 5.28314 8.70536 0 9.90156 7.4822 5.94837 10.332 10.0522 0 10.2781 10.5736 8.25441 5.86389 A0A0B8RT89 A0A0B8RT89_PIG SAP domain containing ribonucleoprotein SARNP Sus scrofa domesticus (domestic pig) ribonucleoprotein complex [GO:1990904] AERFGIA 0.95522 151.41 10.283 6.6946 0 10.8877 11.5062 9.81545 8.16867 8.90842 10.1253 10.7038 9.72019 0 9.13455 10.6674 13.632 10.6813 0 5.30053 9.69853 11.6879 0 10.5 10.0512 6.83845 10.1792 0 0 8.76524 0 8.45483 0 8.74668 8.44058 8.82489 8.52403 9.36238 10.4372 9.74878 7.00338 5.18543 0 9.19173 0 7.51609 9.07625 3.48607 0 0 8.49454 8.21839 10.0848 5.74518 5.71312 8.55754 7.44286 8.85053 0 0 0 0 7.66938 10.4235 0 A0A0B8RT91 A0A0B8RT91_PIG AMMECR1-like AMMECR1L Sus scrofa domesticus (domestic pig) CVPPLEPK 0.95952 97.648 12.3969 0 8.93667 0 8.79737 8.623 9.6756 0 0 0 0 7.88923 10.2193 0 9.26573 9.51897 0 0 0 0 0 0 8.55344 0 0 0 0 0 7.11416 9.34327 0 0 6.25314 8.25904 0 10.2182 0 6.79286 8.68384 7.19672 9.34127 10.0689 0 0 0 8.11416 0 6.43207 13.1595 9.53916 0 7.56163 6.76208 0 2.75041 6.86839 7.66085 0 0 0 0 0 0 A0A0B8RT92 A0A0B8RT92_PIG RRP12-like protein RRP12 Sus scrofa domesticus (domestic pig) AAQHGVCSVLK 1.094 323.31 8.79581 11.7256 10.6794 9.77781 12.3595 14.2329 11.8325 10.2046 11.4815 8.74174 13.6708 10.3506 12.0878 12.3016 13.7057 10.626 9.62438 14.2433 11.8207 11.1272 10.1114 14.0959 11.8702 10.8874 11.2091 11.2076 11.5322 11.817 12.126 12.3873 11.2357 11.8027 11.7447 9.81004 11.0233 9.71387 7.23304 9.98542 12.7419 10.6309 10.3868 7.20506 10.2058 11.8795 12.0319 7.41371 9.47551 10.4532 11.4957 10.9461 11.3723 9.93117 10.0182 9.81482 7.99757 10.1629 9.10855 4.48362 9.93739 10.886 8.90521 8.30328 6.36014 A0A0B8RT94 A0A0B8RT94_PIG A kinase (PRKA) anchor protein 8-like AKAP8L Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] nucleus [GO:0005634] DNA binding [GO:0003677]; kinase activity [GO:0016301]; metal ion binding [GO:0046872] AEGEDEEGK 0.94314 303.48 11.2144 10.5735 11.7754 14.0282 13.9253 12.3735 12.4654 12.0172 12.6448 11.2437 13.7917 12.2633 12.5977 11.1439 14.0383 11.4255 14.2977 9.33573 0 11.0449 10.6928 14.3053 12.7221 11.2054 10.6563 12.663 1.86406 11.1642 11.7341 11.9262 12.9865 13.3529 11.5605 11.0893 9.23249 9.56007 9.16179 9.72344 9.03859 11.6027 9.32249 9.35145 8.52188 10.6016 8.36282 10.1148 0 8.09982 5.53959 10.0208 10.6195 8.31796 10.7046 8.47557 0 8.34438 7.78267 5.77307 7.11925 8.31474 6.96185 0 9.89078 A0A0B8RT95 A0A0B8RT95_PIG Large ribosomal subunit protein uL4 (60S ribosomal protein L4) RPL4 Sus scrofa domesticus (domestic pig) translation [GO:0006412] ribonucleoprotein complex [GO:1990904]; ribosome [GO:0005840] structural constituent of ribosome [GO:0003735] AAAALKAK 0.93301 245.47 11.1361 9.96443 7.46842 0 9.62046 12.3003 10.3929 6.16485 6.25388 0 6.6659 8.68271 10.9061 11.7258 12.844 9.39157 9.34618 7.47743 14.5339 7.42987 4.93036 7.93328 6.72137 9.23451 7.75288 4.49102 9.37256 9.43715 10.6571 6.77426 10.5862 9.4096 9.79108 6.36762 6.69028 11.1021 10.5819 10.6745 10.9642 5.29605 9.4412 8.26097 10.8935 9.65238 10.328 10.3362 9.86871 9.25809 7.20721 8.7738 9.33669 8.45364 8.62567 7.99949 7.89051 10.3984 7.34172 0 5.64475 7.09508 7.96532 8.57611 9.66171 A0A0B8RT97 A0A0B8RT97_PIG ADP-dependent glucokinase ADPGK Sus scrofa domesticus (domestic pig) glycolytic process [GO:0006096]; phosphorylation [GO:0016310] "kinase activity [GO:0016301]; phosphotransferase activity, alcohol group as acceptor [GO:0016773]" APLEFVTSRSEAGSR 0.96981 83.314 14.5258 14.4076 14.6039 8.59653 16.7655 7.40744 16.938 13.3946 17.0586 13.0088 16.4185 8.05458 9.15127 6.24764 16.9721 6.47729 0 5.54908 15.542 15.9394 12.6528 16.5351 16.9156 16.9187 14.9878 0 6.41456 7.92202 0 14.063 16.0423 10.9291 15.9125 0 10.6663 13.8089 14.4624 14.5204 14.7907 10.216 3.68605 0 13.8081 13.6838 9.44566 15.0774 7.89561 0 0 7.88886 7.64883 0 6.66192 0 0 0 13.2191 8.5614 10.0077 10.8663 9.78205 0 0 A0A0B8RT99 A0A0B8RT99_PIG RING-type E3 ubiquitin transferase (EC 2.3.2.27) RNF166 Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737] HCVDNHR 0.96731 63.53 0 0 6.43739 0 0 0 3.69622 0 8.02087 8.70919 0 0 0 9.1932 0 0 8.55367 0 0 0 10.3217 0 9.91683 0 0 8.62797 12.0593 0 0 0 9.50054 0 0 0 0 8.16133 0 0 0 0 0 0 14.3135 14.5749 10.6002 8.2305 0 0 0 0 6.84222 0 0 0 11.1867 0 0 0 6.7039 7.18893 0 0 0 A0A0B8RTA0 A0A0B8RTA0_PIG ADAM metallopeptidase domain 17 ADAM17 Sus scrofa domesticus (domestic pig) Notch signaling pathway [GO:0007219]; proteolysis [GO:0006508] membrane [GO:0016020] metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222] ADNEELLPK 1.1082 323.31 10.5358 11.4856 11.5057 11.5718 14.4776 12.4814 13.1256 11.1765 12.98 12.5758 11.2366 11.5467 12.5731 12.7859 12.7424 11.8895 10.4084 11.927 11.304 12.7282 10.7369 14.8952 13.2762 10.8269 8.5697 12.1401 11.6739 9.00576 10.9198 12.9764 11.798 12.8082 12.0436 12.482 10.0316 11.5153 10.4369 11.269 12.0502 7.40054 8.24031 9.13319 9.22337 10.9998 11.977 10.9505 10.6348 10.5911 8.47452 10.9529 12.0315 11.1777 10.4584 10.3778 7.59021 8.95887 9.11296 5.85042 6.96625 10.5331 10.5138 6.5711 9.5386 A0A0B8RTA2 A0A0B8RTA2_PIG "Actin, cytoplasmic 2 (Gamma-actin)" ACTG1 Sus scrofa domesticus (domestic pig) cytoskeleton [GO:0005856]; dense body [GO:0097433]; focal adhesion [GO:0005925]; plasma membrane [GO:0005886] hydrolase activity [GO:0016787] AGFAGDDAPR 1.113 323.31 12.5654 12.9281 12.5929 14.0026 13.7383 13.7035 13.9566 13.5988 13.0693 12.8247 12.2259 12.1285 12.3056 12.3387 12.4587 13.2761 13.5272 13.1957 12.9451 13.069 13.0119 12.9344 13.0183 13.6083 12.3815 11.6887 12.7122 11.9458 12.9097 12.3093 15.6421 15.3295 15.1299 11.9881 11.4894 12.3368 13.1226 11.9332 12.4616 11.6584 12.168 12.1576 11.5507 11.1143 11.647 12.1165 11.3156 12.1391 11.3747 12.8598 11.6914 11.0242 9.68133 10.4922 10.2228 10.7274 10.2863 10.0527 10.7921 10.2609 0 6.31653 6.58999 A0A0B8RTA4 A0A0B8RTA4_PIG RING-type E3 ubiquitin transferase (EC 2.3.2.27) RFFL Sus scrofa domesticus (domestic pig) apoptotic process [GO:0006915] cytosol [GO:0005829]; plasma membrane [GO:0005886] metal ion binding [GO:0046872] ACGAHFASMSR 0.95931 131.92 8.42307 9.15737 0 9.19353 7.13832 0 7.80129 9.89551 6.78803 9.38763 7.58045 8.71304 8.67807 12.7895 13.1322 9.47952 12.9282 8.88649 10.4404 0 0 9.59526 9.40148 16.9471 8.50311 11.1288 6.48718 10.0859 0 8.18478 11.1991 11.0596 7.57871 8.88813 8.11082 7.67455 0 7.31551 7.10999 0 7.69488 9.44216 8.1393 2.6294 5.27683 0 0 3.68257 7.72874 9.62886 10.4051 0 0 0 0 0 6.43793 0 8.93021 8.64223 0 7.09803 6.05272 A0A0B8RTA5 A0A0B8RTA5_PIG "Aconitate hydratase, mitochondrial (Aconitase) (EC 4.2.1.3)" ACO2 Sus scrofa domesticus (domestic pig) tricarboxylic acid cycle [GO:0006099] mitochondrion [GO:0005739] "4 iron, 4 sulfur cluster binding [GO:0051539]; aconitate hydratase activity [GO:0003994]; metal ion binding [GO:0046872]" ADIANLADEFK 0.94154 285.37 0 12.8027 12.5666 12.5769 12.4801 13.2308 12.9399 10.872 12.1809 12.4932 12.0244 10.1678 9.55524 12.7155 11.5933 11.6147 12.8137 11.1814 0 10.9334 12.6485 12.3624 10.7344 11.1012 11.7196 8.96035 12.4747 9.54626 12.517 8.1375 12.7387 12.852 13.3618 0 11.3781 11.2662 12.496 10 12.608 0 9.19207 11.6254 10.566 14.9349 9.42316 12.277 10.7734 11.5186 9.83708 12.3831 9.35971 12.0768 10.0045 12.0226 11.8737 10.8203 12.2316 10.4809 7.82852 11.7548 10.4704 10.9371 10.4691 A0A0B8RTA7 A0A0B8RTA7_PIG RNA binding motif protein 25 RBM25 Sus scrofa domesticus (domestic pig) mRNA processing [GO:0006397] nucleus [GO:0005634] RNA binding [GO:0003723] ALRLLHDLQIGEK 1.2427 323.31 11.2408 12.5076 10.9817 10.4179 12.4863 11.8585 13.1366 12.3516 12.9755 11.8711 11.901 9.84075 12.8469 12.8308 11.7014 10.4536 12.2556 14.2495 12.347 12.0308 9.68206 12.3109 12.5214 12.3867 9.73895 12.0249 11.4246 11.0727 10.448 12.143 12.7606 11.8626 11.445 10.9116 10.6914 11.2122 11.3944 12.0261 10.7002 11.2936 9.75213 11.2509 12.0154 12.504 11.9164 10.5946 11.9632 9.44402 11.8659 11.6612 10.3883 10.5768 11.4441 8.66587 10.5428 9.67923 11.3718 12.1526 11.8694 11.7894 8.86682 10.8485 10.1464 A0A0B8RTA8 A0A0B8RTA8_PIG "Very long-chain specific acyl-CoA dehydrogenase, mitochondrial (EC 1.3.8.9)" ACADVL Sus scrofa domesticus (domestic pig) mitochondrial inner membrane [GO:0005743] acyl-CoA dehydrogenase activity [GO:0003995]; flavin adenine dinucleotide binding [GO:0050660] AIIAKAVNHAANR 0.92841 235.81 11.7184 7.55949 10.0592 9.63994 11.0704 13.7351 12.1172 11.4151 10.5959 11.4847 11.2733 10.0371 12.3133 13.0924 13.1716 10.8579 10.6728 11.2367 13.1963 13.7067 11.5336 12.7158 12.0914 11.796 10.1187 6.51232 12.5188 14.1041 11.4431 11.1588 6.80826 12.2085 8.57425 12.0101 11.4177 11.4142 13.6911 8.55229 12.0413 11.3366 9.24736 6.68608 9.82139 9.24474 11.5487 11.392 11.4845 12.5718 9.99873 8.06172 10.888 10.1339 10.8309 8.79685 10.856 11.3839 10.9994 10.8807 7.82687 10.2557 6.57548 10.8551 9.33624 A0A0B8RTB0 A0A0B8RTB0_PIG RAS p21 protein activator 2 RASA2 Sus scrofa domesticus (domestic pig) intracellular signal transduction [GO:0035556]; negative regulation of Ras protein signal transduction [GO:0046580] GTPase activator activity [GO:0005096]; metal ion binding [GO:0046872]; phospholipid binding [GO:0005543] CLDEMMKIVGGHYLK 1.4382 323.31 9.08998 11.0855 10.9269 10.2966 11.7457 12.0952 9.69091 8.17876 12.2818 9.89213 11.7824 9.77431 9.49827 10.0126 14.1986 14.5752 11.0289 9.76974 10.3671 8.81865 10.6548 9.62659 9.92198 10.3017 10.2291 7.66931 9.2032 10.4418 10.0247 10.0666 10.9064 12.3322 9.27661 11.3649 11.6408 11.3881 10.8912 9.2364 10.1026 8.85919 10.1485 9.12135 8.61567 10.1988 11.0872 10.1105 10.196 9.90659 10.0217 9.0204 9.76992 10.0239 8.7224 9.83352 8.29751 9.49771 8.93396 9.58494 11.3715 10.8887 9.06595 9.36514 7.04854 A0A0B8RTB1 A0A0B8RTB1_PIG Apoptosis antagonizing transcription factor AATF Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] AGPQPLALQLEQLLNPRPR 0.93462 247.26 0 10.9238 4.53094 11.6091 10.1797 10.3414 9.3427 11.8853 11.3512 10.774 11.3625 9.87975 10.7421 9.67458 11.3291 8.73183 7.57092 10.1936 10.2836 8.9244 9.4298 11.2247 11.3781 10.861 10.5055 9.56081 8.4496 11.3535 9.65172 7.37643 9.32926 11.1398 9.71301 9.45687 10.2041 10.594 11.6947 9.29009 9.41836 9.47466 8.94102 8.59107 6.24354 8.43929 9.39508 9.70701 10.6737 8.92035 9.83017 8.90301 8.53013 8.72431 6.99571 9.74677 0 8.54782 6.5622 9.43189 7.52489 0 7.98544 10.0334 7.63198 A0A0B8RTB3 A0A0B8RTB3_PIG RAB GTPase activating protein 1 RABGAP1 Sus scrofa domesticus (domestic pig) ADALNKELLMTK 1.4463 323.31 10.3651 10.5718 11.0078 13.0612 12.8305 11.7901 13.2769 13.6893 12.3545 12.2021 11.7228 12.2748 11.5151 11.3135 7.3786 12.7831 12.7877 12.5416 10.4959 8.896 11.6585 12.6999 12.7284 9.06682 10.7728 11.1149 9.88088 13.1127 12.8248 10.4552 12.5473 7.27538 10.1918 11.3076 11.1166 10.4433 11.6495 10.4727 11.4476 11.6244 10.4925 10.3313 14.0655 11.0782 10.9541 11.3329 10.8599 11.4782 12.049 11.5147 12.3021 8.23065 12.2919 10.4739 8.99237 10.3063 11.4793 8.94521 10.4386 9.09645 7.7048 0 10.0561 A0A0B8RTB5 A0A0B8RTB5_PIG PYD and CARD domain containing PYCARD Sus scrofa domesticus (domestic pig) inflammatory response [GO:0006954]; innate immune response [GO:0045087]; regulation of apoptotic process [GO:0042981] canonical inflammasome complex [GO:0061702] AEHTNPTK 0.971 91.56 0 8.76424 7.49522 11.2931 11.2373 9.89551 11.9902 0 10.9693 10.7782 11.4904 13.8541 10.4608 0 9.89321 7.41295 0 7.72199 10.3189 10.0986 10.1572 14.4301 14.1562 9.40423 10.3111 8.99992 10.6794 13.2103 8.65033 12.1443 5.66727 13.5747 8.45397 0 11.1584 10.6533 0 9.54483 9.28515 5.58238 7.60184 8.5901 8.81092 10.3409 8.56815 6.13467 6.60816 11.9847 10.0149 5.65713 6.12474 9.87555 2.96023 6.56512 8.8333 11.168 9.87417 8.97404 8.38655 8.60021 0 8.58797 10.5984 A0A0B8RTB7 A0A0B8RTB7_PIG Prostaglandin E2 receptor EP4 subtype (Prostanoid EP4 receptor) PTGER4 Sus scrofa domesticus (domestic pig) plasma membrane [GO:0005886] prostaglandin E receptor activity [GO:0004957] AIEKIKCLFCR 0.96796 119.88 0 10.3112 8.31791 0 9.70089 8.81385 0 13.648 0 0 0 10.2537 8.11863 0 12.3341 9.64413 9.60489 0 0 0 10.6759 10.2981 0 0 9.70772 0 0 7.9814 10.0074 9.23252 11.2747 10.1899 7.67342 9.60842 9.87198 10.0763 10.0553 9.98071 10.2009 7.08002 0 0 9.30456 9.32827 8.8426 8.82966 8.88905 8.95178 8.62454 9.01112 10.3492 8.66203 9.15307 8.75736 10.0359 9.09077 8.73084 7.78607 8.13299 9.24643 0 5.16201 6.79597 A0A0B8RTB9 A0A0B8RTB9_PIG 26S proteasome non-ATPase regulatory subunit 1 PSMD1 Sus scrofa domesticus (domestic pig) regulation of protein catabolic process [GO:0042176] "proteasome regulatory particle, base subcomplex [GO:0008540]" enzyme regulator activity [GO:0030234] AAVESLGFILFR 0.95078 255.95 9.24565 10.4695 10.9115 10.024 12.3862 11.6652 11.224 11.1867 11.2834 12.0425 10.4788 11.0259 11.8111 10.7346 11.1188 11.294 10.6567 9.89936 6.70252 11.808 10.197 11.2993 11.2907 9.86102 11.4642 7.99836 10.0437 9.7975 11.094 8.75188 9.94936 11.209 12.2229 9.38632 10.4862 9.35288 8.74443 0 11.3153 5.72634 11.1178 10.3399 11.6429 7.91833 11.7791 10.8868 10.7372 8.4634 10.6107 9.129 9.14463 11.7177 10.6815 10.6708 10.9073 10.8345 7.68025 9.3903 9.66966 7.06404 10.6915 10.693 10.6826 A0A0B8RTC1 A0A0B8RTC1_PIG Protein kinase C (EC 2.7.11.13) PRKCQ Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] cytoplasm [GO:0005737] ATP binding [GO:0005524]; diacylglycerol-dependent serine/threonine kinase activity [GO:0004697]; metal ion binding [GO:0046872] ALINSMDQNMFR 1.024 323.31 9.1199 12.6739 10.8839 11.9129 11.4506 10.9609 12.7479 13.0182 12.5696 11.8323 9.56849 11.9965 12.4485 10.5277 11.3947 11.5842 11.001 10.0235 12.1935 11.7507 8.79714 14.2403 11.5471 8.58571 12.3897 12.1883 12.0065 9.0209 11.0387 10.1992 13.2992 13.0536 12.6838 12.6235 12.485 10.2408 8.88414 12.277 12.5075 8.58331 10.5143 11.1811 11.9646 11.7081 8.22236 12.24 12.3248 10.4958 12.2107 12.8549 10.0267 9.24581 8.2949 8.9551 9.82134 8.80361 9.16589 9.06695 11.4272 10.507 10.548 10.9142 10.7716 A0A0B8RTC3 A0A0B8RTC3_PIG thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) PRDX4 Sus scrofa domesticus (domestic pig) thioredoxin-dependent peroxiredoxin activity [GO:0140824] AEALWGLEAEERPRTR 0.96685 135.35 11.1009 11.0719 0 12.1273 12.1565 12.3547 11.8556 11.6399 11.532 5.43276 9.76794 11.8289 10.3907 12.1164 9.26472 9.84001 11.6304 11.6554 11.053 11.18 8.94956 11.4335 7.18309 11.6793 10.6866 10.2442 10.1834 9.34374 10.3098 9.3345 11.5562 11.5685 12.4539 9.27011 7.45385 10.6771 10.7581 11.6469 11.218 9.5705 10.4473 9.14705 0 7.42635 8.73647 10.4516 8.05034 9.82706 10.3581 9.57221 7.59999 9.51023 3.83784 0 9.67932 9.13386 5.57827 9.66736 8.48071 9.90701 7.93198 9.04691 3.31599 A0A0B8RTC5 A0A0B8RTC5_PIG DNA-directed RNA polymerase subunit beta (EC 2.7.7.6) POLR3B Sus scrofa domesticus (domestic pig) DNA-templated transcription [GO:0006351] DNA-directed RNA polymerase complex [GO:0000428]; nucleus [GO:0005634] DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; metal ion binding [GO:0046872]; ribonucleoside binding [GO:0032549] AAQFDVVK 1.5329 323.31 10.815 11.1722 11.878 11.711 11.3946 12.0443 11.6805 14.1571 14.0233 10.5461 13.6924 13.6078 12.473 13.478 11.0231 11.8777 10.901 11.046 14.3233 13.9698 10.8668 12.0757 9.77172 11.8447 11.9152 10.4654 8.42463 13.0765 15.5847 11.6199 11.4219 11.3829 11.3869 10.6085 10.966 10.2127 13.4839 9.97011 13.7091 13.2902 9.0217 9.47658 12.0713 12.7297 13.3257 12.5543 8.806 9.67643 10.7989 13.9485 11.3006 8.64469 9.81778 8.73559 10.3285 7.95146 12.2195 13.446 12.1269 12.0924 13.0015 10.8846 10.9763 A0A0B8RTC7 A0A0B8RTC7_PIG "Pleckstrin homology domain containing, family A (Phosphoinositide binding specific) member 2" PLEKHA2 Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737] CEQDREPLR 0.96956 175.68 9.5128 12.7851 9.20114 12.2954 11.3757 13.0486 10.5007 11.5749 11.2947 0 0 0 9.19274 9.06183 10.72 10.7596 8.1281 11.5069 8.16174 9.22349 0 0 0 8.25328 9.73464 8.93154 7.93026 12.2656 12.3498 8.94819 11.7934 10.7504 11.176 0 8.64346 5.25792 10.1982 7.9956 9.89301 9.87364 0 8.03584 0 7.9528 8.85894 9.41397 8.23515 10.5418 11.0486 8.84981 11.3017 9.48523 9.77225 10.1852 0 9.21386 7.64825 6.91361 9.23367 0 7.01033 9.02198 8.89464 A0A0B8RTC9 A0A0B8RTC9_PIG Phospholipase A2-activating protein PLAA Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737] AFERELSQATIDSK 0.9375 301.15 10.8609 9.13817 9.78028 11.2514 9.88402 12.1772 11.711 13.3875 13.6853 12.1605 9.6674 10.4653 12.7361 9.76706 13.0394 9.28205 12.1965 13.8317 11.2217 11.201 9.3447 13.2897 12.0708 11.8713 12.5016 10.254 12.556 10.6559 11.0327 10.7128 8.75876 10.6787 12.1192 9.1031 9.98028 8.89651 9.58212 10.7195 5.6863 9.96636 9.06614 9.75839 10.2766 9.3014 11.467 8.72001 10.6231 11.4629 12.5986 9.46089 8.54913 10.8348 10.6532 10.748 9.05137 9.9969 11.0522 10.0697 11.4809 10.0186 11.0267 9.44966 11.0662 A0A0B8RTD1 A0A0B8RTD1_PIG Phosphatidylinositol transfer protein alpha isoform PITPNA Sus scrofa domesticus (domestic pig) lipid binding [GO:0008289]; phospholipid transporter activity [GO:0005548] AEEDPAK 0.96296 177.45 12.392 11.1152 13.1872 11.9465 13.386 12.4029 13.3591 14.2536 14.2874 11.4744 11.2524 12.6911 12.3622 12.3801 10.1376 12.3431 12.3597 12.4594 11.2921 10.6734 10.9145 11.9805 12.2003 11.1172 11.0585 11.656 13.0512 8.91244 0 12.1135 0 9.84463 8.97456 11.9726 11.0972 9.44209 10.9792 13.4622 11.0693 10.2934 10.0719 12.7681 11.7691 11.4345 11.3409 9.6558 10.356 9.07256 9.24263 11.117 13.0353 12.3938 8.25181 12.5919 12.3967 12.3159 0 9.40784 11.4962 8.9148 10.768 11.2943 10.6765 A0A0B8RTD3 A0A0B8RTD3_PIG "Protein inhibitor of activated STAT, 2" PIAS2 Sus scrofa domesticus (domestic pig) protein sumoylation [GO:0016925]; regulation of macromolecule metabolic process [GO:0060255] transferase activity [GO:0016740]; zinc ion binding [GO:0008270] ADFEELR 0.97218 170.92 8.24726 9.94001 7.94427 11.0456 10.3515 8.66377 10.4263 10.0642 7.9735 9.76947 10.2499 0 10.4237 10.8896 11.619 0 8.40425 5.66914 9.80747 9.21531 5.61353 11.0186 7.50946 9.63156 9.36602 0 9.638 7.41134 7.4203 8.15755 10.123 7.32346 9.56419 9.18185 8.84467 8.15284 0 7.24982 9.89225 9.08683 8.81205 7.46589 9.57941 9.21371 0 4.54096 6.29743 8.25984 0 8.25828 7.52278 9.15939 7.70625 5.71806 8.9963 5.08996 0 0 6.34454 8.69551 9.17595 7.36466 0 A0A0B8RTD5 A0A0B8RTD5_PIG "6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 4" PFKFB4 Sus scrofa domesticus (domestic pig) "fructose 2,6-bisphosphate metabolic process [GO:0006003]; fructose metabolic process [GO:0006000]" "6-phosphofructo-2-kinase activity [GO:0003873]; ATP binding [GO:0005524]; fructose-2,6-bisphosphate 2-phosphatase activity [GO:0004331]" AAEQLPYLK 0.949 203.47 0 7.02702 9.1429 9.33992 12.3022 9.60583 10.0304 0 9.87754 9.44222 8.75512 11.6157 9.42044 11.4842 9.52797 10.3176 9.09418 11.469 9.68865 10.7706 7.9697 10.0474 7.86827 11.5096 10.0438 5.33085 8.45381 10.1324 9.49438 0 0 9.58257 11.043 11.2538 10.2826 8.15957 10.9963 12.349 9.66388 7.1634 10.0243 5.17269 11.8557 9.39249 9.90375 10.4532 9.222 8.29513 10.7149 7.86814 0 8.96174 9.47581 11.7081 0 6.05582 8.18745 8.05088 16.8827 9 9.25854 10.5624 10.2444 A0A0B8RTD8 A0A0B8RTD8_PIG Pyruvate dehyrogenase phosphatase catalytic subunit 2 PDP2 Sus scrofa domesticus (domestic pig) metal ion binding [GO:0046872]; protein serine/threonine phosphatase activity [GO:0004722] AFGDVQLK 0.95191 150.6 10.7214 0 11.26 9.34787 11.0838 10.2422 9.40015 7.31207 9.33322 0 9.00279 11.267 8.60066 10.3172 9.96694 10.7074 10.7795 11.6024 12.1871 9.27282 9.14802 12.4485 0 2.49922 9.5445 6.31625 0 7.64537 0 9.42015 6.40245 11.7822 8.86691 11.6572 7.78444 8.05398 6.33566 0 7.8794 8.47768 9.28997 7.58624 0 7.20653 9.8487 0 0 8.71973 8.57981 8.86959 6.24795 9.11686 0 10.1231 4.81639 8.90836 8.94202 6.02899 9.22769 0 7.55328 8.44137 8.99393 A0A0B8RTE0 A0A0B8RTE0_PIG Pre-B-cell leukemia homeobox interacting protein 1 PBXIP1 Sus scrofa domesticus (domestic pig) DNA binding [GO:0003677] AAAEELAGTLDGEETLFQSGR 0.9622 307.23 7.61508 9.27861 10.9702 7.78568 13.8646 10.4826 9.08842 13.869 10.0182 11.5207 10.5561 11.1941 11.4573 10.8317 14.0296 9.17986 12.0722 7.60095 11.3254 13.4578 10.1803 11.3799 12.0496 11.0713 10.3249 12.9028 9.77101 9.72342 11.8491 11.7045 9.94905 11.2905 11.4114 12.2841 11.6223 11.7595 8.78215 5.24386 8.3969 9.06819 7.48277 8.97888 9.05991 9.76393 9.1967 10.133 10.0945 9.96737 11.6348 7.86431 11.1329 7.77821 9.14947 9.80678 12.0469 9.54653 8.72072 9.87802 9.07093 8.69975 10.4627 6.84837 10.4237 A0A0B8RTE2 A0A0B8RTE2_PIG RNA polymerase II-associated factor 1 homolog PAF1 Sus scrofa domesticus (domestic pig) transcription elongation by RNA polymerase II [GO:0006368] Cdc73/Paf1 complex [GO:0016593] AGVQSGTNALLVVK 1.2736 323.31 12.14 12.2074 10.8594 11.2743 12.1848 11.7843 13.4338 10.2908 12.3732 8.58635 9.56114 12.6237 11.1511 11.5383 11.1054 10.7152 11.0456 11.2524 13.0357 9.78758 12.1291 11.7471 12.8282 9.17822 11.7237 10.1279 9.92 10.7127 9.87822 9.80969 10.6832 10.1606 10.7947 13.0966 8.61453 12.8323 13.4765 10.108 10.8745 8.5547 9.89946 10.3154 10.9443 9.90662 10.9622 12.8861 10.6022 11.0623 10.4943 12.2133 12.0506 10.0678 10.4542 10.4936 9.40952 8.59727 12.1891 9.53366 8.67705 8.96076 10.3436 10.3895 9.25571 A0A0B8RTE4 A0A0B8RTE4_PIG Serine/threonine-protein kinase OSR1 (EC 2.7.11.1) (Oxidative stress-responsive 1 protein) OXSR1 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] cytoplasm [GO:0005737] ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674] ADIWSFGITAIELATGAAPYHK 0.97104 175.86 11.3802 10.2579 12.9009 8.73671 10.9112 12.4259 9.53858 12.2159 12.6837 7.67299 10.9959 11.2163 11.7707 10.0732 13.6432 10.6601 11.3677 11.1992 7.12949 13.3624 10.8345 9.74927 12.2461 10.6474 11.6895 10.6663 0 8.38167 13.2307 9.97799 14.0479 9.53504 10.6808 13.1701 13.4415 8.76527 13.1289 8.54059 9.31567 10.7863 9.25838 0 7.48969 10.4056 12.2119 9.00829 12.7526 9.84753 5.37274 9.78789 3.56645 7.86102 12.2597 10.0402 0 0 5.82347 10.0258 0 0 10.1984 0 8.83045 A0A0B8RTE6 A0A0B8RTE6_PIG Optineurin OPTN Sus scrofa domesticus (domestic pig) autophagosome [GO:0005776]; Golgi apparatus [GO:0005794]; perinuclear region of cytoplasm [GO:0048471]; recycling endosome [GO:0055037] K63-linked polyubiquitin modification-dependent protein binding [GO:0070530]; metal ion binding [GO:0046872] ADLLGIVSELQLK 1.2929 323.31 12.6632 9.15267 10.7669 12.3944 13.6944 12.6723 10.9214 12.9458 12.4801 10.6095 10.7268 10.6832 12.194 12.0307 9.60409 11.5754 12.4991 11.9914 12.745 9.66251 10.6422 13.1944 12.1643 12.2645 9.68832 9.33033 10.0285 4.5109 12.0642 14.1967 9.67705 13.782 12.6866 8.53862 8.18413 10.0802 12.329 12.5076 9.36183 9.09748 11.299 10.706 12.7795 12.2704 9.71836 13.7039 12.9737 11.599 11.8772 11.5975 7.66007 10.9664 8.17158 10.8067 8.90896 9.64854 11.9837 8.86053 9.15015 8.78391 6.63174 10.7336 10.7198 A0A0B8RTE8 A0A0B8RTE8_PIG Nucleoporin 88kDa NUP88 Sus scrofa domesticus (domestic pig) mRNA transport [GO:0051028]; protein transport [GO:0015031]; ribosomal large subunit export from nucleus [GO:0000055]; ribosomal small subunit export from nucleus [GO:0000056] nuclear pore [GO:0005643] structural constituent of nuclear pore [GO:0017056] ATQVFREQYILK 0.96629 268.77 10.9019 8.38509 8.66142 10.6748 11.7314 9.94304 8.68068 8.43421 11.9004 12.9993 7.00798 9.44228 10.0721 10.2222 10.1015 10.7974 9.16294 10.4061 8.45533 8.91148 8.12975 10.5755 10.9821 6.45506 10.4927 9.1558 10.7848 9.55373 10.214 10.9526 8.80581 10.3423 11.6002 10.3717 0 9.91897 10.6338 10.6807 10.602 8.99461 8.19471 10.2222 10.3932 11.0007 10.2969 8.81583 9.71106 10.3915 10.2834 10.0351 12.8084 9.94736 8.7448 0 7.43388 6.08494 0 3.51058 4.24846 5.3477 9.11801 9.42813 0 A0A0B8RTF0 A0A0B8RTF0_PIG Negative regulator of ubiquitin-like proteins 1 NUB1 Sus scrofa domesticus (domestic pig) AEMVVDPETTPYLDIANQTGR 0.96757 260.64 10.1114 11.1795 11.724 11.5147 14.3958 7.88307 10.3385 12.8578 9.07235 12.653 7.5812 8.76544 12.2015 14.4959 11.1182 14.3951 13.2208 10.6745 5.96913 10.4527 8.08889 14.4505 14.1113 14.4048 12.8819 12.1139 11.6023 10.0176 12.5909 11.1264 9.1921 10.9616 12.7216 12.4069 9.6341 9.40697 10.9839 9.30551 10.359 9.84386 8.04881 10.0175 9.55317 9.62753 10.0869 9.60855 0 8.43229 9.87652 12.2911 10.3069 9.80009 8.1205 9.74288 11.0562 11.9131 9.06329 8.80645 4.99779 9.02708 6.24298 6.76461 10.8183 A0A0B8RTF2 A0A0B8RTF2_PIG Nuclear receptor subfamily 2 group C member 1 NR2C1 Sus scrofa domesticus (domestic pig) PML body [GO:0016605] DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270] AESCQGDLSTLASVVTSLANLGK 0.93793 238.99 4.20711 9.72494 8.4345 11.0094 9.83779 12.825 12.5769 10.6942 12.1133 10.5763 9.56356 10.5238 7.96128 10.4708 10.8011 0 10.5803 10.1197 11.7575 10.0426 11.12 7.0705 9.18051 11.3206 9.9053 8.4028 8.99067 10.036 9.79829 7.25333 8.63637 7.41049 0 7.6164 8.06021 7.57713 6.6844 10.0139 9.10326 7.20447 9.74307 9.54423 8.15081 10.8151 10.2549 7.67983 8.59115 6.32661 8.81551 8.4837 9.30003 8.70473 0 11.149 3.92543 8.01575 8.54288 7.73654 4.62813 10.269 9.0676 9.44276 7.0994 A0A0B8RTF4 A0A0B8RTF4_PIG Nucleolar protein 8 NOL8 Sus scrofa domesticus (domestic pig) nucleolus [GO:0005730] RNA binding [GO:0003723] AGQKLMDLQSHFGTDDR 1.3403 323.31 12.2118 12.7444 12.3462 12.6899 13.9177 12.6809 14.2552 13.0453 12.2583 13.3836 11.7628 13.1821 13.4817 12.7302 12.5627 12.7889 13.3753 13.392 12.2799 14.3132 13.7206 13.4247 13.7124 12.7192 14.129 13.5936 13.4211 13.6061 12.5098 13.0038 12.7862 12.8602 13.7807 11.2878 11.8839 12.6134 12.6187 13.477 13.182 11.9473 12.9691 12.3866 11.8915 11.8117 12.4425 13.5343 10.3783 12.5199 13.0816 13.3711 12.1348 12.1695 11.3995 12.6774 12.3644 12.2786 12.7747 11.2629 10.8852 11.4504 9.74848 10.7714 9.60318 A0A0B8RTF5 A0A0B8RTF5_PIG "Endoplasmic reticulum membrane sensor NFE2L1 (Nuclear factor erythroid 2-related factor 1) (Nuclear factor, erythroid derived 2, like 1)" NFE2L1 Sus scrofa domesticus (domestic pig) cholesterol metabolic process [GO:0008203]; regulation of transcription by RNA polymerase II [GO:0006357] endoplasmic reticulum membrane [GO:0005789]; nucleus [GO:0005634] DNA-binding transcription factor activity [GO:0003700]; lipid binding [GO:0008289]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978] AMKIPFTNDK 0.96235 174.9 0 9.73927 11.1144 9.85028 7.60696 10.7921 7.13371 12.33 12.2212 8.63107 13.707 8.7496 7.5672 10.6375 11.3254 7.96653 4.61947 12.3237 7.8916 9.67927 10.7823 7.70162 10.315 12.326 9.77803 0 7.93186 12.519 6.852 9.00357 7.78313 10.3196 10.0188 10.7881 10.8129 10.2623 13.5432 10.0293 8.86573 9.10538 5.8249 8.29747 8.0227 10.6917 9.88754 8.16792 9.41162 0 8.83924 9.53988 0 9.048 5.30064 10.1706 7.62768 4.74991 6.50816 6.33416 7.93428 9.6702 8.64778 6.79935 5.79989 A0A0B8RTF7 A0A0B8RTF7_PIG "Neutrophil cytosolic factor 4, 40kDa" NCF4 Sus scrofa domesticus (domestic pig) phagocytosis [GO:0006909]; respiratory burst [GO:0045730] NADPH oxidase complex [GO:0043020] phosphatidylinositol binding [GO:0035091]; superoxide-generating NADPH oxidase activator activity [GO:0016176] AEALFDFTGNSK 0.98107 191.13 7.35341 10.18 9.8862 0 11.14 11.1149 13.3436 10.9783 5.23327 11.4678 12.3356 12.8273 11.7013 9.16204 13.6026 11.7118 9.1814 11.4856 9.5901 10.2408 9.95751 12.9693 12.187 11.092 13.2438 10.766 10.5157 0 7.88953 9.21444 5.25769 12.9276 10.5596 8.84065 9.38991 0 5.84905 9.45951 7.1632 8.33266 9.27598 11.2758 12.0324 0 8.60618 5.19432 9.38894 4.322 0 10.6011 10.3582 7.63916 8.90268 0 4.81414 6.33816 10.9393 5.31615 7.39412 9.90856 8.40837 10.3898 10.5562 A0A0B8RTF9 A0A0B8RTF9_PIG Glutamine-dependent NAD(+) synthetase (EC 6.3.5.1) (NAD(+) synthase [glutamine-hydrolyzing]) NADSYN1 Sus scrofa domesticus (domestic pig) NAD biosynthetic process [GO:0009435] cytoplasm [GO:0005737] ATP binding [GO:0005524]; glutaminase activity [GO:0004359]; NAD+ synthase (glutamine-hydrolyzing) activity [GO:0003952] AFVQLCR 0.96533 259.47 12.8887 8.83782 12.999 9.58913 9.59365 11.0036 11.7281 11.5178 11.6546 12.2217 11.0355 9.93946 11.5324 0 12.9895 6.72124 11.196 11.7719 11.1117 10.8707 12.4846 12.6099 13.4498 13.8656 10.7724 9.83223 11.2917 11.0307 0 8.33248 9.09979 11.3781 0 8.85162 11.4405 10.102 9.61574 3.02875 10.1109 0 9.96288 8.96749 6.4306 9.55503 11.3274 8.81272 7.34997 8.77096 10.5806 10.1049 13.0932 0 8.83188 8.63172 7.76759 9.81922 9.02989 7.2867 0 10.6613 9.66811 11.9762 8.04363 A0A0B8RTG1 A0A0B8RTG1_PIG Unconventional myosin-Id MYO1D Sus scrofa domesticus (domestic pig) protein transport [GO:0015031] cell cortex [GO:0005938]; dendrite [GO:0030425]; early endosome [GO:0005769]; myosin complex [GO:0016459]; perikaryon [GO:0043204] actin binding [GO:0003779]; ATP binding [GO:0005524]; cytoskeletal motor activity [GO:0003774] ADFVLMDTVSMPEFMANLR 1.3545 323.31 13.2881 11.3313 12.0038 11.8288 13.2353 12.2864 11.2885 12.7478 11.7935 12.5518 10.9109 10.6587 12.016 12.6268 13.4974 11.8499 12.2853 11.6148 12.059 10.1836 11.2404 10.8157 12.0784 13.0299 10.4611 10.3862 11.8883 11.6004 10.8789 10.193 10.4071 11.461 13.2761 12.1324 10.6159 10.7697 12.207 12.6721 12.2973 11.3927 11.1527 11.3736 11.9352 12.6269 11.7523 9.08186 12.0142 10.2161 9.95886 12.0903 13.4615 10.2739 11.363 8.04314 10.4491 10.5638 9.90473 10.2516 10.804 9.62352 9.95625 10.4937 9.1364 A0A0B8RTG3 A0A0B8RTG3_PIG Mitochondrial ribosome-associated GTPase 2 MTG2 Sus scrofa domesticus (domestic pig) ribosome biogenesis [GO:0042254] GTP binding [GO:0005525]; GTPase activity [GO:0003924]; magnesium ion binding [GO:0000287] AELEMYEPGLSR 0.96739 177.83 9.52178 12.013 7.21374 9.2115 0 7.73071 8.83292 7.87584 10.0662 10.2739 8.81992 10.4648 8.83744 10.916 9.59688 8.22057 0 10.021 9.44586 9.32845 8.3756 7.89203 0 9.28935 9.21432 8.04521 8.9498 9.4516 0 0 7.79571 9.20728 8.20594 7.64292 0 8.83684 0 9.32634 8.08327 8.63467 6.40207 7.84518 9.82599 7.18785 8.98692 8.44601 8.84959 7.92855 0 10.794 0 8.64965 7.99226 8.86493 8.57005 7.36361 0 7.99135 8.70404 6.90231 8.62388 8.47521 8.51716 A0A0B8RTG5 A0A0B8RTG5_PIG Matrix metallopeptidase 19 MMP19 Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] extracellular matrix [GO:0031012] metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270] AALLQAFQYWSNVAPLTFR 0.95064 203.65 10.872 10.0076 9.98797 8.63281 12.6963 12.6381 12.757 11.9322 12.8312 13.2135 12.3428 10.9497 11.3435 12.8182 10.1898 10.621 12.5287 12.5527 10.0479 11.2408 10.9465 12.7869 11.236 10.3458 8.89833 10.5568 10.1459 0 11.3875 10.2681 11.3627 11.0602 11.8271 8.09128 8.0242 9.75744 10.341 9.63483 10.9457 0 9.14647 11.355 9.84748 9.78485 10.3133 9.19143 9.26101 12.5125 9.73142 10.2366 0 10.1035 8.06253 8.15406 10.6359 9.92779 4.91236 9.86561 9.33776 10.7267 9.44553 9.85871 9.9104 A0A0B8RTG7 A0A0B8RTG7_PIG Protein MIS12 homolog MIS12 Sus scrofa domesticus (domestic pig) cell division [GO:0051301]; mitotic cell cycle [GO:0000278] kinetochore [GO:0000776]; nucleus [GO:0005634] CTEKFLCFMK 0.96014 108.27 5.92965 0 1.55969 0 8.45179 0 10.6531 0 11.7297 10.5486 7.06706 5.14176 10.9759 10.9405 0 0 9.0917 11.0202 10.917 4.37372 0 10.8647 0 9.6326 10.3349 4.38066 4.48536 10.5287 8.98485 9.0739 0 0 0 0 7.79682 7.46752 8.74584 0 9.15114 10.5743 0 8.16506 0 0 9.36591 0 8.01553 0 8.60415 5.35322 0 0 0 8.38016 0 10.2716 8.47509 3.27325 6.13256 0 7.77643 0 0 A0A0B8RTG9 A0A0B8RTG9_PIG tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (Methyltransferase-like protein 1) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) METTL1 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] tRNA (guanine(46)-N7)-methyltransferase activity [GO:0008176]; tRNA binding [GO:0000049] AAPGGGFQNIACLR 0.96015 97.712 12.5136 0 13.1733 0 6.1503 10.1326 6.51548 0 11.9969 11.7998 11.9261 6.33564 13.3786 0 12.1988 9.93121 11.8277 12.0014 7.44948 6.43294 11.9948 5.81875 6.15642 0 0 7.11676 0 11.5182 11.6599 0 0 11.8761 0 6.60036 11.621 11.4938 11.7689 11.9663 11.8657 9.16689 0 0 0 8.90884 0 0 11.5637 0 0 0 10.9093 0 0 0 5.35928 10.9216 9.01374 0 0 0 9.6847 0 0 A0A0B8RTH1 A0A0B8RTH1_PIG MAU2 chromatid cohesion factor homolog (Cohesin loading complex subunit SCC4 homolog) MAU2 Sus scrofa domesticus (domestic pig) cell division [GO:0051301]; chromosome segregation [GO:0007059]; mitotic sister chromatid cohesion [GO:0007064] nucleoplasm [GO:0005654] AAAFYVRGLFSFFQGR 0.96756 81.067 8.00692 7.46736 7.9238 13.7911 13.3689 9.33051 9.6732 13.2679 13.1291 12.3039 7.18319 7.56826 0 0 0 8.5622 13.3462 13.0778 13.0108 0 5.05671 6.95268 13.5375 0 0 12.518 10.346 7.09656 6.68314 7.24174 7.22072 7.48067 7.46655 0 0 0 0 10.0378 7.00865 0 0 6.28672 7.39832 0 9.98314 7.35385 6.97338 8.35346 0 5.88828 0 0 10.0947 8.91692 8.46952 7.55735 7.57024 5.76861 0 6.30009 0 0 0 A0A0B8RTH4 A0A0B8RTH4_PIG non-specific serine/threonine protein kinase (EC 2.7.11.1) MAP4K1 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; MAP kinase kinase kinase kinase activity [GO:0008349]; protein serine kinase activity [GO:0106310] AGNPIAHISPHRLLARK 0.91739 232.11 11.6727 10.8955 12.507 11.9241 10.4353 10.1396 10.6597 13.6055 10.9935 12.2481 10.23 13.1749 8.81925 10.5247 12.1025 10.2211 11.7474 8.97022 10.2719 8.92249 12.1219 8.53819 10.7442 7.56453 7.57758 8.62428 8.78696 8.80113 13.5821 10.3326 8.80071 11.2655 8.93817 7.9465 9.85201 0 7.79318 9.21721 8.96498 9.37955 13.9944 7.76115 12.3886 6.15224 9.40278 9.10617 0 9.41039 10.1609 10.2818 9.3144 10.1267 9.71942 10.7292 5.58637 11.507 9.36254 7.03507 8.01926 5.20402 7.66235 9.27566 7.93764 A0A0B8RTH6 A0A0B8RTH6_PIG "Mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase" MAP3K1 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; zinc ion binding [GO:0008270] AAQQQTTQQHPLAGSQR 1.369 323.31 9.54984 10.8076 11.5464 12.7115 13.7121 12.8432 12.3165 10.2982 12.9375 11.9403 11.3642 10.9644 13.6382 12.4989 12.2696 12.4521 11.3039 13.6325 11.4838 6.69919 11.2495 10.8454 10.5814 13.2584 10.2304 11.0872 11.4594 11.4802 11.8065 11.9323 12.4328 12.3685 12.275 12.1715 12.2689 12.0316 10.4298 13.5547 12.8971 10.021 10.1528 10.6853 10.2729 10.5186 8.8683 11.5444 12.4879 9.26221 12.7489 11.0619 12.1065 10.1353 10.0032 6.57313 10.0546 11.1765 10.4396 8.79743 9.20092 6.90147 8.14939 7.9755 8.91851 A0A0B8RTH9 A0A0B8RTH9_PIG Acyl-protein thioesterase 1 (EC 3.1.2.22) (Lysophospholipase 1) (Lysophospholipase I) (Palmitoyl-protein hydrolase) LYPLA1 Sus scrofa domesticus (domestic pig) endoplasmic reticulum [GO:0005783]; nuclear membrane [GO:0031965]; plasma membrane [GO:0005886] hydrolase activity [GO:0016787] LAGVTALSCWLPLR 0.9985 23.376 0 0 0 0 0 0 8.34868 7.92386 0 0 0 0 0 0 7.11572 6.89676 0 7.55136 0 0 0 0 9.14193 0 0 0 0 0 0 0 8.34136 0 0 0 0 0 6.60389 0 0 0 7.53317 0 0 0 0 7.42509 7.25096 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A0B8RTI1 A0A0B8RTI1_PIG non-specific serine/threonine protein kinase (EC 2.7.11.1) LRRK1 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310]; regulation of signal transduction [GO:0009966] cytoplasm [GO:0005737]; organelle [GO:0043226] ATP binding [GO:0005524]; GTP binding [GO:0005525]; protein serine/threonine kinase activity [GO:0004674] AEDLRMLLVGTGFTKQTEEQYFQFLAK 1.3763 323.31 13.5036 12.037 13.5021 12.5396 13.648 13.3022 14.8095 13.7566 12.7793 14.9551 12.9778 11.2386 14.3341 14.44 12.5123 12.2305 11.3619 11.0713 12.2418 13.5275 11.9696 12.1002 13.0538 14.4968 12.6795 11.5285 13.4886 12.5672 12.1254 11.1573 11.7762 13.6526 13.183 12.4513 12.6825 11.6873 11.7339 12.2901 11.7944 12.5846 11.2784 9.46103 12.356 11.5618 12.219 13.6697 9.1918 12.3878 12.3635 12.0301 12.7552 11.2151 13.0523 12.4092 10.8103 11.1352 11.899 11.0501 9.68066 11.8115 10.3646 10.8336 10.8887 A0A0B8RTI4 A0A0B8RTI4_PIG "LPS-responsive vesicle trafficking, beach and anchor containing" LRBA Sus scrofa domesticus (domestic pig) AAASVSVSK 1.3913 323.31 15.8065 16.1925 16.9823 13.6196 12.5323 17.0193 16.7197 17.3399 17.4253 16.7823 17.3822 12.4583 16.9719 17.6885 12.4844 17.4773 17.4413 17.3864 17.6632 11.9154 16.8921 14.2398 17.0807 16.8936 17.4329 17.0864 16.6839 16.732 10.9277 17.2161 17.5632 17.5419 17.5605 12.4288 17.1135 16.7197 17.6321 17.0561 17.454 16.3303 16.2078 15.1072 11.5047 15.3102 15.0723 12.6905 17.1965 17.1165 15.9942 16.0753 16.6561 16.1522 15.3235 16.1334 16.5717 16.0151 16.7375 16.1994 14.9113 11.3679 10.0584 10.7087 9.49424 A0A0B8RTI6 A0A0B8RTI6_PIG Leucyl/cystinyl aminopeptidase LNPEP Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] membrane [GO:0016020] aminopeptidase activity [GO:0004177]; metallopeptidase activity [GO:0008237]; zinc ion binding [GO:0008270] AFDLIDYLR 1.2549 323.31 9.99195 10.5356 9.83892 10.6962 10.747 13.1972 6.07519 10.6281 11.7092 9.55844 10.9591 11.8596 12.1565 10.8338 11.0074 10.1819 11.8912 10.4298 9.30504 7.20163 11.379 10.9506 10.4896 8.32432 10.6004 9.36634 10.3089 12.1529 7.96365 10.4473 10.57 10.4637 9.64396 6.20099 11.3086 9.36599 9.80676 10.7277 0 6.42623 10.578 0 9.86709 11.6325 10.876 11.0399 11.8073 9.60524 10.3779 6.33466 0 8.74648 9.55363 8.61239 10.603 11.5658 10.8724 10.3862 8.52368 9.32249 0 0 0 A0A0B8RTI7 A0A0B8RTI7_PIG Galectin LGALS9 Sus scrofa domesticus (domestic pig) carbohydrate binding [GO:0030246] DNDIAFHFNPR 0.97236 91.629 6.04157 0 9.85001 8.72216 8.87532 0 7.91904 9.22451 0 5.0548 0 6.88105 9.75134 9.77485 9.97556 0 0 0 7.29967 0 8.50156 0 9.83253 9.13188 0 6.45167 0 0 0 4.9357 0 9.2142 10.1645 7.68018 0 0 8.51668 0 8.66007 11.8883 11.9543 6.78725 0 0 0 0 0 0 8.40761 7.39197 4.9313 0 7.79578 0 0 0 0 0 0 10.2804 0 9.948 10.857 A0A0B8RTI9 A0A0B8RTI9_PIG Importin subunit alpha KPNA1 Sus scrofa domesticus (domestic pig) protein import into nucleus [GO:0006606] cytoplasm [GO:0005737] nuclear import signal receptor activity [GO:0061608] EAAWAITNATSGGSAEQIK 0.95793 146.97 9.20352 0 11.5829 11.8362 8.11562 7.66803 0 10.2736 10.2882 10.6663 8.85212 10.4747 14.5326 14.5589 0 5.37664 11.7555 10.0836 10.392 6.8485 0 9.65628 6.03124 9.86782 13.3629 0 13.1281 10.451 8.78931 7.86561 0 9.37132 6.90857 0 11.4401 8.54419 5.32751 9.86563 0 6.19432 9.0329 10.1945 15.1588 15.5517 15.2889 9.16232 10.5276 10.8095 8.41426 11.7015 4.28518 11.2392 11.8903 6.58949 5.88662 9.91442 7.22603 10.991 10.9385 7.94199 5.66656 0 11.8732 A0A0B8RTJ2 A0A0B8RTJ2_PIG Kinesin light chain KLC4 Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737]; kinesin complex [GO:0005871]; microtubule [GO:0005874] AASLNYLNQPNATPLQVSR 0.9419 284.25 9.0885 11.4949 9.75051 11.1575 12.6704 10.2622 9.6395 12.7443 10.7201 10.4125 9.65428 10.0167 11.9755 12.0602 9.72649 12.3354 9.88611 7.99056 10.1396 10.4319 12.1344 6.5725 11.7323 10.9526 12.1391 13.099 9.88902 9.92665 10.4317 10.4625 9.53181 11.9642 10.9332 10.2037 10.4833 7.29158 13.7859 9.63225 10.1268 8.45306 7.40786 8.08343 10.7558 9.91849 5.47839 8.23002 10.6344 11.4637 12.9675 12.726 11.3933 8.44298 5.20582 0 7.72342 6.98755 9.20455 0 9.6942 7.94983 10.1805 6.9222 7.53411 A0A0B8RTJ4 A0A0B8RTJ4_PIG ribonuclease P (EC 3.1.26.5) KIAA0391 Sus scrofa domesticus (domestic pig) tRNA processing [GO:0008033] mitochondrion [GO:0005739] metal ion binding [GO:0046872]; ribonuclease P activity [GO:0004526] ACLPDAK 0.96886 307.55 7.26987 8.47504 11.1956 11.6977 8.42337 12.3731 13.6281 12.865 13.3639 10.1704 9.9747 12.627 13.1358 11.6833 11.4738 8.50946 9.70435 11.7914 10.538 11.1244 5.05892 11.3092 13.8618 13.2435 11.8889 9.51692 10.2563 11.9751 10.988 9.65725 11.3183 9.79841 12.9946 8.04887 8.96688 0 10.4523 10.5686 10.3955 10.3225 9.49448 9.74811 7.11437 9.26306 10.5454 7.32184 8.16937 7.29186 8.65871 10.5439 8.675 2.52411 6.99447 6.29046 10.2745 7.95158 9.361 8.848 9.57154 7.04253 8.95274 9.07117 0 A0A0B8RTJ6 A0A0B8RTJ6_PIG [histone H3]-trimethyl-L-lysine(27) demethylase (EC 1.14.11.68) KDM6A Sus scrofa domesticus (domestic pig) methylation [GO:0032259] nucleus [GO:0005634] histone demethylase activity [GO:0032452]; metal ion binding [GO:0046872]; methyltransferase activity [GO:0008168]; oxidoreductase activity [GO:0016491] AFQEVLYVDPSFCR 0.9697 323.31 8.59976 10.9956 12.2245 11.7875 11.5724 12.1804 13.0272 14.115 12.0994 12.6815 10.9346 12.1008 11.0006 11.7762 13.6455 14.032 11.5783 14.0563 9.59419 11.2807 8.30788 12.1335 11.2545 9.91391 8.17318 10.1852 10.351 10.9263 12.0707 11.1614 10.8296 13.1487 11.6212 11.6079 11.7192 12.401 7.6756 6.16308 10.5527 9.37621 9.2814 10.5751 11.4312 12.0417 6.42898 11.8526 10.165 11.7965 10.9332 10.377 10.9313 11.0797 10.8783 9.90597 0 11.8187 8.69227 4.02237 8.05696 8.07441 8.11072 10.072 8.4266 A0A0B8RTJ8 A0A0B8RTJ8_PIG [histone H3]-dimethyl-L-lysine(36) demethylase (EC 1.14.11.27) KDM2B Sus scrofa domesticus (domestic pig) methylation [GO:0032259] nucleus [GO:0005634] DNA binding [GO:0003677]; histone H3K36me/H3K36me2 demethylase activity [GO:0140680]; methyltransferase activity [GO:0008168]; zinc ion binding [GO:0008270] ALVEKLESLPENK 1.0119 323.31 13.3256 13.3966 12.8671 14.5144 14.9831 14.3075 14.5366 16.1495 14.5265 14.0423 14.2825 13.785 14.3373 15.385 14.9015 14.6138 15.1668 14.6569 13.709 14.0875 14.4413 15.271 14.3825 14.2694 13.6546 12.4559 12.9643 12.8694 12.2182 12.2343 11.121 14.53 14.73 12.974 12.0678 12.5976 14.1764 12.101 12.8899 13.4708 12.7348 13.1095 12.5305 11.6111 12.1832 14.0684 12.722 14.0394 13.4695 14.449 13.7756 12.7413 12.977 13.5258 11.5012 11.1023 11.9998 11.4447 11.9254 12.667 10.2158 12.4738 11.2138 A0A0B8RTK2 A0A0B8RTK2_PIG Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 (Histone arginine demethylase JMJD6) (JmjC domain-containing protein 6) (Jumonji domain-containing protein 6) (Lysyl-hydroxylase JMJD6) (Peptide-lysine 5-dioxygenase JMJD6) (Phosphatidylserine receptor) JMJD6 Sus scrofa domesticus (domestic pig) chromatin organization [GO:0006325] nucleus [GO:0005634] metal ion binding [GO:0046872] ADALQLSVEEFVER 0.96745 137.4 6.96832 10.4631 0 0 8.27352 11.0271 0 9.46948 8.85337 7.84499 5.68941 9.34512 0 9.48758 10.7129 10.1665 10.2768 7.83289 0 8.95312 12.8336 7.17702 7.65871 7.03892 4.44606 7.95385 8.50247 7.87725 4.16479 7.70418 0 13.1489 9.15699 11.107 8.00056 9.33336 2.92539 7.69877 11.903 12.0408 0 6.73593 3.66903 10.6431 11.1529 11.0229 11.5719 9.54747 7.30012 8.50613 5.85781 8.11317 7.47184 0 6.32984 0 4.96542 7.07211 0 4.5174 0 10.4928 10.5265 A0A0B8RTK5 A0A0B8RTK5_PIG Integrin alpha FG-GAP repeat containing 1 ITFG1 Sus scrofa domesticus (domestic pig) integrin-mediated signaling pathway [GO:0007229] membrane [GO:0016020] DVLLTYLPR 0.96694 73.844 0 7.08948 0 8.81893 9.85548 9.97699 2.80696 0 0 0 0 6.88056 9.3818 0 0 6.98242 7.89342 10.4126 0 5.95513 9.03122 13.3115 9.8014 6.49446 8.58871 13.2457 0 8.50692 0 0 10.2886 9.85242 9.20279 0 5.83335 0 9.36999 0 7.57039 0 8.30223 9.23702 8.44249 8.39729 0 0 7.96844 0 8.70619 8.69439 9.03606 8.43596 7.39257 0 0 0 9.1171 0 0 7.96895 0 0 8.19121 A0A0B8RTK7 A0A0B8RTK7_PIG Importin 9 IPO9 Sus scrofa domesticus (domestic pig) protein transport [GO:0015031] nucleus [GO:0005634] AAKNPER 0.95607 129.92 8.21893 0 6.51163 9.24885 10.6406 11.8428 11.9853 8.07916 9.97169 9.89791 8.8967 10.599 10.4333 10.7577 10.8483 10.1726 8.82069 0 9.18861 10.3065 8.59048 10.162 10.2444 12.2453 8.6014 7.42459 6.14445 8.83501 10.3537 8.65818 9.10549 8.02536 10.3577 9.37045 9.39712 7.01759 8.01959 7.95478 0 8.15137 8.61578 0 10.0523 9.30369 9.01631 7.04024 0 4.84935 7.72772 8.0242 10.2586 0 7.41337 0 0 10.9866 7.36851 0 0 0 0 0 0 A0A0B8RTK9 A0A0B8RTK9_PIG "Interleukin 2 receptor, gamma" IL2RG Sus scrofa domesticus (domestic pig) membrane [GO:0016020] cytokine receptor activity [GO:0004896] DRSWTEQSVDHR 0.96439 116.55 7.61294 0 8.18597 9.36525 11.3223 9.85234 5.17425 6.80206 9.9288 0 7.97877 6.69042 8.05924 9.78452 10.9424 9.42681 9.69652 9.65489 8.3539 6.11691 9.34906 9.06447 11.593 7.56613 5.54303 9.08433 10.7398 8.69084 6.8622 8.29948 7.42299 0 10.2133 10.4856 7.94533 3.7685 8.58549 7.31976 7.13042 0 5.29976 0 10.3376 10.6359 9.75716 10.2949 0 7.84937 6.3051 0 10.0168 8.40952 8.26983 9.88461 0 7.4746 7.14802 6.45751 7.85131 5.69897 6.14664 7.27743 0 A0A0B8RTL1 A0A0B8RTL1_PIG Inhibitor of nuclear factor kappa-B kinase subunit epsilon IKBKE Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310]; positive regulation of gene expression [GO:0010628]; response to stimulus [GO:0050896] cytoplasm [GO:0005737] ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674] CWGFDQFFAETSDILQR 0.92683 235.15 9.10753 9.28008 9.71392 10.4407 11.5606 9.74315 8.98374 11.8874 11.0597 10.0654 8.79263 11.0373 12.5792 13.1864 10.4384 9.74559 10.1557 9.50577 9.47143 10.3029 9.54846 11.3232 11.5071 9.55493 9.53241 9.72113 10.8436 8.09577 9.7981 7.93328 8.52544 9.04751 10.4054 9.66759 8.58444 10.1722 9.7287 8.55363 7.28151 9.26641 6.98982 9.45547 6.07682 8.87461 9.50549 10.0771 7.90617 6.96993 9.51157 8.87366 10.6478 0 8.54978 9.91024 9.96061 8.87 8.43871 5.1674 5.15259 8.44 8.97882 0 7.09276 A0A0B8RTL4 A0A0B8RTL4_PIG Immediate early response 3 IER3 Sus scrofa domesticus (domestic pig) negative regulation of apoptotic process [GO:0043066] APTPAPSTSPVPR 0.97773 37.653 0 9.86729 0 0 0 6.19735 6.78712 7.01525 0 10.1794 0 6.52698 11.5734 9.36422 9.02115 0 0 9.57325 0 5.56023 7.98493 7.5004 6.32191 0 0 0 4.76702 0 0 0 8.18745 0 7.33682 0 6.27029 0 0 0 0 4.12598 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6.83251 0 0 0 0 0 0 0 0 A0A0B8RTL5 A0A0B8RTL5_PIG Heterogeneous nuclear ribonucleoprotein R HNRNPR Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737]; ribonucleoprotein complex [GO:1990904] RNA binding [GO:0003723] ADGYNQPDSK 1.3264 323.31 13.1701 13.1496 13.186 14.3298 14.5813 14.3644 14.2136 12.5209 14.1635 13.9902 14.1588 13.9137 13.7307 14.0151 13.7734 14.1747 11.7065 14.0479 13.349 10.0807 13.6676 14.3664 13.9549 14.1198 13.4873 8.84087 9.77903 12.2098 12.3825 12.2536 13.6171 12.2938 13.5897 11.7352 11.7078 12.2485 13.31 12.7997 13.2513 12.1804 12.1934 12.6323 11.9668 11.9363 11.7231 12.1704 10.4127 12.2534 13.0298 13.1129 13.0713 12.4174 12.7761 12.8849 11.8131 12.1258 11.7817 11.0349 11.3284 12.2514 10.4415 11.2022 10.3996 A0A0B8RTL7 A0A0B8RTL7_PIG Homeodomain interacting protein kinase 2 HIPK2 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; DNA binding [GO:0003677]; protein kinase activity [GO:0004672] ADRREFIDLLK 0.9688 172.67 10.2908 12.9457 7.29186 9.25006 9.37071 13.2204 10.0832 9.99265 9.35672 8.94559 0 9.04903 10.8102 9.11858 14.735 10.5115 10.1845 10.4319 10.3247 8.39579 12.4755 9.27326 11.2915 13.0178 8.23357 12.885 3.91953 9.06388 10.0274 12.424 6.44346 12.0922 13.114 6.7786 10.3219 8.38909 10.1548 0 12.5727 11.9739 8.08725 11.7351 0 7.23745 0 8.10659 7.3773 12.0833 7.65105 8.16189 0 0 11.7414 0 0 4.89811 11.0973 11.1822 0 10.483 0 9.02885 4.99164 A0A0B8RTL9 A0A0B8RTL9_PIG HECT-type E3 ubiquitin transferase (EC 2.3.2.26) HERC2 Sus scrofa domesticus (domestic pig) protein ubiquitination [GO:0016567] endoplasmic reticulum [GO:0005783] ubiquitin-protein transferase activity [GO:0004842]; zinc ion binding [GO:0008270] ADFLSNDDYAVYVR 1.4066 323.31 13.7 13.0571 13.3596 15.0455 14.6755 13.5401 14.4118 14.4455 14.4119 14.5013 14.2197 13.5189 15.5791 15.72 15.2095 14.5955 14.1584 14.088 13.3795 13.0831 14.1552 14.4977 14.6387 14.5083 14.6689 13.878 14.0478 14.0686 13.0526 12.7757 13.7924 13.9875 13.4814 13.6415 13.2409 13.5897 12.8175 15.0703 13.4858 13.8996 13.9774 13.7616 18.8187 19.0633 18.9503 12.8296 14.6992 14.4636 15.3367 15.4571 13.0694 14.6044 13.2743 12.4276 15.6443 15.4306 13.2915 14.7312 14.6738 12.9241 12.4887 14.2645 14.3139 A0A0B8RTM7 A0A0B8RTM7_PIG Hepatoma-derived growth factor-related protein 2 HDGFRP2 Sus scrofa domesticus (domestic pig) DNA recombination [GO:0006310]; DNA repair [GO:0006281]; muscle organ development [GO:0007517] cytoplasm [GO:0005737]; nucleus [GO:0005634] AAEVYTR 1.5059 323.31 9.91416 10.8099 11.2423 11.6217 10.2055 9.49935 11.8206 11.6097 11.5858 11.2019 6.05265 10.4867 10.4316 11.7755 10.8251 10.1419 10.4009 9.7623 10.7056 12.2018 10.8601 13.5028 9.89754 10.0619 9.09321 9.94696 9.47039 8.15947 13.6007 12.4306 11.1927 11.3987 11.561 7.90436 9.80874 11.2289 11.1081 10.0512 8.86282 8.97851 9.01842 8.86481 9.71845 7.81147 11.4187 8.36142 11.4693 10.8868 9.87267 10.3374 9.49025 9.45771 10.1329 10.4073 10.8209 9.98939 9.84458 9.0624 8.28462 9.70461 7.85006 10.1608 7.09149 A0A0B8RTM8 A0A0B8RTM8_PIG Nucleolar GTP-binding protein 1 GTPBP4 Sus scrofa domesticus (domestic pig) ribosome biogenesis [GO:0042254] nucleolus [GO:0005730] GTP binding [GO:0005525] AAAGEYDSESDSEDEEMAEIR 1.0894 323.31 10.9772 9.46791 11.7534 11.6297 13.6527 12.5419 11.2709 12.0366 11.2154 9.87974 12.2611 12.7781 12.2387 9.71795 13.1961 10.1067 12.9719 13.174 12.5202 10.9919 10.0949 10.2603 12.3965 10.8268 8.85755 11.7487 9.78391 11.0185 10.6883 10.2675 12.5308 12.3745 10.6747 8.04286 9.88795 11.3 12.806 10.5559 11.5563 9.48041 10.3453 9.98556 9.81697 8.78179 11.7627 9.63319 11.8794 9.44727 10.7764 12.344 10.9179 9.90587 11.2747 10.4192 9.64575 10.7747 10.3898 7.13289 9.52894 7.68944 7.1372 7.21189 4.64328 A0A0B8RTM9 A0A0B8RTM9_PIG General transcription factor IIH subunit 3 (General transcription factor IIH polypeptide 3) GTF2H3 Sus scrofa domesticus (domestic pig) nucleotide-excision repair [GO:0006289]; regulation of DNA-templated transcription [GO:0006355] transcription factor TFIIH core complex [GO:0000439]; transcription factor TFIIH holo complex [GO:0005675] metal ion binding [GO:0046872] AAEDSALQYMNFMNVIFAAQK 0.96492 67.317 0 9.13568 4.06368 8.15497 9.94199 10.3773 0 0 9.65941 0 0 6.67059 0 10.6725 0 8.06372 0 6.47109 0 7.29131 0 5.78699 0 4.76484 0 6.04413 0 0 4.95308 10.7647 0 7.09244 8.34465 0 0 0 5.06927 10.3584 0 0 0 7.24422 8.00899 8.11889 6.47328 0 9.98371 3.4665 7.45878 0 0 0 0 9.56091 0 8.60622 0 0 0 0 6.03668 0 0 A0A0B8RTN0 A0A0B8RTN0_PIG Integral membrane protein GPR137B GPR137B Sus scrofa domesticus (domestic pig) membrane [GO:0016020] NPTKDLTNPGMVPSHGFGPR 0.96584 67.716 0 8.50724 9.41007 10.8109 8.30072 8.40731 8.45652 8.35522 11.234 11.1928 8.93325 0 6.21888 0 5.35156 9.39821 0 8.96728 0 9.27626 7.8247 0 8.12603 8.31624 7.52599 9.04081 7.83523 8.08958 8.68874 8.71939 0 8.92211 8.00101 0 0 10.8487 0 8.81452 0 7.30606 8.4261 0 6.6872 0 6.38521 0 8.14939 6.45012 7.34287 0 7.33289 8.64288 0 6.98527 0 0 7.44344 0 5.03007 0 0 6.1314 0 A0A0B8RTN1 A0A0B8RTN1_PIG G patch domain containing 1 GPATCH1 Sus scrofa domesticus (domestic pig) macromolecule metabolic process [GO:0043170]; nitrogen compound metabolic process [GO:0006807]; primary metabolic process [GO:0044238] nucleic acid binding [GO:0003676] AIFASSSDEKSSSSEDEQGDSEDDQEGTR 1.219 323.31 13.0681 11.5466 12.2427 11.8587 14.3571 12.1061 13.3836 14.7855 14.3107 12.2963 13.0211 13.1595 14.4021 14.3923 14.2452 13.5969 14.7143 10.3352 12.6224 13.3498 13.6537 14.3467 14.0211 12.0277 12.0191 11.5695 12.2878 11.824 9.56527 12.0537 12.6958 14.0146 12.6234 9.62434 10.1787 10.1628 11.1745 12.789 8.95513 10.9953 10.576 10.8119 7.84656 11.035 11.5366 12.1452 11.2553 12.0533 9.87495 12.0073 12.3838 11.2059 7.79487 10.8918 8.98031 11.7696 10.4535 8.75322 11.1852 10.0642 8.65807 8.93929 9.64636 A0A0B8RTN3 A0A0B8RTN3_PIG N-acetylglucosamine-1-phosphate transferase alpha and beta subunits GNPTAB Sus scrofa domesticus (domestic pig) membrane [GO:0016020] "calcium ion binding [GO:0005509]; transferase activity, transferring phosphorus-containing groups [GO:0016772]" ACNNSACDWDGGDCSGNSGGSR 1.2019 323.31 11.8295 10.9609 11.9529 13.8357 13.6126 13.5808 13.5416 11.3424 13.4437 11.5621 12.1894 12.0574 14.9813 13.1402 11.8481 12.1252 12.9219 11.9728 11.6441 11.0994 11.4304 12.3783 11.9681 13.5227 10.7932 10.9043 9.53947 10.3338 10.3585 11.0242 11.7279 12.586 12.2354 11.2623 11.2283 9.29705 10.7947 11.304 9.05859 10.6588 10.4751 12.204 10.6662 11.7175 10.8552 10.6614 11.3379 13.0991 12.2146 12.8648 11.3751 9.37487 9.98042 9.71148 11.2279 11.304 10.5839 10.3079 9.14743 10.3145 8.96806 9.56739 8.91776 A0A0B8RTN5 A0A0B8RTN5_PIG Lactoylglutathione lyase (EC 4.4.1.5) (Glyoxalase I) GLO1 Sus scrofa domesticus (domestic pig) lactoylglutathione lyase activity [GO:0004462]; metal ion binding [GO:0046872] AAWAFSR 0.95996 112.36 9.89055 10.3058 10.2732 10.3759 9.51357 10.7723 10.6397 11.4023 13.1867 9.26608 10.6277 7.17063 9.84718 9.91989 0 9.18861 7.96769 9.55265 8.58026 9.47182 7.69558 0 10.6054 4.99372 8.67934 7.99022 0 9.29317 7.15431 8.90755 11.4816 9.63212 0 9.60105 9.32438 10.6606 10.8827 8.55493 8.9273 9.24567 0 10.4252 9.91195 8.49109 8.27286 10.1223 6.54592 7.28096 8.58613 0 7.96469 0 10.0192 0 8.21946 7.99418 8.90406 6.41126 0 8.34758 0 7.13175 0 A0A0B8RTN6 A0A0B8RTN6_PIG "GTPase, IMAP family member 8" GIMAP8 Sus scrofa domesticus (domestic pig) GTP binding [GO:0005525] AAGWEQNPGPWALK 1.1743 323.31 10.6781 9.10682 9.86364 11.4158 10.638 14.0782 7.9859 11.899 12.7778 8.20247 9.23475 10.0156 12.86 12.6208 12.05 11.2391 10.296 10.9672 8.46328 12.0638 8.90911 12.0889 9.75425 11.6456 8.89542 11.2194 9.4143 10.789 7.50898 12.2612 11.1747 10.6994 10.2784 8.50843 9.91718 10.7071 12.0322 9.46303 8.84759 8.49005 0 5.0657 8.25734 9.65426 10.3227 0 0 2.7118 7.82267 6.98778 10.3048 7.19741 0 5.11865 9.37879 8.81689 7.83226 9.8738 8.56491 0 5.50487 8.35147 9.70299 A0A0B8RTN9 A0A0B8RTN9_PIG Lysosomal alpha-glucosidase (EC 3.2.1.20) (Acid maltase) GAA Sus scrofa domesticus (domestic pig) carbohydrate metabolic process [GO:0005975] lysosomal membrane [GO:0005765] alpha-glucosidase activity [GO:0090599]; carbohydrate binding [GO:0030246] AITQEQCEAR 0.95499 148.92 9.85723 11.1577 6.10022 7.45459 11.2101 7.83838 0 7.17752 12.1969 12.3759 6.65735 9.22682 9.10627 10.9699 9.02012 6.69613 11.5895 6.31067 10.8677 0 0 6.12253 10.7382 12.9063 9.86655 8.64382 7.49041 11.6097 10.0088 10.4268 0 11.4128 10.8399 8.52603 8.83804 8.41899 11.8541 0 12.1173 11.1893 0 0 6.73227 9.12371 11.2893 10.5324 0 0 0 0 6.42267 8.81513 0 9.6422 0 0 5.90843 4.99209 5.70385 0 5.47729 0 0 A0A0B8RTP1 A0A0B8RTP1_PIG FRY-like FRYL Sus scrofa domesticus (domestic pig) cell morphogenesis [GO:0000902] AADSSRSIYEVAMQLLQILEPKMFR 1.2133 323.31 12.946 11.936 13.2167 13.8427 14.4659 14.2079 14.9348 14.653 14.5368 14.2836 12.0475 13.4987 15.4045 12.1981 14.5821 11.5452 13.4038 13.0551 11.7655 13.5 14.7466 13.5716 13.0842 14.0083 11.9465 11.3697 13.3576 15.7939 12.607 13.5694 14.3154 14.817 14.8882 13.4239 12.2598 12.2283 9.52131 13.5258 13.0053 11.7854 11.9356 13.1936 12.4051 12.5181 11.3687 12.9842 12.7189 10.7125 14.7664 13.78 13.7501 12.0152 12.1251 12.3016 10.6526 11.2077 12.2858 10.7362 12.4697 11.2977 11.6851 10.41 11.4121 A0A0B8RTP4 A0A0B8RTP4_PIG Leucine-rich repeat flightless-interacting protein 1 FLII Sus scrofa domesticus (domestic pig) actin filament binding [GO:0051015] AAALKLGQELCGMLHRPR 1.0667 323.31 10.4545 12.2995 12.3601 10.642 12.2836 11.7864 12.5083 12.077 11.2613 11.3916 12.0289 11.8427 13.7248 10.7551 12.5719 13.1043 11.102 9.75042 12.6369 12.364 11.2361 11.889 13.3249 12.9917 11.4915 9.71382 10.6814 10.8338 13.2214 11.6707 13.0316 9.70833 12.4702 10.6591 10.7346 11.7348 13.7817 10.1972 9.10148 9.31148 12.7497 9.68596 11.7271 11.5415 8.46177 11.7021 10.3852 9.50714 12.0435 13.1083 13.2173 10.5777 12.4465 12.3916 10.1616 10.4936 12.9405 9.84817 7.63423 9.71973 5.86436 11.2685 10.2087 A0A0B8RTP6 A0A0B8RTP6_PIG F-box protein 33 FBXO33 Sus scrofa domesticus (domestic pig) ALSRKSTNLR 0.95805 107.16 10.3058 7.33468 0 0 9.00851 0 0 11.4818 7.13617 12.9141 9.09982 8.7862 10.2549 8.45615 10.5633 0 8.29696 7.58007 0 8.28549 6.99695 9.91947 8.66139 9.93157 6.58748 8.63081 0 6.68285 0 0 0 8.96391 7.5549 9.20894 0 8.5941 7.10497 6.6117 0 8.8042 7.48148 5.61953 7.23458 0 3.36709 7.27873 0 6.70777 6.83908 8.66042 0 7.13083 3.18968 0 7.21091 6.47926 6.3061 0 4.28836 0 12.0513 9.51745 0 A0A0B8RTP9 A0A0B8RTP9_PIG "Family with sequence similarity 96, member A" FAM96A Sus scrofa domesticus (domestic pig) chromosome segregation [GO:0007059]; protein maturation by [4Fe-4S] cluster transfer [GO:0106035] ALEVYDLIR 0.96689 61.75 0 0 0 9.34341 0 10.0275 0 0 9.71413 7.80941 0 8.58082 0 0 7.47078 9.62158 8.52074 7.61692 13.501 0 10.2694 8.1068 8.4429 9.5299 0 10.4782 9.64521 11.1469 11.5339 11.6868 11.9289 12.2578 12.2938 8.43388 0 11.3512 11.4874 0 0 6.80245 9.74002 0 0 0 9.1383 0 6.15937 0 12.3322 8.25852 7.15644 10.5688 5.67649 9.67005 0 9.34241 0 0 8.90463 7.90785 0 5.12813 0 A0A0B8RTQ2 A0A0B8RTQ2_PIG Constitutive coactivator of PPAR-gamma-like protein 2 FAM120C Sus scrofa domesticus (domestic pig) AFLACMK 0.96032 258.31 13.2623 8.85866 10.5505 11.8462 10.8678 12.0838 11.5388 12.9779 11.1292 12.7338 11.1968 12.051 11.9142 12.8033 12.4551 10.8035 10.3589 10.7334 11.1351 9.88169 9.30602 10.97 11.8951 13.796 8.99568 12.5227 9.07106 9.473 10.825 10.8045 11.5119 12.2892 10.4217 0 10.139 9.81847 10.8265 6.34255 9.56495 10.5333 9.33311 9.66993 11.5666 10.5224 10.4902 10.0467 11.66 9.26594 10.6791 9.2494 10.7946 10.6562 9.96062 10.6351 10.3102 10.9823 10.8967 9.09787 9.06191 8.71617 10.5639 10.221 10.0136 A0A0B8RTQ6 A0A0B8RTQ6_PIG Endoplasmic reticulum lectin ERLEC1 Sus scrofa domesticus (domestic pig) endoplasmic reticulum unfolded protein response [GO:0030968]; ubiquitin-dependent ERAD pathway [GO:0030433] endoplasmic reticulum lumen [GO:0005788] carbohydrate binding [GO:0030246] ALPQLSDDIPFR 0.96841 163.49 9.42145 11.0224 6.51661 0 9.18958 12.8959 12.6269 11.1044 11.2764 11.8561 6.3187 11.028 10.0109 12.0058 10.2153 5.99134 12.2034 10.3139 6.85649 7.83548 8.36606 8.58778 11.3822 7.22872 6.72397 10.08 9.66562 0 0 5.65257 9.98485 11.7788 10.6287 8.5749 8.7239 9.41481 9.14649 9.87716 10.4927 9.4871 7.64976 9.71833 9.06792 10.4174 8.97209 8.25941 10.3276 9.41314 8.96878 0 0 0 5.83066 9.78999 5.86151 8.66096 0 0 0 0 8.26782 8.46504 6.4203 A0A0B8RTQ8 A0A0B8RTQ8_PIG Elastin microfibril interfacer 2 EMILIN2 Sus scrofa domesticus (domestic pig) regulation of response to stimulus [GO:0048583] AGDGVNIVVTGGR 1.3617 323.31 12.5043 11.9918 8.39223 11.2677 12.2089 12.307 12.8611 10.6936 11.4646 12.7227 11.8542 12.5542 14.0094 12.3133 13.2193 12.3174 8.98536 10.8613 11.8086 13.6722 13.7346 11.4775 11.7915 12.2731 11.1827 11.731 12.5985 11.8129 12.0705 11.4479 12.5302 12.4502 12.1854 12.5028 10.9266 9.54017 12.1026 11.7821 12.3814 10.8188 9.3443 11.8053 9.96694 10.2703 10.3872 11.1719 11.252 11.5914 11.6421 11.2514 12.8722 9.66889 8.98707 10.4555 10.8403 9.98128 8.62311 10.5787 9.11785 7.77893 10.6663 8.77795 8.51124 A0A0B8RTR2 A0A0B8RTR2_PIG Early growth response protein EGR1 Sus scrofa domesticus (domestic pig) rhythmic process [GO:0048511] cytoplasm [GO:0005737]; nucleus [GO:0005634] DNA binding [GO:0003677]; metal ion binding [GO:0046872] AFATQSGSQDLK 0.95486 101.25 11.2497 11.1731 10.1976 11.8343 10.5367 11.9758 11.9145 10.5679 7.74436 11.7042 11.7466 9.90958 12.2366 10.1149 9.98399 9.14896 8.06932 11.9031 10.1763 9.10858 0 10.5119 10.108 12.055 12.2145 8.81893 11.9471 11.5566 8.43663 11.5259 12.0292 11.8799 11.5408 0 11.8903 11.6905 11.8393 11.6726 11.7843 9.16932 10.8311 10.8455 0 10.784 10.8127 6.97235 11.9494 11.5059 7.25342 12.2 0 11.0447 10.253 0 11.2713 0 11.1246 8.9926 10.7464 8.98678 9.70745 10.5516 10.102 A0A0B8RTR8 A0A0B8RTR8_PIG Dopey family member 2 DOPEY2 Sus scrofa domesticus (domestic pig) Golgi to endosome transport [GO:0006895] cytosol [GO:0005829] AFYSYCRDALGSDLK 0.9588 323.31 12.505 12.6308 14.1995 13.8681 13.9647 13.4489 14.4897 13.1401 12.7457 12.8689 13.0515 12.3839 13.9864 13.1936 17.2389 12.8109 13.0241 13.4176 13.4295 13.4325 12.8349 13.9153 13.9997 13.0062 13.1562 13.1789 12.8175 12.6144 13.2073 13.7307 13.4564 13.8034 12.7014 10.8275 13.2482 12.0762 13.0345 13.366 12.4062 11.6708 12.0098 12.3127 12.0586 11.326 11.9944 12.0328 12.6259 12.2988 12.3855 12.3621 11.6728 11.8955 12.0461 11.9279 11.6687 11.629 11.9253 10.5458 11.0694 11.3503 11.2564 11.1044 10.688 A0A0B8RTS1 A0A0B8RTS1_PIG Disco-interacting protein 2-like B DIP2B Sus scrofa domesticus (domestic pig) AACILTTQTLMR 0.99611 323.31 12.1041 11.468 10.4095 13.2932 12.5885 11.715 8.43246 11.3001 10.5132 11.7663 12.1352 9.19827 13.2464 11.559 10.7893 11.4837 10.9393 8.74554 11.1252 10.6984 11.4074 12.547 15.1507 10.9792 11.777 10.5306 9.90361 10.6947 9.72434 11.8912 13.2894 9.02672 11.8895 9.16365 11.7576 10.6984 7.86549 10.0315 12.4231 11.1107 10.1653 11.2294 6.13683 12.3804 12.6393 10.879 12.945 11.1872 11.5322 13.6566 9.44855 11.5045 11.9393 11.1411 8.98948 10.0003 8.42261 9.4228 9.12738 9.42169 10.8228 9.75282 9.55802 A0A0B8RTS4 A0A0B8RTS4_PIG DGCR8 microprocessor complex subunit DGCR8 Sus scrofa domesticus (domestic pig) primary miRNA processing [GO:0031053] microprocessor complex [GO:0070877] heme binding [GO:0020037]; identical protein binding [GO:0042802]; RNA binding [GO:0003723] AKVEVCKDESVDLEEFR 1.0281 323.31 8.36803 11.2237 9.66033 11.2355 12.1397 11.056 12.1676 11.0135 11.7621 9.5146 10.5524 10.3017 12.0189 12.0991 10.3773 10.8007 9.44131 11.6706 12.0457 12.0202 10.7876 9.45327 10.8266 12.247 9.77633 8.86805 7.39515 8.97341 10.2713 10.9206 12.421 11.8349 11.6208 6.96371 11.8121 8.86106 8.63474 11.2864 12.4443 7.83895 11.0132 10.2717 9.74324 9.40941 10.4958 8.43867 10.1792 10.6568 10.8913 11.0108 11.2904 8.99382 10.2275 9.49055 10.4362 9.48521 10.0167 9.38754 8.84872 9.78183 8.10722 7.86245 9.18349 A0A0B8RTS7 A0A0B8RTS7_PIG "Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] (EC 1.3.1.124) (2,4-dienoyl-CoA reductase 2)" DECR2 Sus scrofa domesticus (domestic pig) fatty acid catabolic process [GO:0009062] "2,4-dienoyl-CoA reductase (NADPH) activity [GO:0008670]" AVLDTDTLGTFNMCR 0.96528 73.699 0 0 0 0 0 10.403 9.04067 0 7.40011 0 0 10.0791 5.13697 11.0015 0 0 0 8.74258 7.01937 10.7584 0 10.5805 10.4996 0 0 0 6.62319 0 6.53218 10.1257 0 10.8999 8.49893 9.68886 10.2074 0 11.0185 0 0 0 8.68503 0 0 10.4686 10.2009 0 0 7.10276 0 0 0 0 4.93654 0 8.00237 0 0 0 0 0 7.31886 0 0 A0A0B8RTT0 A0A0B8RTT0_PIG "Discoidin, CUB and LCCL domain containing 2" DCBLD2 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] AAAAAPARAALPLSR 0.94226 239.68 10.212 6.78162 11.0203 11.4485 11.6102 11.4731 10.0215 9.57558 10.4792 0 10.7237 10.1115 11.1079 11.9109 13.188 9.91147 11.1057 10.6469 10.4854 10.162 7.44352 11.1078 11.3569 11.4583 10.1668 8.76165 10.24 9.43686 10.9884 11.6292 12.8381 0 7.58067 8.56955 10.4433 8.77469 0 8.69961 10.9346 10.9678 12.2418 6.93558 6.77386 10.3582 8.27286 9.52636 11.3514 6.86109 11.6297 8.03127 11.9536 11.4259 6.92291 8.21135 9.20931 10.0961 10.0105 0 2.72157 10.7791 9.39324 8.6132 10.4419 A0A0B8RTT2 A0A0B8RTT2_PIG "Cytochrome P450, family 4, subfamily V, polypeptide 2" CYP4V2 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] "heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" APWLWFDFLYFMFK 0.92494 234.16 3.63564 8.1641 8.44601 5.97678 10.4131 9.78805 10.913 9.53732 11.1116 10.666 11.3013 11.1933 10.2183 11.3213 7.02967 11.0828 10.3852 9.81729 10.5221 11.1495 9.25925 11.0865 12.0607 10.086 11.0526 6.75074 0 9.42415 8.66067 0 12.9452 0 8.05447 11.0767 10.8039 0 8.15147 11.2992 8.35553 11.005 7.5806 6.75796 4.54028 9.46832 9.75721 0 0 9.482 0 7.52223 9.18772 9.03963 4.46153 6.3202 0 9.55913 4.79374 7.15451 6.73254 0 0 0 7.60452 A0A0B8RTT4 A0A0B8RTT4_PIG C-X-C motif chemokine 16 (Transmembrane chemokine CXCL16) CXCL16 Sus scrofa domesticus (domestic pig) lymphocyte chemotaxis [GO:0048247]; positive regulation of cell growth [GO:0030307]; positive regulation of cell migration [GO:0030335]; receptor-mediated endocytosis [GO:0006898]; response to tumor necrosis factor [GO:0034612]; response to type II interferon [GO:0034341] extracellular space [GO:0005615]; membrane [GO:0016020] chemokine activity [GO:0008009]; low-density lipoprotein particle receptor activity [GO:0005041]; scavenger receptor activity [GO:0005044] ENQEQLGK 0.95979 98.889 9.3926 7.67363 8.1573 9.64787 0 8.53267 9.067 8.70915 8.74032 7.80084 9.57809 9.48999 6.46153 10.7372 10.221 10.0224 6.76009 0 0 0 0 0 0 6.92552 8.52517 0 10.0674 6.15727 0 0 9.24717 0 8.56704 0 0 7.0119 0 6.79986 0 11.6677 0 0 6.56009 5.60039 0 9.18537 7.66527 8.63535 8.63782 9.55313 8.57027 0 6.16195 6.0473 9.1373 0 3.7241 0 9.67444 0 6.77913 0 8.45627 A0A0B8RTT6 A0A0B8RTT6_PIG Cysteine-serine-rich nuclear protein 1 CSRNP1 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] ARHEKLR 0.9475 155.5 12.0541 12.0874 10.8355 12.5288 12.6327 10.2854 12.3691 12.1998 9.18257 12.0181 12.2118 12.2717 12.2251 0 12.0115 12.2716 12.1474 0 8.4345 10.8094 11.8292 10.7419 11.4438 9.58084 11.4921 9.50533 8.78784 10.4968 9.26308 9.14926 11.4861 11.6546 11.8582 11.2883 10.2901 10.5137 11.1365 10.6504 7.31931 11.8162 8.98542 11.4514 12.4334 11.0044 11.2564 11.4718 10.9548 8.20158 7.41287 11.2046 7.28105 11.7599 11.8761 11.6325 11.0405 10.8402 10.8323 11.0566 11.1182 10.788 10.802 10.7485 10.5362 A0A0B8RTT8 A0A0B8RTT8_PIG V-crk avian sarcoma virus CT10 oncogene-like CRKL Sus scrofa domesticus (domestic pig) regulation of cell motility [GO:2000145] AIQKRVPCAYDK 0.95549 128.55 11.5956 9.71792 7.80374 11.4112 10.6247 10.8429 11.969 9.61067 11.446 12.5883 8.86403 12.0464 7.49945 10.7939 9.09911 10.8655 8.39909 9.03326 10.1529 9.93499 10.6366 9.36984 12.5906 11.8718 9.0284 9.71881 9.37393 10.3424 10.405 10.6434 11.264 11.504 11.9692 10.2976 10.3783 9.1485 10.4329 10.4215 11.3622 0 0 6.34991 9.0601 0 4.99594 8.65971 10.327 8.72618 10.1271 9.95472 7.92659 9.92296 9.66619 9.20335 6.23059 0 5.3791 8.75087 8.59723 0 0 0 0 A0A0B8RTU0 A0A0B8RTU0_PIG "CCR4-NOT transcription complex, subunit 1" CNOT1 Sus scrofa domesticus (domestic pig) negative regulation of translation [GO:0017148] CCR4-NOT core complex [GO:0030015]; nucleus [GO:0005634] AAANFSDRSLLK 1.0987 323.31 12.6318 11.122 11.0719 13.8349 11.8333 11.9878 13.9166 13.0454 13.0858 13.2839 13.1936 12.8654 14.3004 14.4155 13.0876 11.4946 13.3269 12.5898 12.6808 11.4857 11.4749 12.1649 14.2948 13.5217 10.502 11.2494 11.4521 13.0265 11.2609 12.5511 11.3466 13.3727 12.7294 12.9149 12.2763 12.745 12.8156 12.8741 12.9137 11.8555 10.1643 10.108 11.2359 10.3458 9.43644 12.2123 12.0788 12.5412 13.4529 12.3435 13.5541 11.2377 11.5822 11.7733 11.9027 12.0124 12.2972 12.3577 11.952 11.8682 10.7796 11.0194 12.0257 A0A0B8RTU2 A0A0B8RTU2_PIG Battenin CLN3 Sus scrofa domesticus (domestic pig) lysosomal membrane [GO:0005765] GGCAGSR 0.96848 49.404 7.46123 9.01402 8.0855 0 10.1913 0 0 0 0 10.6714 9.89595 0 10.3519 8.08034 0 0 8.40203 0 9.29306 0 0 0 9.56461 0 0 9.15755 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6.37936 0 0 8.35407 0 0 0 0 8.76288 0 0 0 0 6.05879 0 9.1965 0 8.27766 0 0 0 5.27471 0 A0A0B8RTU4 A0A0B8RTU4_PIG Chloride channel protein CLCN5 Sus scrofa domesticus (domestic pig) endosome membrane [GO:0010008]; Golgi membrane [GO:0000139]; plasma membrane [GO:0005886] ATP binding [GO:0005524]; voltage-gated chloride channel activity [GO:0005247] AMWQGAMDNR 0.97001 173.8 10.1731 0 12.402 10.4332 9.60168 2.4522 0 10.1169 5.29087 8.40246 5.01846 9.50589 11.2739 7.27109 7.09117 9.31238 6.93216 8.79708 0 10.1034 0 0 9.03 0 5.28322 0 7.57403 9.73254 8.80433 7.75656 8.13955 9.094 12.1354 6.85524 8.62352 6.43443 4.31404 10.284 0 9.64378 7.10967 8.30533 7.3766 0 5.28344 7.13072 0 8.06372 9.91012 7.64962 7.91797 0 5.31237 7.84975 0 5.89867 8.38414 6.4655 0 0 0 0 3.51286 A0A0B8RTU5 A0A0B8RTU5_PIG DNA helicase (EC 3.6.4.12) CHD9 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] ATP binding [GO:0005524]; ATP-dependent chromatin remodeler activity [GO:0140658]; hydrolase activity [GO:0016787] ADASSGSDSTSSSSEDSESSNED 1.1532 323.31 13.2444 13.9616 13.8836 13.6564 14.4926 14.7463 14.3455 16.0168 13.5451 13.0086 14.3006 14.6449 15.0627 14.397 14.6955 13.9692 15.088 14.6088 12.464 13.157 13.2584 15.1022 14.2441 13.942 13.7681 13.6585 14.0018 12.6952 12.9856 13.1172 14.0532 13.6153 15.3174 12.8412 12.7343 12.8594 13.029 13.5808 13.0179 11.6628 12.495 12.522 13.0344 10.4348 12.063 13.5589 12.7157 13.4034 13.7756 13.9809 12.5988 13.2807 13.4149 13.9756 11.661 12.8858 12.5451 12.4639 12.355 10.7703 12.2675 11.1836 12.4921 A0A0B8RTU7 A0A0B8RTU7_PIG "Cerebellar degeneration-related protein 2, 62kDa" CDR2 Sus scrofa domesticus (domestic pig) ALELEAEVAEMR 0.94799 242.44 9.38901 0 9.88354 10.0974 10.618 10.0114 10.2849 9.04426 10.2849 6.30513 8.52642 8.78555 7.42366 9.89087 12.01 10.5926 10.8298 9.97943 12.5814 9.05501 10.8704 10.8178 9.57932 9.08568 10.6623 8.93307 9.58429 8.73481 10.9637 10.5435 9.79925 13.8426 11.0084 9.09682 10.3547 10.3581 9.71995 10.2748 9.60813 0 8.9197 0 7.60637 0 0 9.35995 8.57871 8.77235 8.24008 8.85259 8.56194 8.11458 9.06692 0 8.2181 8.71001 7.07489 8.97128 15.0222 8.42752 0 0 0 A0A0B8RTU9 A0A0B8RTU9_PIG Tetraspanin CD81 Sus scrofa domesticus (domestic pig) adaptive immune response [GO:0002250] basolateral plasma membrane [GO:0016323]; lateral plasma membrane [GO:0016328] lipid binding [GO:0008289] DVKQFYDQALQQAIVDDDANNAK 0.98439 33.195 5.84207 0 10.0751 4.08789 10.1081 9.29848 0 10.3106 10.6695 0 9.64494 8.18923 9.16209 0 9.19316 8.64469 9.36728 7.06921 8.24327 10.6805 9.95133 10.7291 9.67605 8.61084 10.7347 10.8676 9.65139 6.53667 0 7.30834 6.88826 7.18884 0 0 7.31306 8.56898 7.83327 0 8.84822 6.19655 6.40189 6.57175 5.5296 6.09525 0 8.74019 5.6267 6.80271 7.76779 6.52987 8.60203 6.78398 0 7.40633 0 0 0 6.71768 0 0 0 0 4.60555 A0A0B8RTV1 A0A0B8RTV1_PIG Tetraspanin CD37 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] CCGWNSPRDWFR 0.98829 30.628 0 0 0 9.80752 9.2421 0 0 0 0 0 0 7.21023 9.77461 9.59748 0 0 9.54535 0 10.0661 0 0 0 6.33441 6.30921 0 0 0 0 0 8.99602 0 10.1295 0 0 7.52286 0 8.86734 8.96512 0 0 0 0 0 0 0 4.91963 0 4.73742 0 0 0 0 0 8.64721 0 0 8.0474 0 0 0 8.21447 0 0 A0A0B8RTV3 A0A0B8RTV3_PIG B-cell receptor CD22 (Sialic acid-binding Ig-like lectin 2) CD22 Sus scrofa domesticus (domestic pig) plasma membrane [GO:0005886] AAMGVGFFLAILLLAIWGVKLR 0.94847 209.49 6.43748 9.47774 9.35352 12.9701 12.896 12.3188 9.53009 13.1302 10.6719 10.373 9.47525 10.4316 12.482 11.565 9.87364 13.5527 11.3098 9.80502 10.8226 9.55873 4.93017 13.2734 10.8445 9.68613 7.80096 0 4.22997 10.0528 0 9.83809 9.89505 10.2181 11.409 7.53146 9.14871 6.4656 8.41477 9.65869 8.10805 10.1589 10.2525 10.1717 8.9157 10.6339 0 7.28937 10.1501 9.93746 0 9.11884 0 9.94946 9.21607 8.82763 0 8.57996 8.32764 0 9.16714 9.07786 6.44435 0 0 A0A0B8RTV4 A0A0B8RTV4_PIG Cyclin-C CCNC Sus scrofa domesticus (domestic pig) regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] cyclin-dependent protein serine/threonine kinase regulator activity [GO:0016538] AGNFWQSSHYLQWILDKQDLLK 0.95226 110.32 10.8862 9.78919 0 11.2557 6.92754 10.3698 10.9786 11.6906 10.7327 10.0276 7.48325 10.9388 11.3083 10.021 10.8849 10.788 10.3957 10.0062 7.03034 0 0 9.70957 0 9.93798 0 3.86641 0 0 0 10.8315 11.288 8.13489 9.34063 0 10.0884 9.48766 4.49486 7.55666 7.80806 9.52713 9.573 0 8.34607 9.48597 8.23726 7.24831 9.83769 0 9.75221 6.07682 0 9.93441 0 9.00963 6.9798 9.44561 4.89724 6.68804 0 7.65943 8.51155 8.10444 0 A0A0B8RTV6 A0A0B8RTV6_PIG Cell division cycle and apoptosis regulator 1 CCAR1 Sus scrofa domesticus (domestic pig) cell cycle [GO:0007049]; cell division [GO:0051301]; regulation of DNA-templated transcription [GO:0006355] cytoplasm [GO:0005737]; organelle membrane [GO:0031090] AEVEQKLQLLEEK 1.0802 323.31 11.0951 12.8389 11.9939 13.1313 8.51483 13.3745 12.0088 11.8664 12.6747 11.8892 10.6904 12.2215 11.8565 12.2288 12.1545 11.4897 11.9147 12.0812 13.4621 10.5692 11.9727 12.0378 12.7478 12.4684 9.95961 10.0352 12.1353 10.3416 8.71874 9.71464 12.3268 8.48732 12.5977 10.5555 9.35636 10.4865 13.518 11.5089 10.4195 11.4701 10.6889 10.0509 11.2447 10.8846 11.647 10.561 8.54187 6.51987 12.9192 11.6986 11.0259 10.5815 9.31152 9.89582 10.0633 9.52248 8.34541 11.6042 10.7942 7.89706 10.3219 9.77329 11.1813 A0A0B8RTV8 A0A0B8RTV8_PIG Caspase-3 (EC 3.4.22.56) CASP3 Sus scrofa domesticus (domestic pig) apoptotic process [GO:0006915]; proteolysis [GO:0006508] cytoplasm [GO:0005737] cysteine-type endopeptidase activity [GO:0004197] ANTKNSVDSK 0.97611 180.11 7.62534 7.23726 6.672 9.66981 11.5356 8.98971 0 6.34394 10.2798 0 9.46434 9.93357 7.87129 6.45182 11.8918 0 8.26599 8.20609 9.35059 0 7.32076 9.76045 8.95597 8.75672 10.0055 0 8.4074 9.58858 5.53922 8.31365 6.56893 10.6239 10.4622 9.31302 5.88281 9.48242 10.539 0 0 9.34074 9.67442 8.72938 0 7.16551 8.75732 7.54821 8.98371 0 6.45538 9.68066 0 0 6.36494 8.79312 6.79468 8.26959 3.90458 6.76779 0 8.32143 0 5.93126 0 A0A0B8RTW0 A0A0B8RTW0_PIG "CDK2-associated, cullin domain 1" CACUL1 Sus scrofa domesticus (domestic pig) ubiquitin-dependent protein catabolic process [GO:0006511] ubiquitin protein ligase binding [GO:0031625] AAPAPTPSSTININTSTSK 0.96661 113.21 0 0 0 0 13.2748 10.0422 8.31243 0 0 5.7188 6.24178 12.0818 9.56689 0 11.8622 7.68657 7.61971 10.2004 7.92404 0 0 0 0 0 11.1369 9.12846 0 11.0922 8.49893 8.87507 0 0 10.2098 10.1105 8.32939 6.38469 0 7.27612 6.44599 9.93046 0 0 9.73627 0 8.94813 0 7.58751 9.41614 7.69954 6.9905 9.84277 8.00461 0 4.98614 7.16912 0 10.0251 7.10434 0 0 0 0 7.77472 A0A0B8RTW2 A0A0B8RTW2_PIG Uncharacterized protein C6orf203 C6orf203 Sus scrofa domesticus (domestic pig) RNA binding [GO:0003723] AAETETVMR 0.95389 159.86 8.91845 0 9.18837 16.6789 10.0828 8.73752 9.35674 11.6781 11.6824 16.1877 9.21931 6.81839 14.7132 10.0386 12.2415 10.8731 12.1106 9.80384 6.15457 8.82069 7.8896 9.90002 11.564 10.6552 10.67 12.239 10.1621 6.10781 8.9804 8.6653 11.4447 11.7886 7.0258 9.42897 9.87264 6.16688 10.4991 9.76447 10.6403 10.9661 10.933 9.52583 11.1791 12.2546 10.5448 9.36776 6.97842 11.3652 11.902 9.13617 8.95233 9.70319 9.47701 0 9.16947 7.36816 10.449 6.02596 0 11.0203 11.1241 11.4115 8.71287 A0A0B8RTW4 A0A0B8RTW4_PIG BRISC and BRCA1-A complex member 2 BRE Sus scrofa domesticus (domestic pig) apoptotic process [GO:0006915]; cell division [GO:0051301]; chromatin organization [GO:0006325]; double-strand break repair [GO:0006302]; mitotic G2 DNA damage checkpoint signaling [GO:0007095]; positive regulation of DNA repair [GO:0045739]; response to ionizing radiation [GO:0010212] BRCA1-A complex [GO:0070531]; BRISC complex [GO:0070552]; cytoplasm [GO:0005737] polyubiquitin modification-dependent protein binding [GO:0031593] AKAYFKTFVPQFQEAAFANGK 0.96738 137.66 9.29763 6.62082 7.26547 9.14733 8.32616 7.45919 9.56737 9.30565 0 8.88121 7.7097 8.15765 11.2894 0 6.513 8.38642 8.94067 0 5.49275 8.24084 7.43112 12.3725 0 8.58357 7.38595 5.57679 0 7.5675 9.00812 9.05132 0 0 0 2.94725 6.80851 0 7.08119 0 7.32166 9.21072 6.86307 8.49398 9.22164 7.50882 8.20911 7.45869 9.10552 8.11129 0 6.86827 9.02165 9.41443 11.5919 4.46878 5.62047 0 8.48595 0 0 7.77505 0 7.70625 0 A0A0B8RTW6 A0A0B8RTW6_PIG Beclin-1 BECN1 Sus scrofa domesticus (domestic pig) apoptotic process [GO:0006915]; autophagosome assembly [GO:0000045]; cell cycle [GO:0007049]; cell division [GO:0051301]; defense response to virus [GO:0051607]; early endosome to late endosome transport [GO:0045022] autophagosome [GO:0005776]; cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]; endosome membrane [GO:0010008]; Golgi apparatus [GO:0005794]; mitochondrial membrane [GO:0031966]; nucleus [GO:0005634] CLEILEQMHEDDSEQLR 0.95047 242.07 7.50351 0 7.91797 10.617 4.78225 10.439 12.5277 11.3084 9.99704 10.3549 10.2465 0 9.20266 9.13222 8.96385 10.5079 7.35905 8.44803 12.1714 4.74006 10.1667 11.6042 7.81295 10.034 8.30168 10.248 13.0688 9.99944 6.8846 5.0241 9.21965 11.5845 10.7927 9.16476 3.64858 0 7.85462 9.42253 9.37643 9.26833 4.9211 8.48353 0 4.4351 0 7.70722 5.25701 8.31818 13.1944 7.1979 8.04592 8.82747 8.97676 6.52074 8.55132 7.56308 8.50291 8.40173 6.9571 0 8.13103 7.53768 8.31773 A0A0B8RTW8 A0A0B8RTW8_PIG BCL2-associated athanogene 3 BAG3 Sus scrofa domesticus (domestic pig) protein-folding chaperone binding [GO:0051087] ADVRQARR 0.95098 166.1 0 0 8.75372 10.3432 11.7896 10.7202 10.5626 9.24786 8.24084 10.9197 9.42393 5.55539 12.989 10.7741 0 5.93187 10.6826 9.52221 9.57183 10.1485 10.5954 6.30703 0 9.84599 12.6629 7.77076 10.0256 8.1047 10.8928 6.11103 9.9901 11.8436 11.8597 9.87998 10.0188 0 8.52662 9.41058 7.851 7.60748 7.65306 5.3048 8.78391 0 8.67472 8.55378 9.02187 9.22766 9.63399 0 0 9.63938 8.29402 8.52007 9.43317 5.38115 0 8.19584 0 8.80323 0 7.44741 7.75455 A0A0B8RTW9 A0A0B8RTW9_PIG V-type proton ATPase subunit a ATP6V0A2 Sus scrofa domesticus (domestic pig) "vacuolar proton-transporting V-type ATPase, V0 domain [GO:0000220]" "proton-transporting ATPase activity, rotational mechanism [GO:0046961]" AAESVYSRVIQVKK 0.9385 238.19 12.346 10.0097 7.75241 11.0808 11.4464 3.10502 9.27682 10.3465 11.9917 9.67585 9.763 7.05322 13.7222 13.9365 11.7573 6.26298 9.6141 9.21442 9.81357 0 0 10.3962 7.39343 11.2797 8.98846 0 12.1091 11.1555 8.12547 6.50534 11.0877 10.2635 10.531 5.14237 12.0707 9.79199 0 10.9051 0 8.8042 0 9.96219 9.93637 6.60305 9.76583 7.96636 11.1002 10.2103 8.05268 10.7238 10.9903 6.22019 0 9.06482 9.58005 9.18799 0 6.89893 8.64162 10.4248 0 8.08279 0 A0A0B8RTX1 A0A0B8RTX1_PIG Atlastin GTPase 3 ATL3 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] GTP binding [GO:0005525]; GTPase activity [GO:0003924] ALASILLQDHIR 0.96097 161.71 10.8904 9.91728 7.93864 7.43338 6.08128 9.21684 7.42047 10.3222 7.96993 0 0 11.7176 10.0385 13.3821 10.2465 8.6326 0 8.98746 9.18123 9.34897 9.81375 8.99707 8.49478 9.6003 0 4.71331 6.62939 9.49241 10.6595 9.96239 10.0287 8.85758 10.3835 9.0222 10.4953 0 9.56096 0 9.00616 0 9.90206 0 8.33141 8.8604 0 9.09911 9.23189 0 7.81724 0 0 10.6571 0 8.94708 9.08007 8.50426 0 0 7.61287 10.9334 0 5.13332 0 A0A0B8RTX2 A0A0B8RTX2_PIG Additional sex combs like transcriptional regulator 2 ASXL2 Sus scrofa domesticus (domestic pig) regulation of DNA-templated transcription [GO:0006355] nucleus [GO:0005634] DNA binding [GO:0003677]; metal ion binding [GO:0046872] AARGESPDSNR 1.1034 323.31 10.4165 10.4529 10.4557 12.6734 13.5177 13.8943 11.3433 13.3468 12.5949 13.0007 13.2523 12.591 11.403 9.97212 11.5402 13.8638 10.1227 12.2096 11.4118 10.3405 8.96373 10.8163 13.8629 12.5656 10.5445 9.23549 11.1492 9.61511 9.88122 11.6314 10.8336 12.8862 12.3722 9.39184 11.5583 11.3053 11.0106 10.3309 9.70587 11.6141 9.56136 12.048 11.3653 10.7966 11.8977 9.72547 10.7386 8.99977 11.5096 12.8918 13.3529 9.15775 10.1525 11.4848 11.7678 10.2388 9.11993 10.1804 10.3492 10.8681 7.59104 9.13013 10.4309 A0A0B8RTX3 A0A0B8RTX3_PIG "Adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1" APPL1 Sus scrofa domesticus (domestic pig) cell cycle [GO:0007049] early endosome membrane [GO:0031901]; nucleus [GO:0005634]; phagocytic vesicle [GO:0045335]; ruffle [GO:0001726] identical protein binding [GO:0042802] AGYLNAR 0.92872 224.89 10.5539 9.83635 7.51704 9.40924 11.0942 11.1882 8.60807 10.802 11.3466 10.5884 10.834 11.3419 11.1894 10.8273 11.2948 10.1371 8.80087 10.7807 12.1398 11.1258 13.0615 10.3713 9.60387 9.09693 9.42076 7.60296 10.6345 10.5816 9.13494 10.6743 11.8801 13.3957 9.82906 7.09466 13.7011 8.36142 11.8094 11.6893 10.9803 8.75509 9.87003 10.4421 0 8.55029 11.0437 11.9188 10.6443 12.0027 8.2702 9.76419 9.1484 5.55299 10.6959 10.6694 8.96316 8.4929 7.88399 0 6.7486 0 8.56468 8.75355 9.12544 A0A0B8RTX5 A0A0B8RTX5_PIG AP-2 complex subunit mu (AP-2 mu chain) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) AP2M1 Sus scrofa domesticus (domestic pig) endocytosis [GO:0006897]; intracellular protein transport [GO:0006886] clathrin adaptor complex [GO:0030131]; clathrin-coated pit [GO:0005905] lipid binding [GO:0008289] AKYKASENAIVWK 0.95312 256.68 9.54088 5.81568 9.07727 12.3094 10.9763 11.4953 9.10295 0 10.7272 10.8342 11.2874 9.49179 10.4204 10.4052 14.5256 9.01369 8.73349 0 10.6291 10.688 8.87719 10.3048 11.0428 11.4354 10.4324 8.88228 10.2065 11.1351 8.03897 9.78167 10.4018 8.42836 7.89403 9.09117 7.19653 0 0 5.74416 6.34536 9.91111 0 6.55055 9.06337 7.26969 15.4091 10.4694 9.74599 7.32607 0 7.67631 10.9894 0 0 8.1299 9.60563 0 5.28381 6.92469 10.7509 6.78306 8.01764 8.3009 7.81352 A0A0B8RTX6 A0A0B8RTX6_PIG Adhesion molecule with Ig-like domain 3 AMIGO3 Sus scrofa domesticus (domestic pig) cell adhesion [GO:0007155] membrane [GO:0016020] ALRLNHNELEVLGR 0.95914 132.44 7.60807 0 8.24698 6.54043 6.48427 9.27146 7.56506 0 9.15499 3.74685 7.22265 7.57289 3.13172 9.04234 10.2952 8.0855 6.89688 7.03793 8.15997 7.86288 8.93342 0 8.07932 6.97418 0 5.88198 7.73363 8.74022 0 0 6.46823 4.7067 7.10538 6.91217 9.15608 0 0 4.53667 8.10192 3.11203 0 0 8.66903 7.80884 0 0 6.12205 0 0 7.25456 0 0 0 8.66477 4.17481 7.72948 5.37152 0 0 8.7651 0 0 0 A0A0B8RTX7 A0A0B8RTX7_PIG "Apoptosis-inducing factor, mitochondrion-associated, 1" AIFM1 Sus scrofa domesticus (domestic pig) apoptotic process [GO:0006915] mitochondrion [GO:0005739] flavin adenine dinucleotide binding [GO:0050660]; oxidoreductase activity [GO:0016491]; protein dimerization activity [GO:0046983] AGAEVKSR 0.93103 249.25 10.1279 10.3429 10.1726 11.1359 11.7378 10.5687 9.74153 10.583 12.1077 11.1669 11.1097 10.979 11.9936 10.3023 11.152 9.77503 8.80726 11.2997 12.132 9.77167 6.96047 7.73606 9.77625 11.4432 6.45543 10.0792 7.7658 8.55926 13.2383 11.8221 9.49913 11.1232 14.9695 8.39356 9.1517 9.33029 11.4069 10.3798 7.17403 6.47242 7.42139 8.51041 10.8794 11.8665 11.253 10.744 9.68697 8.59421 9.36133 12.4761 10.7908 9.40892 12.2451 12.2493 8.99113 4.71798 8.25866 6.53394 9.24653 0 7.51538 8.52834 8.00231 A0A0B8RTX9 A0A0B8RTX9_PIG Adiponectin receptor 1 ADIPOR1 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] metal ion binding [GO:0046872] ACFKSIFR 0.9656 71.727 5.36646 10.9354 8.26871 7.92071 0 0 7.01413 0 8.84043 7.65557 8.3619 7.0846 0 8.44617 8.43725 8.76089 0 8.59051 9.8867 7.79487 10.6222 0 8.34279 0 6.40247 0 7.0782 0 0 10.293 10.4292 7.69328 6.26318 10.5214 0 0 0 6.60541 6.52188 9.16365 7.9334 6.49875 10.0157 9.0484 8.8874 9.99944 9.09392 5.56992 9.787 7.76567 9.26864 5.23546 8.11072 0 0 5.58532 0 5.44463 5.96933 0 0 7.6703 3.12905 A0A0B8RTY1 A0A0B8RTY1_PIG Disintegrin and metalloproteinase domain-containing protein 10 (EC 3.4.24.81) (Kuzbanian protein homolog) (Mammalian disintegrin-metalloprotease) ADAM10 Sus scrofa domesticus (domestic pig) Notch signaling pathway [GO:0007219]; proteolysis [GO:0006508] adherens junction [GO:0005912]; clathrin-coated vesicle [GO:0030136]; Golgi membrane [GO:0000139] metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]; SH3 domain binding [GO:0017124] AIDTIYQTTDFSGIR 1.1179 323.31 9.5433 11.1789 0 12.4357 12.6404 9.93724 12.8273 12.6139 12.5098 9.90985 10.7345 9.67966 9.45461 12.9701 10.9504 12.054 8.24636 13.1182 10.5667 12.4705 6.80671 12.1736 12.6436 12.1384 9.42756 11.4211 11.9344 10.2731 9.97025 8.61047 11.5699 11.3798 10.973 8.21738 10.0393 9.58658 9.76929 11.0373 9.12882 9.34957 7.69919 10.7774 11.1818 11.6331 8.42484 11.6466 9.22711 10.2886 9.42995 10.8445 9.77793 9.19456 9.8933 9.27139 6.84962 9.95688 7.77847 8.43825 9.71879 9.80216 10.016 10.0069 10.2583 A0A0B8RTY4 A0A0B8RTY4_PIG Cytoplasmic aconitate hydratase (EC 4.2.1.3) (Citrate hydro-lyase) (Iron-responsive element-binding protein 1) ACO1 Sus scrofa domesticus (domestic pig) cytosol [GO:0005829] "4 iron, 4 sulfur cluster binding [GO:0051539]; aconitate hydratase activity [GO:0003994]; iron-responsive element binding [GO:0030350]; metal ion binding [GO:0046872]" ADSLQKNQDLEFERNR 0.94118 299.88 9.38165 6.247 9.55211 10.9441 11.2537 10.4357 11.0495 8.80151 9.78143 11.1152 0 13.0517 10.6635 8.11432 13.843 10.828 9.7862 11.1414 6.70127 3.09776 11.4108 11.4642 11.8636 9.11455 10.4694 11.3049 9.7353 11.6396 10.7338 9.46838 9.88231 10.8903 7.50597 11.3626 11.0971 10.0007 9.61809 10.1026 9.14269 9.06835 9.2329 7.61633 10.5566 10.9221 10.0305 8.62874 10.3201 9.39184 9.96593 10.1443 11.5809 7.65549 7.21471 5.67081 10.9605 8.21218 7.61478 8.40318 8.32477 8.07125 7.95286 5.10932 7.72219 A0A0B8RTY5 A0A0B8RTY5_PIG "Short-chain specific acyl-CoA dehydrogenase, mitochondrial (EC 1.3.8.1) (Butyryl-CoA dehydrogenase)" ACADS Sus scrofa domesticus (domestic pig) mitochondrion [GO:0005739] acyl-CoA dehydrogenase activity [GO:0003995]; flavin adenine dinucleotide binding [GO:0050660] ACGPVRGALWPR 0.95699 145.98 9.60661 0 9.65202 12.015 0 9.82002 10.4106 11.0851 0 9.56989 10.2691 9.49695 11.4547 9.09218 9.56157 10.2802 12.3725 7.01201 7.29416 9.18063 9.7854 10.3979 0 7.6985 11.5416 10.0309 11.0552 11.6419 10.9384 8.19037 4.8073 9.69646 8.6714 0 11.0943 4.63981 10.6506 11.2442 10.6615 8.28725 8.34983 0 0 2.82312 7.53838 10.0972 0 10.3391 11.0391 8.91367 13.1381 5.69605 9.03301 0 10.8204 8.74106 8.02592 0 0 9.06738 0 8.58755 7.36291 A0A0B8RTY7 A0A0B8RTY7_PIG Aminoadipate-semialdehyde dehydrogenase AASDH Sus scrofa domesticus (domestic pig) lipid metabolic process [GO:0006629] nucleotide binding [GO:0000166] ATGDFVTLK 0.93438 288.38 10.0732 9.85975 11.0038 8.99118 13.5646 8.125 12.867 9.23742 8.89987 10.103 12.5351 9.57499 10.1694 8.7038 10.628 8.71696 11.3798 7.91552 9.45391 11.8403 7.083 8.1153 10.5771 8.66434 0 9.51875 7.86357 9.8301 8.10171 9.59826 11.4042 10.6765 10.9011 9.98328 9.45919 9.78395 10.9047 9.23012 10.8761 8.43208 9.55332 0 8.5907 7.99825 11.1542 0 9.3458 10.2982 9.67564 10.2795 9.30597 10.6523 9.21808 10.8261 11.3456 9.1635 8.82276 9.96265 7.5168 7.22458 8.75278 6.00968 7.81192 A0A0B8RVC6 A0A0B8RVC6_PIG Zinc finger protein 136 ZNF136 Sus scrofa domesticus (domestic pig) regulation of DNA-templated transcription [GO:0006355] metal ion binding [GO:0046872] AFIYLSSLR 1.2488 323.31 10.412 10.3536 11.2134 12.7265 12.4133 10.7743 12.5558 12.2516 12.9988 11.2469 12.2614 10.3539 12.3749 9.54653 12.8232 12.4083 11.7247 12.31 11.408 11.6518 11.5458 9.29412 12.3481 11.4561 0 8.14787 10.1467 10.1689 10.4397 10.789 12.1928 11.8157 11.5736 11.5074 9.96026 9.94908 11.0485 9.51503 9.97699 11.4668 10.4224 9.1718 11.6166 11.7334 11.1968 9.65336 10.6789 11.1514 11.2818 11.3371 12.2953 9.85244 10.0996 11.3673 10.5979 10.254 9.55013 10.2211 9.18138 10.4706 8.06469 9.01787 8.70456 A0A0B8RVC9 A0A0B8RVC9_PIG Zinc finger RNA-binding protein ZFR Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270] AGYSQGATQYTQAQQTR 1.2611 323.31 12.6953 16.7378 13.7774 13.7971 13.7024 13.1704 14.9531 13.822 14.6688 12.6897 17.0997 13.4264 13.7141 14.6077 18.3108 18.5126 14.1644 13.0929 9.80758 17.5386 12.5583 13.3817 13.3075 17.6336 10.9516 11.2649 9.69141 13.4726 12.1912 13.5452 13.3008 14.2937 13.3344 13.1867 12.2594 15.1783 13.6604 13.8723 13.6506 16.2238 15.9222 13.2505 12.5023 12.8366 13.3688 12.7753 16.6183 13.2784 13.3051 13.2961 16.1399 13.3038 12.703 9.51907 13.2567 17.2042 8.96936 17.4698 10.5732 17.1087 6.1327 11.4035 12.8725 A0A0B8RVD1 A0A0B8RVD1_PIG Zinc finger CCCH-type containing 12C ZC3H12C Sus scrofa domesticus (domestic pig) endonuclease activity [GO:0004519]; metal ion binding [GO:0046872] ADSTSDVKRGAPK 1.4302 323.31 12.781 9.00879 12.1762 14.5012 12.7831 12.5864 11.7255 8.59294 10.6995 10.6244 11.6095 11.043 13.8542 11.5519 4.89569 14.5044 8.93319 12.019 12.6504 11.8217 11.0494 13.699 10.1998 10.0226 11.4808 10.7487 0 8.98479 8.56022 10.1097 10.1834 14.931 10.8216 10.5459 10.3542 8.92345 10.2354 9.59132 8.81871 13.395 10.0778 8.47423 10.7555 11.7825 11.3276 6.21292 4.6339 9.03727 8.86629 11.0487 9.00627 11.3728 7.75295 7.25729 9.9952 7.27491 8.74544 10.1657 0 11.7822 8.7656 8.00501 10.0003 A0A0B8RVD2 A0A0B8RVD2_PIG 14-3-3 protein beta/alpha YWHAB Sus scrofa domesticus (domestic pig) monooxygenase activity [GO:0004497] AKLAEQAER 1.4545 323.31 14.1836 14.2248 14.0165 15.3159 15.3928 15.3862 15.0308 15.4605 15.3233 15.2732 14.8586 15.1927 15.2681 15.4131 14.7742 15.2099 15.0688 15.331 14.7149 15.0635 15.256 15.382 15.6147 15.2971 14.5295 14.4898 13.442 14.4024 14.0979 13.2999 14.7866 15.4452 15.4529 14.7852 14.1599 14.7422 15.0908 15.0674 14.9449 13.5911 13.5982 13.4979 12.6513 12.7052 12.5719 14.2323 14.342 14.0164 14.404 14.6243 14.6194 13.8761 13.8919 13.9888 13.4337 13.4248 13.4751 12.839 12.8917 12.7733 11.3568 11.2942 11.507 A0A0B8RVD4 A0A0B8RVD4_PIG WD repeat domain 43 WDR43 Sus scrofa domesticus (domestic pig) nucleolus [GO:0005730] DEDVDEENEEEDEDAEEK 0.96965 175.32 8.59051 10.6755 7.62753 10.2124 8.198 11.8084 11.9963 10.0199 8.7949 7.00237 10.1945 8.91615 9.77855 10.1046 8.48325 8.92994 9.88626 9.13909 10.5817 7.44626 10.1005 9.292 10.2586 9.99887 8.50851 7.61934 9.36669 5.06901 0 7.80155 9.44182 8.61254 11.0229 0 6.44654 7.416 6.46447 7.61073 6.50799 6.70072 10.3302 8.20794 11.081 7.16732 4.51014 6.32959 8.19417 8.2866 9.76552 7.93015 9.35136 8.48897 0 8.4654 10.9546 4.90651 9.34136 0 0 7.18229 6.22701 3.67356 10.2149 A0A0B8RVD6 A0A0B8RVD6_PIG Vacuolar protein sorting-associated protein 54 VPS54 Sus scrofa domesticus (domestic pig) "protein transport [GO:0015031]; retrograde transport, endosome to Golgi [GO:0042147]" cytosol [GO:0005829]; GARP complex [GO:0000938] AHFEARLQPK 1.4713 323.31 12.3125 12.8888 11.8024 14.6725 14.7027 14.3233 13.785 14.3487 12.7704 12.8623 14.3805 13.8291 14.7208 14.8048 14.8549 14.3757 14.504 14.1766 13.2099 12.8093 11.5081 14.4138 14.3183 12.1178 12.4941 11.6401 10.9471 12.0651 11.3365 11.6309 12.4009 10.8871 11.0017 9.7887 10.2421 9.18656 10.8297 12.6442 12.3931 8.36903 11.4195 9.76562 13.0401 11.7429 9.47464 11.6616 9.78714 11.3311 12.7896 12.9885 10.9541 10.9186 11.3157 10.9058 11.5243 12.0324 8.86298 11.0037 10.3063 11.5661 10.8341 9.61804 9.32634 A0A0B8RVD8 A0A0B8RVD8_PIG Vimentin VIM Sus scrofa domesticus (domestic pig) intermediate filament [GO:0005882]; nuclear matrix [GO:0016363]; plasma membrane [GO:0005886] DGQVINETSQHHDDLE 1.4798 323.31 13.7326 12.7997 13.887 12.6898 12.9124 13.584 11.3663 13.9459 13.4063 13.5517 13.8118 11.8956 14.1497 12.8266 12.688 12.6514 12.9241 12.3123 13.231 13.6519 13.5476 14.2346 14.1794 13.0636 12.7003 12.799 12.6561 15.6519 13.0396 14.1673 12.472 13.0875 12.5642 10.4786 11.7072 11.342 13.5006 11.7255 12.6345 11.1105 11.5772 11.6296 11.9313 14.2187 12.6046 11.6178 8.11228 12.3639 12.1947 11.9594 13.1193 11.8833 11.3211 11.3689 12.8415 13.5797 12.7525 13.1425 12.0064 13.3031 12.4276 12.2219 11.8485 A0A0B8RVE1 A0A0B8RVE1_PIG Ubiquilin 4 UBQLN4 Sus scrofa domesticus (domestic pig) ALSNLESIPGGYNALRR 0.96656 48.504 8.97126 8.70684 9.43771 10.2833 9.05826 8.94108 10.5758 10.2985 9.26983 9.66855 0 9.03637 8.97685 9.13417 10.2694 9.51635 8.59694 9.37075 9.84668 9.65539 8.78542 10.2107 10.2642 9.04182 8.72209 9.62819 9.72419 0 7.24279 7.54651 11.0044 11.1967 8.52309 7.54442 8.27561 7.86746 9.81708 9.06167 8.58286 7.36615 7.57781 8.6768 7.0332 7.06501 6.75502 7.11998 7.21917 0 9.14387 0 7.44783 4.96005 7.48099 8.54898 0 7.36667 7.32939 0 4.38895 0 0 0 0 A0A0B8RVE3 A0A0B8RVE3_PIG Ubiquitin associated protein 2-like UBAP2L Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737] AINVLLEGNPDTHSWEMVGK 0.97872 184.6 11.6829 0 12.7302 13.6892 12.2059 12.3952 13.2382 13.2831 12.9828 12.5906 12.2369 12.2221 12.367 12.6174 12.6304 14.2261 13.0766 12.7345 11.8246 11.4166 11.7523 12.6475 8.62761 9.55449 12.3944 11.9346 12.6627 10.7034 8.16476 6.65693 12.4113 8.12065 12.055 10.6121 0 8.97613 10.6628 9.11353 11.6272 14.2208 11.1408 11.1102 10.4322 11.3731 11.918 11.3757 11.2005 14.6244 13.6536 11.4562 11.5946 11.4341 7.86771 11.4301 14.8862 14.932 11.2514 15.8844 15.5038 12.1927 15.1167 15.0233 9.46944 A0A0B8RVE5 A0A0B8RVE5_PIG Tetratricopeptide repeat protein 27 TTC27 Sus scrofa domesticus (domestic pig) AEEILRQELEKR 1.4222 323.31 11.7705 9.22494 8.01396 11.4082 6.41608 13.758 10.4438 11.1811 11.8042 8.35204 8.56628 10.04 10.579 9.63141 11.604 8.82877 12.3618 6.01581 10.2628 11.9385 11.4157 9.54722 9.95334 9.09756 11.5238 7.32751 11.392 8.10879 9.07722 9.85776 11.0359 11.2073 8.39656 8.81877 10.7613 10.6252 11.2597 8.34674 6.91169 0 9.36267 10.0326 8.94489 11.3106 9.94891 11.1179 9.22651 6.35607 7.19456 8.70619 10.3151 10.6354 10.4735 6.71864 9.7375 10.671 8.99602 9.29414 9.48531 7.83504 7.01915 7.27687 0 A0A0B8RVE7 A0A0B8RVE7_PIG "TROVE domain family, member 2" TROVE2 Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737] metal ion binding [GO:0046872]; RNA binding [GO:0003723] ALLQEMPLTALLRNLGK 0.9697 263.18 9.92117 5.52023 10.7403 13.7384 10.1546 10.0865 8.45574 13.1253 5.86849 8.46234 10.5949 9.68145 4.37747 13.9451 14.3086 13.1789 9.12368 7.11312 13.0097 10.9834 12.7708 9.49304 11.4931 8.89272 8.20574 6.93345 13.9684 10.784 10.9758 0 7.2212 11.2096 11.1606 9.30863 9.49703 5.14747 10.5012 9.88769 10.2592 7.01647 6.9216 9.89657 15.468 15.7366 15.9173 8.79393 7.81076 0 7.08502 11.7903 7.62659 11.5051 7.68657 7.52168 12.1748 12.2148 8.32125 0 10.6249 10.7796 6.95163 3.48774 6.77281 A0A0B8RVE8 A0A0B8RVE8_PIG Translocating chain-associated membrane protein TRAM2 Sus scrofa domesticus (domestic pig) "SRP-dependent cotranslational protein targeting to membrane, translocation [GO:0006616]" membrane [GO:0016020] AENGTSPR 0.9588 102.67 8.00596 9.8111 10.4719 10.8531 0 0 11.1131 9.71555 11.011 9.91326 0 9.98741 10.7645 9.00874 9.76124 9.436 10.0423 9.64947 7.672 0 8.69763 7.04286 11.3019 6.72887 11.9575 8.77712 9.38107 0 7.87553 8.93094 9.73769 9.35628 10.6569 0 7.08268 11.5704 0 0 7.96913 8.44473 9.6196 0 9.11767 14.1433 13.8812 10.604 0 1.63793 8.68696 0 3.16095 3.32582 11.24 11.0814 0 11.403 9.8605 0 6.92113 5.3185 7.34793 0 3.25789 A0A0B8RVF0 A0A0B8RVF0_PIG Tumor necrosis factor receptor superfamily member 1A (Tumor necrosis factor receptor 1) (Tumor necrosis factor receptor type I) (p55) (p60) TNFRSF1A Sus scrofa domesticus (domestic pig) apoptotic process [GO:0006915]; inflammatory response [GO:0006954]; prostaglandin metabolic process [GO:0006693] Golgi membrane [GO:0000139]; plasma membrane [GO:0005886] tumor necrosis factor receptor activity [GO:0005031] CLREAQYSMLAEWR 0.96755 171.86 10.6523 11.2981 10.6076 12.2614 12.1343 12.596 12.6608 12.5284 12.5813 12.4546 12.1988 11.8763 10.0418 5.28133 12.597 12.801 12.5961 12.2937 7.07788 5.94153 11.6042 12.3542 12.4238 12.7033 9.03064 5.62921 8.89324 9.84178 10.5942 10.8135 9.12921 10.4681 11.4156 9.26873 9.42717 7.88673 4.5715 10.6419 10.68 10.2363 9.62804 8.63347 5.22693 7.23391 7.62205 9.86802 10.2355 10.2876 11.4965 11.5001 11.0121 9.66354 9.44983 12.4105 4.12904 10.8487 4.54733 9.06674 0 2.80892 8.6865 0 8.54512 A0A0B8RVF2 A0A0B8RVF2_PIG Transmembrane protein 150B TMEM150B Sus scrofa domesticus (domestic pig) autophagosome membrane [GO:0000421]; endosome membrane [GO:0010008]; plasma membrane [GO:0005886] DWGVGKWPNR 1.0018 18.505 9.88307 0 0 0 0 0 0 0 7.38189 0 0 0 0 0 0 0 0 0 0 0 0 7.20701 0 0 0 0 0 5.63978 0 0 0 9.52521 0 0 8.7075 0 0 0 0 0 0 0 0 8.18987 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.70262 0 0 0 0 A0A0B8RVF4 A0A0B8RVF4_PIG Toll/interleukin-1 receptor domain-containing adapter protein (TIR domain-containing adapter protein) TIRAP Sus scrofa domesticus (domestic pig) inflammatory response [GO:0006954]; innate immune response [GO:0045087]; regulation of innate immune response [GO:0045088]; signal transduction [GO:0007165] cytoplasm [GO:0005737]; plasma membrane [GO:0005886] identical protein binding [GO:0042802]; Toll-like receptor 2 binding [GO:0035663]; Toll-like receptor 4 binding [GO:0035662] ASSTSFPDPRSK 0.97209 57.211 7.41566 7.97591 0 11.1221 8.49093 5.11274 0 9.52793 9.07524 0 0 6.71727 10.1342 8.42047 0 0 0 5.96855 8.16128 7.02724 6.8596 0 0 0 10.1956 0 9.01976 0 0 0 10.0344 0 0 0 0 0 8.91235 8.21427 9.05368 0 0 0 0 10.4761 9.96694 6.09106 0 7.64573 0 0 9.97513 7.35376 0 0 2.97812 0 8.1151 7.29811 8.20653 0 0 0 0 A0A0B8RVF6 A0A0B8RVF6_PIG Transcription elongation factor TCEA2 Sus scrofa domesticus (domestic pig) transcription elongation by RNA polymerase II [GO:0006368] nucleus [GO:0005634] DNA binding [GO:0003677]; translation elongation factor activity [GO:0003746]; zinc ion binding [GO:0008270] AMTKEAIREHQMAR 0.97716 184.26 7.62564 11.8836 0 0 0 10.7912 9.56344 9.21779 9.24224 10.7347 9.75307 6.11191 10.4286 10.775 6.54206 9.99152 9.39654 7.74886 9.82181 0 10.5139 8.89621 9.9588 7.13761 5.90864 0 10.8374 8.76305 8.68387 8.86205 10.163 10.4429 9.68986 7.81102 0 9.21186 8.81852 10.632 10.5001 8.87329 8.71774 10.4169 5.57253 10.0239 8.08343 9.43448 0 10.9 9.33989 9.46561 5.71438 7.97384 10.5796 0 9.71234 8.83996 8.52242 7.53776 0 9.91444 0 5.17959 8.92041 A0A0B8RVF7 A0A0B8RVF7_PIG "Transforming, acidic coiled-coil containing protein 1" TACC1 Sus scrofa domesticus (domestic pig) mitotic spindle organization [GO:0007052] cytoplasm [GO:0005737]; cytoskeleton [GO:0005856] AAADSSPIK 1.5515 323.31 17.3846 10.7345 9.71783 17.8897 12.2034 17.9584 11.4118 12.5499 10.631 17.937 17.8132 17.925 9.28432 17.9196 18.1462 17.9463 11.3279 17.7662 10.8128 11.1319 11.261 18.1691 11.8123 17.9774 9.81235 17.5499 10.9633 9.72439 10.4309 17.5467 10.7616 10.6419 17.907 8.77212 17.5133 17.685 18.1144 11.0283 17.8979 16.8035 16.7018 16.5933 9.73715 9.99817 16.136 17.5234 9.50076 8.8715 17.7586 17.5831 17.8049 10.6053 9.94265 9.29992 9.26238 17.1646 17.2062 8.95431 16.7326 10.3823 8.15618 7.29002 15.6487 A0A0B8RVF9 A0A0B8RVF9_PIG SWAP switching B-cell complex 70kDa subunit SWAP70 Sus scrofa domesticus (domestic pig) AELEKWHLEQQQAIR 1.561 323.31 10.8494 11.257 9.81681 12.3119 12.3412 11.9059 12.7091 12.8615 11.851 11.4645 11.2217 12.0269 13.5546 13.0303 12.4233 13.0695 12.774 12.5666 11.7112 10.5797 8.79364 12.2706 13.3678 17.4917 11.1486 10.6044 11.5491 11.0556 11.1932 11.4428 11.815 11.0634 10.861 10.9105 10.8671 8.44853 9.13743 10.5994 11.4102 9.74482 10.9471 8.38154 0 8.57357 8.46761 9.89495 8.33047 11.0426 10.0095 10.1626 11.7337 8.76471 10.0769 8.33575 9.53393 10.3197 10.2036 10.7411 10.7153 0 9.14027 9.90275 8.3208 A0A0B8RVG1 A0A0B8RVG1_PIG Extracellular sulfatase (EC 3.1.6.-) SULF1 Sus scrofa domesticus (domestic pig) bone development [GO:0060348]; chondrocyte development [GO:0002063]; embryonic skeletal system development [GO:0048706]; esophagus smooth muscle contraction [GO:0014846]; glial cell-derived neurotrophic factor receptor signaling pathway [GO:0035860]; heparan sulfate proteoglycan metabolic process [GO:0030201]; innervation [GO:0060384]; kidney development [GO:0001822]; negative regulation of fibroblast growth factor receptor signaling pathway [GO:0040037]; positive regulation of Wnt signaling pathway [GO:0030177] cell surface [GO:0009986]; endoplasmic reticulum [GO:0005783]; extracellular space [GO:0005615]; Golgi stack [GO:0005795]; lysosome [GO:0005764] arylsulfatase activity [GO:0004065]; calcium ion binding [GO:0005509]; N-acetylglucosamine-6-sulfatase activity [GO:0008449] AKIWRDTFLVER 1.5706 323.31 10.1524 9.39071 5.99247 12.554 11.0725 10.5377 12.7126 9.4204 12.0645 11.1883 11.2734 11.1266 12.8431 10.85 10.9632 11.9545 11.4523 12.42 0 8.38366 12.1093 9.95683 12.1887 11.4606 13.7149 8.9018 8.54141 10.1886 9.88316 10.8115 12.0204 12.2442 7.81788 9.30026 7.80316 10.3755 10.2346 11.1049 8.18923 11.5882 9.4673 10.575 9.27524 10.0864 8.61254 9.23103 9.7858 0 11.4649 8.49341 10.4485 8.64187 12.5483 8.80707 4.26933 8.15173 7.67136 6.63071 8.99707 10.3757 9.6374 11.6661 10.3375 A0A0B8RVG3 A0A0B8RVG3_PIG non-specific serine/threonine protein kinase (EC 2.7.11.1) STK10 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] plasma membrane [GO:0005886] ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674] AEVMEEIEDGR 1.5802 323.31 14.3015 13.1519 11.7319 12.6997 17.4585 13.9374 17.0368 13.8128 17.2088 13.5195 16.3457 11.2905 17.0181 17.108 13.5497 17.0282 15.2102 16.6815 12.8969 12.5572 11.8976 14.368 15.302 15.0609 11.0619 14.9817 11.7541 12.0737 12.2513 11.3061 14.2368 16.113 11.992 11.0359 14.2394 13.9727 12.9492 12.1004 14.9004 10.0136 9.47968 14.28 10.7561 9.87592 12.2617 10.8168 14.9684 15.2158 13.1705 11.8178 15.6247 15.2404 12.8239 9.95042 13.9457 13.5894 9.37134 10.7726 12.2545 11.1448 10.9945 11.0215 10.7191 A0A0B8RVG5 A0A0B8RVG5_PIG Suppression of tumorigenicity 13 (Colon carcinoma) (Hsp70 interacting protein) ST13 Sus scrofa domesticus (domestic pig) protein dimerization activity [GO:0046983] AFVKMCK 0.96691 318.61 11.4606 11.2709 11.5912 12.0132 12.5492 12.2138 12.527 12.7795 13.1983 14.4019 11.9163 11.9904 12.478 13.1856 11.6824 11.5371 11.4413 10.578 12.0806 11.8045 14.6293 14.5428 12.1859 12.1355 10.8159 11.3466 11.2421 11.5618 11.7866 11.813 11.9974 11.9404 12.1354 10.9123 12.2095 12.0053 12.481 12.457 11.3171 10.8951 10.9754 11.0528 10.4856 10.0812 10.5357 11.47 11.5222 10.7715 11.1134 11.0522 11.1747 7.76904 10.3905 10.8919 10.0178 10.7651 10.8811 9.79495 10.0168 8.94254 8.73654 9.10379 8.58575 A0A0B8RVG7 A0A0B8RVG7_PIG Snf2-related CREBBP activator protein SRCAP Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] ATP binding [GO:0005524]; ATP-dependent chromatin remodeler activity [GO:0140658]; DNA binding [GO:0003677] AEQEIAALVEQLTPIERYAMK 1.4144 323.31 11.4256 11.8591 13.3502 12.8528 13.2869 11.4472 13.0839 11.744 12.5985 10.9225 12.728 11.3829 12.8088 14.01 12.1626 11.9154 11.4037 12.7636 11.2391 13.8061 13.0535 12.2202 13.6704 12.9614 12.7736 12.3501 12.5847 12.8671 13.318 12.9284 12.1837 11.7459 11.5361 11.3356 10.5905 12.4279 11.5884 11.6903 10.9388 11.9293 10.2979 12.35 11.1337 12.0178 11.7937 11.5514 11.7943 13.5996 11.858 12.3557 11.0455 11.5869 12.4889 11.5683 12.7007 11.0689 9.63305 11.3931 11.0631 10.4246 10.1384 10.1836 9.75932 A0A0B8RVG9 A0A0B8RVG9_PIG Spermatogenesis associated 2 SPATA2 Sus scrofa domesticus (domestic pig) AAKDYYKPR 0.96601 270.28 10.5366 4.58093 11.0344 11.0305 11.9556 12.1823 11.2219 9.2057 10.6381 10.4838 11.3608 11.1233 12.1873 10.7872 11.0565 11.8971 9.87788 10.3429 10.8174 11.2019 12.0045 10.7273 12.0508 10.9048 10.216 9.29639 9.04682 11.5574 11.9287 11.6811 11.695 11.3584 9.31173 11.097 11.9037 11.2915 11.6288 11.9781 2.62656 10.1365 10.2401 10.4519 10.6412 9.88047 10.643 8.61464 11.3876 11.9974 9.82617 9.32159 10.9715 11.9791 10.9236 10.3613 10.4328 10.4416 8.85583 10.1865 10.2989 4.33578 9.52697 9.30506 9.40165 A0A0B8RVH1 A0A0B8RVH1_PIG Sortilin-related receptor (Low-density lipoprotein receptor relative with 11 ligand-binding repeats) (Sorting protein-related receptor containing LDLR class A repeats) SORL1 Sus scrofa domesticus (domestic pig) endocytosis [GO:0006897] early endosome membrane [GO:0031901]; endoplasmic reticulum membrane [GO:0005789]; extracellular region [GO:0005576]; Golgi membrane [GO:0000139]; multivesicular body membrane [GO:0032585]; plasma membrane [GO:0005886]; recycling endosome membrane [GO:0055038]; transport vesicle membrane [GO:0030658] AADLLLHSK 1.2673 323.31 11.8192 13.0848 10.373 12.7339 13.7692 13.1739 12.996 12.5017 12.9606 12.7369 11.965 13.0608 13.3006 12.3004 12.5822 12.8579 11.8255 12.1922 11.7784 10.7584 12.1669 13.6331 13.1163 13.1457 11.7938 10.4711 10.4192 13.1839 13.0113 12.6156 11.9776 11.0339 12.3963 11.3814 9.56094 11.0644 11.6515 10.4132 11.8525 11.4467 9.59982 11.7866 10.6102 11.4382 10.7674 9.73613 10.7399 11.387 10.7692 11.5056 10.781 10.1855 6.42541 10.5025 9.77882 11.408 11.2072 11.3824 10.7401 10.2167 9.72272 9.91024 9.80526 A0A0B8RVH3 A0A0B8RVH3_PIG Nonsense-mediated mRNA decay factor SMG5 Sus scrofa domesticus (domestic pig) "nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]" cytoplasm [GO:0005737]; nucleus [GO:0005634] AAHRHFNFDTDR 0.9635 317.32 10.935 10.1275 10.802 10.3311 10.6604 11.6013 10.529 10.2194 3.84449 10.7026 9.44812 10.6627 9.24046 10.7156 11.7283 9.40729 9.35922 4.21078 9.38795 12.0266 10.5195 14.0883 10.0268 8.40182 9.88519 12.2762 8.60159 13.6446 9.41853 10.6001 10.7834 12.5518 11.358 8.84759 2.48021 9.79695 12.3059 8.36663 11.2712 12.0392 9.38995 10.0407 8.57467 8.4245 8.18383 10.6722 12.6976 10.3242 10.2476 10.3485 14.1498 10.613 9.41037 8.83017 6.1222 12.7868 12.8053 10.0579 10.7943 10.1223 9.47131 9.86433 9.8034 A0A0B8RVH5 A0A0B8RVH5_PIG Mothers against decapentaplegic homolog (MAD homolog) (Mothers against DPP homolog) (SMAD family member) SMAD2 Sus scrofa domesticus (domestic pig) regulation of DNA-templated transcription [GO:0006355] cytoplasm [GO:0005737]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667] DNA binding [GO:0003677]; metal ion binding [GO:0046872] AIENCEYAFNLK 0.95688 106.24 9.06439 11.4491 6.21064 10.1916 11.6993 10.3879 11.5934 8.37356 5.60389 5.3238 9.2764 11.0037 12.7056 12.894 6.43466 0 7.29131 9.12848 10.4919 7.89184 10.6268 8.96159 11.7084 0 9.68956 8.804 9.32285 0 6.45978 12.9403 9.29276 7.6178 10.6502 9.64438 0 8.94559 0 9.41796 10.611 9.21544 0 6.64292 11.8994 10.604 2.99483 0 12.8783 4.56169 11.7596 9.78803 0 10.9833 0 0 7.0899 10.6709 10.7096 10.6934 4.46068 10.6225 10.8714 0 11.3096 A0A0B8RVH6 A0A0B8RVH6_PIG "Solute carrier family 4 (Anion exchanger), member 1, adaptor protein" SLC4A1AP Sus scrofa domesticus (domestic pig) AKKLTLPLFGAMK 0.94832 255.94 10.1582 11.1943 8.59541 10.5218 0 10.8228 10.2677 8.64173 11.2898 12.0134 10.5109 3.42102 8.91746 13.048 11.0282 10.5046 11.7214 13.4784 10.5719 10.2716 11.1475 12.9751 8.63318 12.4641 10.7442 9.11897 0 9.57722 9.45133 7.0505 11.6693 11.0077 4.26776 6.37745 8.58139 8.56662 13.3665 8.73549 11.17 6.24977 9.84726 8.303 10.8227 9.62233 9.09664 7.74584 9.42968 12.6523 7.2914 12.6972 13.4272 10.8522 12.5454 10.8067 12.4357 6.56067 6.58757 10.9154 9.40516 3.82467 3.29324 8.98937 10.4428 A0A0B8RVH9 A0A0B8RVH9_PIG "Solute carrier family 35, member G1" SLC35G1 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] AIQIEKAGLVALMKTLEVVFAFIFQITFFNK 0.97253 85.171 7.01235 9.10001 12.3018 14.3973 14.3001 8.23376 11.2439 5.29946 4.37455 7.13873 0 0 8.50803 10.1466 8.14863 14.5874 5.48433 11.1772 7.96203 13.9875 4.4002 8.31963 8.43325 14.9984 10.5922 0 0 4.84202 7.76957 5.27187 13.4388 13.3209 0 0 5.40834 7.13103 6.71191 0 0 10.8381 0 2.4405 9.7845 8.55995 8.05154 0 0 6.45126 6.87024 6.57592 6.25569 10.4072 5.65972 10.6504 7.22313 6.23268 5.49448 7.49578 6.84549 7.43979 8.44878 6.14288 5.84715 A0A0B8RVI0 A0A0B8RVI0_PIG "Solute carrier family 2 (Facilitated glucose transporter), member 6" SLC2A6 Sus scrofa domesticus (domestic pig) carbohydrate transport [GO:0008643] plasma membrane [GO:0005886] transmembrane transporter activity [GO:0022857] DPHMYRPITIALVMR 0.96809 65.362 0 0 8.26083 9.3156 0 11.7293 0 9.27394 11.0958 0 0 9.57139 8.43108 10.8304 0 0 0 8.11666 7.65299 0 0 0 9.38024 0 7.51072 0 13.3607 0 9.06848 9.19131 6.93275 0 7.74376 0 11.7371 0 9.59457 7.18943 0 0 8.87427 11.0359 8.66156 9.08752 8.82947 11.3424 8.37286 8.19609 0 0 7.49522 0 0 0 0 0 0 0 11.2909 0 0 0 0 A0A0B8RVI2 A0A0B8RVI2_PIG "Solute carrier family 22 (Organic cation/carnitine transporter), member 5" SLC22A5 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] transmembrane transporter activity [GO:0022857] AAGLNGIVAPSTIFDSSELQDLSSKK 0.96392 82.289 0 9.27044 8.27966 9.71872 10.1992 9.14183 0 7.72178 0 0 0 0 8.50311 6.90014 7.32535 9.07369 9.9253 8.55236 6.2491 0 9.57626 7.1811 0 0 7.41109 6.46341 7.35957 8.12774 8.79948 8.91301 10.1331 10.4522 9.91552 9.01461 0 9.11017 8.17373 8.45487 0 9.07393 8.45816 9.62587 0 0 7.60837 9.11845 0 0 9.35101 8.2095 0 7.63967 7.50486 4.7252 0 5.37681 0 0 0 0 0 0 8.0705 A0A0B8RVI4 A0A0B8RVI4_PIG Spindle and kinetochore-associated protein 3 SKA3 Sus scrofa domesticus (domestic pig) chromosome segregation [GO:0007059] cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; outer kinetochore [GO:0000940] ALDGEDSDFEDYPLR 0.96241 174.68 10.476 9.75937 11.0796 12.0736 11.123 12.1925 11.0823 11.4608 12.2975 10.3623 10.4196 8.61217 11.2864 11.5374 12.2813 13.5839 11.2007 11.4212 10.9372 11.9346 11.2723 13.0963 9.87994 12.8465 8.55804 8.6643 11.4857 10.2097 0 9.7344 9.63427 10.1067 10.5704 8.3208 7.38016 0 8.43342 8.30811 8.42471 9.11189 13.8003 7.8767 9.24719 0 5.86357 7.34092 0 9.96356 9.81617 6.21298 0 9.72497 9.6661 8.19397 8.20496 8.26289 14.2192 0 4.30349 14.0806 8.15487 6.70072 14.3316 A0A0B8RVI6 A0A0B8RVI6_PIG SF3B1 protein SF3B1 Sus scrofa domesticus (domestic pig) spliceosomal complex assembly [GO:0000245] spliceosomal complex [GO:0005681] mRNA binding [GO:0003729] AALDEAQGVGLDSTGYYDQEIYGGSDSR 1.3196 323.31 9.99647 12.8439 5.48594 12.8466 11.1536 11.0061 10.9313 12.7039 11.121 12.6745 10.9026 14.1904 10.5379 11.984 12.0959 12.4973 10.5537 11.3346 10.7324 10.7249 8.53485 11.534 11.2358 11.5944 9.45164 10.8943 11.5533 10.2321 9.99845 10.8183 10.7414 11.1754 11.5945 6.64573 11.0992 8.34434 9.89043 8.53943 8.3199 8.8802 9.93915 10.768 7.54473 8.23021 10.7459 10.4829 9.64449 8.62812 9.88855 10.0593 8.6271 8.75802 8.82298 4.98039 10.3799 9.04958 9.50345 7.29389 7.7486 7.90611 8.26153 9.02882 8.66786 A0A0B8RVI9 A0A0B8RVI9_PIG Protein SDA1 SDAD1 Sus scrofa domesticus (domestic pig) protein transport [GO:0015031]; ribosomal large subunit biogenesis [GO:0042273]; ribosomal large subunit export from nucleus [GO:0000055] nucleolus [GO:0005730] AAAVSTSR 0.95556 321.73 11.5446 11.5933 7.30734 12.2063 12.3334 12.8928 13.0159 12.3722 11.466 8.04215 12.7329 6.67779 13.0284 10.8867 12.1943 12.0608 12.0248 11.7071 12.8847 8.69491 9.85017 11.8732 12.9117 12.893 8.9571 12.4824 11.9459 9.73686 0 11.7555 11.1903 10.3785 10.6585 12.431 10.9723 7.27006 8.37591 9.08709 9.68485 11.6871 10.8468 6.54925 0 10.4643 9.32977 10.2298 11.1027 10.1658 11.0144 10.4275 10.3393 11.8357 10.7044 10.5214 11.586 11.3397 9.38459 10.8839 10.9172 9.84456 7.37921 6.70833 9.87055 A0A0B8RVJ0 A0A0B8RVJ0_PIG "SAM domain, SH3 domain and nuclear localization signals 1" SAMSN1 Sus scrofa domesticus (domestic pig) AGKKYIK 0.96744 177.75 10.7586 7.25323 8.33271 8.54882 0 8.34234 9.12278 14.2658 0 10.4382 8.65076 5.70595 9.58916 8.31967 11.0507 8.29715 10.3375 7.98868 7.99594 10.1618 9.14774 10.6132 9.52972 9.1844 9.05436 8.18696 9.02951 10.5643 5.78816 12.4216 10.1059 0 11.2465 7.27072 9.87478 9.64245 7.0917 8.32278 5.81837 7.86518 9.72171 10.6382 9.28965 0 9.45572 0 9.61434 10.5248 10.4838 5.36447 5.75796 9.76002 8.28401 8.70027 6.82833 0 9.58361 7.4441 8.77745 7.73159 8.48196 11.0292 10.5253 A0A0B8RVJ1 A0A0B8RVJ1_PIG Ribosome binding protein 1 RRBP1 Sus scrofa domesticus (domestic pig) protein transport [GO:0015031] endoplasmic reticulum membrane [GO:0005789] AAAFEKQVLQLQASHK 1.3333 323.31 15.5062 13.1315 15.7656 16.1236 16.3196 16.2298 14.1938 15.9952 15.6608 15.8908 15.7555 14.0933 16.2219 16.0792 14.3071 15.9347 15.7222 15.0608 15.1388 15.0316 13.0178 15.3488 15.6014 14.8619 13.8325 13.1748 14.9511 15.1764 14.6875 14.4075 15.6591 15.8311 16.002 14.577 14.6357 13.8001 15.1217 14.9523 13.9059 15.3353 13.4949 15.313 15.1808 15.1666 15.3176 15.281 14.966 14.9607 15.6804 15.485 15.4151 15.4083 13.0598 15.4498 12.8044 10.8714 14.6804 14.9099 13.1133 14.4914 14.4979 14.3867 12.2996 A0A0B8RVJ2 A0A0B8RVJ2_PIG Large ribosomal subunit protein eL28 (60S ribosomal protein L28) RPL28 Sus scrofa domesticus (domestic pig) translation [GO:0006412] cytoplasm [GO:0005737]; ribonucleoprotein complex [GO:1990904]; ribosome [GO:0005840] structural constituent of ribosome [GO:0003735] ARNSFRYNGLIHHK 0.96095 108.3 11.0524 8.78699 10.9299 8.14155 8.27053 10.3726 0 0 6.80954 0 13.5567 8.64339 7.48301 11.1011 8.41912 10.7566 0 7.97143 0 0 8.13709 6.3911 0 14.3923 8.05213 7.70335 4.621 8.27956 7.2181 8.51061 0 12.2456 10.6168 10.5219 7.97321 3.69042 7.35359 9.53997 7.14883 0 0 0 0 10.2172 0 6.83289 4.55631 10.0154 0 6.79051 6.70363 9.63867 6.74645 9.20655 6.82998 8.79993 0 0 8.27952 8.35218 6.81224 7.83687 7.2971 A0A0B8RVJ3 A0A0B8RVJ3_PIG RING finger protein 145 RNF145 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] zinc ion binding [GO:0008270] AFLLSIILFIVVASILQSMLEIADPIVLALGASR 0.95763 166.77 0 9.69378 9.47488 6.97453 7.70002 10.2862 9.47427 7.68243 10.4237 7.10035 0 0 4.68852 7.40395 8.55585 10.4721 9.43382 9.3254 8.78274 7.89948 9.0018 7.69195 10.0034 7.62673 8.80629 10.224 6.73904 8.18493 0 5.17237 0 12.1808 9.47263 6.29142 8.32584 8.05202 0 7.11686 7.63008 0 10.0231 0 5.64363 7.61596 7.83346 10.1883 5.10308 7.80019 8.79523 9.06698 10.506 7.17712 0 0 6.95093 6.27107 5.59911 7.53294 7.72894 0 1.28582 12.1636 0 A0A0B8RVJ4 A0A0B8RVJ4_PIG Receptor expression-enhancing protein REEP1 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] ASGKHGQPK 0.95837 117.83 0 8.74598 5.98946 10.3701 12.0586 7.82687 0 12.4259 10.3347 8.50279 11.2853 5.2297 11.1049 9.8765 4.96102 0 8.45796 8.20672 7.71884 0 9.41007 6.49087 10.6241 10.3624 10.0791 0 0 0 0 7.06026 0 0 9.13661 12.5566 8.99698 0 9.07703 7.22448 0 0 4.68004 0 0 8.86719 0 9.76809 8.26172 0 9.60583 0 9.8142 4.44347 4.83961 0 0 9.55009 10.1938 6.62962 5.50281 0 0 9.8755 0 A0A0B8RVJ5 A0A0B8RVJ5_PIG RNA binding motif protein 19 RBM19 Sus scrofa domesticus (domestic pig) RNA binding [GO:0003723] AAAQKELSDMDYLR 1.3474 323.31 9.36741 8.12319 12.0289 12.6368 11.7612 9.01145 13.0832 13.1227 12.6351 12.01 10.9277 11.4297 12.3404 12.9617 13.1092 12.4953 10.7553 10.5084 10.7416 8.58429 12.4512 12.4649 12.2513 10.1923 11.6916 9.23453 10.7328 11.1682 8.23912 11.169 13.212 11.7395 12.4919 10.7576 11.0914 12.4572 10.6325 10.8119 12.1712 6.9364 11.1298 8.79045 13.2049 11.6567 13.1869 9.69035 9.4946 10.8684 11.543 10.8797 7.93852 7.81134 11.3023 9.86205 10.9224 10.7399 9.68408 11.7556 9.06172 8.67832 9.82888 11.4468 8.47269 A0A0B8RVJ7 A0A0B8RVJ7_PIG RAN binding protein 6 RANBP6 Sus scrofa domesticus (domestic pig) protein import into nucleus [GO:0006606] cytoplasm [GO:0005737]; nucleus [GO:0005634] AAACTTLGQMATDFAPNFQK 0.97112 315.38 9.09003 11.8036 9.73936 11.8145 11.571 9.5539 11.3713 13.2491 5.75136 11.1338 11.0824 9.37626 8.8587 13.751 10.8934 11.5445 11.4393 10.7301 10.9406 9.2957 8.15629 11.3849 7.81775 9.24043 0 10.6713 6.38738 7.39806 9.44259 9.76529 9.35557 6.23272 12.1638 10.7381 10.7112 8.66779 8.38465 9.93581 10.4037 8.57308 8.34087 7.18229 11.0596 9.15543 8.14843 7.09181 0 9.31198 10.0157 9.31701 8.86703 9.61939 8.52701 5.17951 10.0798 7.81385 8.55417 11.0634 9.02622 0 6.58822 9.17433 7.73998 A0A0B8RVJ8 A0A0B8RVJ8_PIG Ras-related protein Rab-8B RAB8B Sus scrofa domesticus (domestic pig) phagocytic vesicle membrane [GO:0030670]; plasma membrane [GO:0005886] GTP binding [GO:0005525]; GTPase activity [GO:0003924] AKTYDYLFK 0.95185 150.75 0 10.6344 11.161 10.4337 12.6146 11.7047 14.3754 13.0864 12.7669 11.0163 9.0694 10.7642 8.6642 11.3837 11.2662 0 10.4541 11.8823 10.0988 9.54772 9.76471 10.8764 11.3391 11.886 9.75467 8.76573 0 12.4181 15.1961 10.4397 12.4134 8.88783 11.346 9.29767 8.34674 4.89419 6.28664 9.53848 7.74403 9.40427 8.76059 8.9546 10.5525 0 8.24902 9.41659 12.0728 0 13.2909 10.7934 10.0943 10.3854 10.5451 0 0 6.32929 9.73281 0 0 9.50516 8.39438 9.42635 0 A0A0B8RVK0 A0A0B8RVK0_PIG "Protein tyrosine phosphatase, receptor type, O" PTPRO Sus scrofa domesticus (domestic pig) dephosphorylation [GO:0016311] membrane [GO:0016020] protein tyrosine phosphatase activity [GO:0004725] CKNRYTNILPYDFSR 0.95611 129.81 9.29267 0 9.6291 9.47727 10.8301 10.2768 10.8108 0 0 8.98385 9.22347 9.44547 8.51278 11.0139 9.73679 8.98371 0 10.6286 8.50108 8.20906 9.43854 9.59365 9.28473 5.55299 0 5.73601 8.59238 8.41498 9.51712 8.63699 0 0 0 0 0 0 3.3781 8.88047 9.18249 7.95414 0 0 0 0 8.35513 6.458 8.98979 3.96135 9.14356 6.38023 0 0 6.9364 0 4.16438 7.82674 0 5.95068 0 0 0 0 0 A0A0B8RVK2 A0A0B8RVK2_PIG Phosphatidylserine synthase (EC 2.7.8.29) (Serine-exchange enzyme) PTDSS1 Sus scrofa domesticus (domestic pig) phosphatidylserine biosynthetic process [GO:0006659] endoplasmic reticulum membrane [GO:0005789] L-serine-phosphatidylethanolamine phosphatidyltransferase activity [GO:0106245] ASCVGSR 0.95708 168.85 8.51979 9.90093 10.1695 10.9475 12.2774 11.5839 0 6.52677 8.06598 9.09017 6.41765 9.52419 0 6.23255 8.15821 7.95588 8.42152 9.50845 10.1088 8.28378 0 10.7071 9.48301 10.2825 8.42316 0 0 7.89597 8.41519 9.88548 10.6502 13.0295 0 8.82448 0 7.62015 7.86802 11.1352 9.86144 5.55115 3.88782 0 8.99268 7.73159 0 8.68134 7.46606 8.30405 8.75712 10.9378 11.2285 6.16426 7.94228 9.87613 1.43957 7.24451 6.31341 9.12673 8.30122 7.49378 8.38297 10.1893 6.26735 A0A0B8RVK4 A0A0B8RVK4_PIG Proteasome subunit beta PSMB2 Sus scrofa domesticus (domestic pig) proteasomal protein catabolic process [GO:0010498] cytoplasm [GO:0005737]; nucleus [GO:0005634]; proteasome core complex [GO:0005839] APFAAHGYGAFLTLSILDR 0.96612 161.98 10.8235 11.0541 11.1302 11.4158 11.7774 11.3951 11.42 10.88 11.3804 9.35733 10.8142 0 8.94351 0 11.8145 11.0608 11.0943 11.3977 8.34092 10.5494 10.9979 11.2734 11.2247 11.2055 9.53125 9.11699 9.52705 10.5011 10.8781 9.7491 11.2197 0 11.0827 9.39755 6.07722 9.94014 10.1328 11.1645 10.4418 10.0884 10.2127 10.0074 9.936 10.4355 9.35548 9.28695 10.3096 10.1968 9.915 9.73227 9.03417 10.1175 9.49007 9.70001 9.01812 8.08124 7.35235 0 7.00113 8.68972 0 8.17098 9.45315 A0A0B8RVK6 A0A0B8RVK6_PIG Protein kinase C (EC 2.7.11.13) PRKCI Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] cytoplasm [GO:0005737] ATP binding [GO:0005524]; diacylglycerol-dependent serine/threonine kinase activity [GO:0004697]; metal ion binding [GO:0046872]; protein serine kinase activity [GO:0106310] AASVLKSFLNK 0.92593 222.6 9.21332 11.5098 8.03221 11.0119 9.26151 8.32463 10.6782 11.9282 11.7455 10.3417 10.1687 6.77004 10.3972 10.4001 0 10.376 13.0129 0 10.6259 10.5941 9.25718 0 8.07671 11.0221 9.36122 9.22653 9.12758 10.0819 9.62642 9.94559 10.6769 0 7.93334 7.05517 0 7.9578 11.3305 8.04418 10.977 5.70462 6.67101 10.4244 0 9.34638 8.76255 10.5881 9.79954 9.97628 8.87836 10.3136 11.2501 9.41462 8.13232 0 10.9867 10.9546 7.33593 7.7911 10.9697 7.79162 8.23381 9.39277 9.46307 A0A0B8RVK9 A0A0B8RVK9_PIG Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma PPP2R3C Sus scrofa domesticus (domestic pig) regulation of dephosphorylation [GO:0035303] cytoplasm [GO:0005737]; nucleus [GO:0005634] metal ion binding [GO:0046872] AGPKCKQFFTAK 0.93909 253.88 11.1885 14.2205 10.0623 10.6188 11.0794 10.7272 8.30716 10.1972 9.74086 10.2596 9.83428 10.3349 11.0001 14.5818 8.65896 10.8542 14.0257 11.5558 10.8116 5.9216 12.0393 11.7405 11.4791 10.871 8.76271 6.93946 8.86734 7.88007 9.1728 15.1798 8.95768 10.0505 10.0573 8.28988 11.2805 9.53368 10.4115 0 7.32607 14.0393 6.41983 13.5311 7.97022 8.28411 8.27403 9.7799 8.99135 14.4053 14.3675 13.4138 0 6.33244 6.24791 9.51495 14.9452 15.8097 7.99492 16.8551 15.5252 10.5674 4.94753 0 14.4722 A0A0B8RVL1 A0A0B8RVL1_PIG DNA-directed RNA polymerase subunit beta (EC 2.7.7.6) POLR2B Sus scrofa domesticus (domestic pig) DNA-templated transcription [GO:0006351] DNA-directed RNA polymerase complex [GO:0000428] DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; metal ion binding [GO:0046872]; ribonucleoside binding [GO:0032549] AYFLGYMVHRLLLAALGR 1.3838 323.31 12.7774 11.1096 9.62996 11.5977 13.2093 9.43336 12.2021 12.2839 12.3978 12.1779 13.0829 11.7038 12.3361 9.36833 11.5701 12.1736 12.5446 9.36615 14.5126 12.2883 12.5612 12.212 11.6717 10.5354 11.3703 10.4346 9.00506 0 10.0765 12.2673 11.8344 12.1429 11.4537 9.19933 9.67848 9.11808 11.153 9.59369 12.098 12.0651 6.65735 9.95696 9.06304 8.02741 9.78205 7.60466 10.5072 10.4864 11.9157 6.48038 11.6793 9.61659 10.3267 6.72124 8.6586 11.1527 10.4586 7.01179 11.1924 6.45078 10.0489 9.7873 10.9326 A0A0B8RVL3 A0A0B8RVL3_PIG "Phosphatidylinositol-specific phospholipase C, X domain containing 1" PLCXD1 Sus scrofa domesticus (domestic pig) lipid metabolic process [GO:0006629] phosphoric diester hydrolase activity [GO:0008081] CTNIIAGDFIGADTFVSDVIR 0.96738 90.427 8.00203 9.35118 0 9.45648 10.4621 10.0118 9.10428 9.1259 0 9.09932 7.89427 6.91073 9.33646 8.71153 6.8591 9.93029 7.51924 0 6.93652 8.16098 10.506 9.15934 8.05186 6.71163 8.45746 8.41823 8.79669 9.68429 8.98843 0 10.2172 7.79025 7.05778 7.75442 7.69321 0 0 9.47648 0 7.69995 0 0 8.28221 9.39358 0 0 10.1152 8.01787 8.23707 2.10806 0 0 0 10.0508 4.27553 0 0 3.57797 0 0 0 0 0 A0A0B8RVL5 A0A0B8RVL5_PIG Platelet-activating factor acetylhydrolase (EC 3.1.1.47) PLA2G7 Sus scrofa domesticus (domestic pig) lipid catabolic process [GO:0016042] extracellular region [GO:0005576] 1-alkyl-2-acetylglycerophosphocholine esterase activity [GO:0003847] CYSPGRER 0.95823 153.67 8.43217 10.5593 10.9947 10.0478 10.9112 0 10.0524 10.0751 11.4016 6.35641 10.4203 5.91667 8.93573 8.86666 7.41253 10.1389 10.8814 9.32717 9.81208 10.0516 6.42413 7.55252 5.37483 9.44375 8.13981 0 9.96222 8.44944 9.50088 7.27156 9.58616 10.584 10.0782 9.83529 8.60825 8.8346 8.90454 9.28186 9.37027 0 0 7.59932 7.61294 8.50434 9.99661 8.04691 0 6.65707 6.50745 9.2787 9.61316 9.95168 10.0428 11.2426 8.57909 7.55819 7.12732 5.8535 9.23446 8.99684 8.22569 10.5132 0 A0A0B8RVL7 A0A0B8RVL7_PIG Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma (EC 2.7.1.149) (Phosphatidylinositol 5-phosphate 4-kinase type II gamma) PIP4K2C Sus scrofa domesticus (domestic pig) phosphatidylinositol metabolic process [GO:0046488]; phosphorylation [GO:0016310] endoplasmic reticulum [GO:0005783] ATP binding [GO:0005524]; phosphatidylinositol kinase activity [GO:0052742] AAHAAKTVK 0.92788 214.27 8.47561 11.5956 9.96447 12.8522 11.7264 12.6464 11.9099 10.4848 10.5483 8.67564 11.7362 11.1823 12.9313 12.5497 12.89 13.3902 7.97734 12.7577 8.44993 8.60526 10.8634 8.27757 10.6745 10.8438 10.7209 11.2525 5.25965 7.63865 8.06404 10.3659 10.5735 10.2425 10.6852 4.90048 4.76431 10.139 11.5681 10.3781 10.5736 9.04431 8.90869 10.0662 9.38007 7.85031 13.608 9.12415 8.09482 8.85041 9.87212 9.1993 8.93496 10.7087 6.322 5.86523 6.35324 0 8.39013 7.83485 9.4794 7.93746 8.48844 2.69035 6.1551 A0A0B8RVL9 A0A0B8RVL9_PIG PHD finger protein 1 PHF1 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] metal ion binding [GO:0046872]; methylated histone binding [GO:0035064] AGPWGRGLTSPGEAPEAGAR 0.96408 141.53 10.3274 0 9.81783 10.5434 10.8926 10.3309 13.0146 4.72917 12.971 10.3554 7.66028 9.62029 12.064 12.0324 10.043 8.70898 0 10.4012 8.50934 9.99365 9.94112 10.9523 9.43896 11.1217 9.37339 0 8.6945 10.9203 11.4059 11.5018 11.7782 11.8618 12.922 0 11.1152 11.1139 12.2144 11.003 10.8028 9.81493 0 8.79941 8.82225 0 8.61246 7.80877 12.4772 10.253 10.5229 10.5241 10.631 7.87197 9.5841 9.2446 8.56297 9.31316 8.7385 6.57622 10.131 8.69491 0 9.66612 9.21267 A0A0B8RVM1 A0A0B8RVM1_PIG "6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 3" PFKFB3 Sus scrofa domesticus (domestic pig) "fructose 2,6-bisphosphate metabolic process [GO:0006003]; fructose metabolic process [GO:0006000]" "6-phosphofructo-2-kinase activity [GO:0003873]; ATP binding [GO:0005524]; fructose-2,6-bisphosphate 2-phosphatase activity [GO:0004331]" ALNEIDAGVCEEMTYEEIR 0.93729 301.83 12.1813 11.3786 8.10685 11.0916 13.56 13.6424 13.7501 14.0989 13.8082 13.0244 9.38517 8.43779 9.76165 8.88594 13.9601 13.479 11.2656 13.4813 8.81909 9.38066 9.93221 13.384 14.5478 13.9093 12.6867 6.34843 8.49273 11.273 11.3206 7.08385 10.7998 12.7527 12.7161 10.4219 11.4478 10.9692 10.7176 12.3064 11.9951 10.8183 10.7036 10.2945 11.2598 9.49945 6.79649 10.6153 10.7459 9.54815 10.1148 13.0575 12.7927 12.0022 10.9886 8.6685 9.09035 10.5988 10.7361 8.22559 6.94474 10.972 9.95308 6.55912 9.48398 A0A0B8RVM3 A0A0B8RVM3_PIG Protein-serine/threonine kinase (EC 2.7.11.-) PDK3 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] mitochondrial matrix [GO:0005759] ATP binding [GO:0005524]; protein kinase activity [GO:0004672] AAPLAGFGYGLPISRLYAR 0.96619 198.63 8.15142 7.41785 7.10696 10.4379 11.0421 11.0753 11.2104 7.83706 10.8258 6.52991 9.89442 0 11.0909 7.81436 10.3486 5.73847 8.18036 7.39755 0 10.2486 10.2527 8.75164 3.75553 9.62908 10.2708 7.385 10.1845 8.12717 7.99447 10.3276 9.00893 9.36003 12.2954 8.96769 6.25793 0 10.479 9.11218 7.81698 0 9.91144 0 8.28771 6.3008 9.58291 5.24918 8.39926 3.211 10.7722 0 12.2606 9.99294 8.52966 7.96417 9.50281 10.2138 3.24341 8.95931 11.1665 10.256 0 6.76765 0 A0A0B8RVM5 A0A0B8RVM5_PIG Polybromo 1 PB1 Sus scrofa domesticus (domestic pig) chromatin remodeling [GO:0006338] RSC-type complex [GO:0016586] chromatin binding [GO:0003682]; DNA binding [GO:0003677] AACKLWDLYLR 0.98462 323.31 11.181 16.555 16.3124 13.7843 13.7325 13.4015 13.8032 12.8036 13.6925 14.145 17.1488 13.7928 18.68 14.4373 18.2759 18.5118 13.0413 17.7431 14.1499 13.0755 17.3647 17.9275 18.0263 17.7737 15.4485 12.0538 15.2411 16.8681 12.0853 16.6904 12.8528 17.2037 16.7752 12.0354 12.8817 12.3768 13.5148 13.087 15.1154 16.0576 15.7401 11.5381 16.1171 15.7708 15.643 16.6433 11.8739 16.2839 16.5688 16.4377 11.8708 15.3751 15.1384 15.2137 11.9127 17.0803 12.14 10.5298 10.1081 17.0881 12.8263 9.85565 11.9402 A0A0B8RVM7 A0A0B8RVM7_PIG Phosphofurin acidic cluster sorting protein 2 PACS2 Sus scrofa domesticus (domestic pig) AKDKDTEPK 0.93424 238.11 6.64559 11.4774 9.84031 0 11.0015 9.96036 13.0269 10.845 9.47958 7.98459 11.5467 10.3747 10.8913 10.2235 10.2609 9.56054 7.99022 12.0967 9.37284 6.67059 8.00377 7.38629 9.35711 12.5871 6.22178 6.30181 11.1476 5.6302 8.7067 8.35359 9.29175 2.66319 6.68538 5.97134 6.6089 0 8.78486 9.27608 9.93065 9.16569 8.9989 0 9.05327 9.8261 10.468 10.3585 5.89533 5.12536 0 9.0189 9.82051 7.82005 9.3758 10.1773 0 8.86102 9.24624 8.61254 6.18144 8.59746 0 0 8.45253 A0A0B8RVM9 A0A0B8RVM9_PIG Succinyl-CoA:3-ketoacid-coenzyme A transferase (EC 2.8.3.5) OXCT1 Sus scrofa domesticus (domestic pig) ketone body catabolic process [GO:0046952] mitochondrion [GO:0005739] succinyl-CoA:3-oxo-acid CoA-transferase activity [GO:0008260] AAETTVVEVEEIVDIGSFAPEDIHIPKIYVHR 0.93836 238.28 8.93779 8.22362 8.90758 13.119 6.05211 4.40456 11.3913 10.7018 11.2496 8.63677 10.5444 10.2053 11.495 10.016 10.8545 10.5431 9.33501 9.68701 9.61154 10.0728 9.62174 10.9385 10.9881 11.7538 9.13732 9.05675 10.1819 9.47165 9.78354 8.95245 9.94705 9.1712 9.7248 4.88723 6.62829 8.164 7.64954 10.1803 10.1182 6.14366 10.766 8.61912 8.67154 8.17083 7.96959 8.9982 9.60086 9.62974 10.8533 5.82372 10.5091 0 8.10675 0 5.56261 10.2469 10.0558 8.22265 8.47873 10.1439 8.33851 7.26922 8.18428 A0A0B8RVN1 A0A0B8RVN1_PIG "Optic atrophy 3 (Autosomal recessive, with chorea and spastic paraplegia)" OPA3 Sus scrofa domesticus (domestic pig) AVSTSKE 0.97193 86.895 8.29916 8.32778 0 9.55919 8.4959 8.60118 8.851 9.77175 0 0 5.33974 9.54778 0 11.1075 7.98225 0 7.97241 0 8.37047 0 10.872 8.51258 8.90941 7.67023 8.12422 5.65097 0 0 8.19923 7.44774 12.117 8.31759 0 7.9493 0 9.7008 0 9.63916 5.12371 7.80484 0 6.9697 7.60192 9.98057 8.63067 0 0 5.13525 0 0 7.68503 9.48037 7.72574 7.75542 10.8777 5.82222 0 9.94952 7.10455 5.14604 5.67211 0 8.28012 A0A0B8RVN3 A0A0B8RVN3_PIG Nucleoporin 54kDa NUP54 Sus scrofa domesticus (domestic pig) nuclear pore [GO:0005643] DAILAKWNQLQAFWGTGK 0.97436 181.5 9.28774 5.28274 8.83624 10.1067 0 11.9913 9.74851 7.63089 10.3947 11.0694 11.7264 8.39124 11.0474 10.0391 13.2331 9.49991 9.85988 12.2641 10.3259 11.9269 8.10166 10.9886 0 9.5405 10.4762 8.22612 4.613 0 0 6.98721 11.8024 0 10.525 7.31234 8.64389 8.39124 9.02959 5.09921 8.11718 0 9.99251 0 0 9.63744 9.94328 9.66993 8.73674 7.89912 9.31737 9.63592 8.99339 5.78542 6.96498 0 0 5.71732 3.85738 0 10.4536 0 1.90092 0 6.71425 A0A0B8RVN5 A0A0B8RVN5_PIG 5'-nucleotidase domain containing 2 NT5DC2 Sus scrofa domesticus (domestic pig) hydrolase activity [GO:0016787]; metal ion binding [GO:0046872] ALFNAQFGSIFR 0.93432 227.32 5.52441 9.86908 9.22692 11.9833 8.29618 0 11.9058 10.2566 8.92449 8.68692 8.18205 11.616 11.7898 9.72629 12.1165 11.1098 10.3485 14.3817 8.5871 10.0887 10.7591 11.0947 12.0193 11.0957 8.81442 7.16169 9.35418 10.2871 8.83952 9.15813 9.04851 9.28665 11.5023 4.92818 10.9287 9.83687 0 11.4869 11.5694 6.352 7.6343 9.05975 10.88 3.8543 9.04502 8.20858 10.381 8.49398 9.20755 9.76411 11.6715 0 10.0876 0 10.5998 9.50676 8.54851 7.13986 9.81562 10.2609 8.74113 0 9.76434 A0A0B8RVN8 A0A0B8RVN8_PIG "Nuclear receptor subfamily 1, group D, member 2" NR1D2 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270] AGTFEVLMVRFASLFDAKER 0.93434 253.47 9.72036 3.93885 6.97659 11.6023 12.2682 10.7506 10.7847 11.3608 11.9791 8.55029 8.51542 8.8631 9.6425 9.95144 10.7084 11.7689 10.7874 9.01519 8.89591 11.4742 11.5923 11.0853 10.0618 10.3185 10.2553 9.12394 10.5532 10.5129 8.70065 7.93393 8.57414 9.2281 10.0101 10.5853 8.557 8.92991 10.3882 0 6.57487 7.27286 10.3311 8.28854 5.061 7.52215 10.1347 7.79474 6.7211 7.8089 5.61642 9.89785 7.56636 9.66537 6.86814 10.4691 6.83048 7.48486 8.03122 9.86567 7.8495 8.07644 0 6.59367 7.49889 A0A0B8RVP0 A0A0B8RVP0_PIG Glycylpeptide N-tetradecanoyltransferase (EC 2.3.1.97) NMT1 Sus scrofa domesticus (domestic pig) cytosol [GO:0005829]; membrane [GO:0016020] glycylpeptide N-tetradecanoyltransferase activity [GO:0004379] AIELFSVGQGPAK 0.95376 160.21 8.49113 6.37922 8.32396 8.11629 10.8708 9.67044 10.2312 10.0239 10.1986 5.21894 9.07842 0 10.1223 11.1084 10.2422 6.24958 9.28063 7.42038 8.62121 0 0 9.11356 11.1722 0 8.37704 7.93121 8.20633 10.6083 8.79675 7.54697 8.73383 11.965 8.70013 0 8.53224 9.35526 9.7661 0 8.00574 6.77426 0 0 10.0213 9.50202 9.60513 6.76328 6.71987 0 0 10.3171 3.09808 10.4493 8.88026 9.84233 5.61674 0 0 7.28364 8.20823 0 0 8.19441 7.66626 A0A0B8RVP2 A0A0B8RVP2_PIG NEK6-subfamily protein kinase (EC 2.7.11.34) NEK6 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] centrosome [GO:0005813]; spindle pole [GO:0000922] ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674] CSLADFQIEK 0.96268 118.79 7.94638 9.33264 0 11.9907 11.9868 11.3094 11.343 11.73 0 8.19972 10.8656 10.7499 12.3962 8.7118 5.76463 12.0287 8.6146 6.80903 8.50708 11.7405 10.6767 9.24141 12.0078 8.81311 10.6582 8.84178 9.50416 9.08124 9.61982 0 11.5567 11.8347 8.24717 7.87369 8.436 5.45042 9.88449 0 7.337 9.47293 7.68657 7.74079 7.63778 8.8748 0 8.97347 9.85719 9.53164 5.83228 9.89441 8.71359 9.91442 8.7702 8.24065 0 9.0096 8.21335 12.6277 6.61715 9.40256 9.40367 5.10597 0 A0A0B8RVP4 A0A0B8RVP4_PIG Neurobeachin-like 1 NBEAL1 Sus scrofa domesticus (domestic pig) ACKNSICLDLSTNCLHGR 1 323.31 14.6056 12.2825 12.3492 14.7815 13.3453 13.4327 13.7552 13.0318 12.816 12.9797 11.8155 10.3496 13.5688 13.1802 12.4382 12.9361 15.0982 17.3955 12.2697 11.7969 12.0765 17.2167 12.7367 14.3364 12.3399 10.1916 11.683 12.1723 9.44717 15.0773 12.8923 14.8157 11.9942 11.1085 11.4424 10.1355 11.3554 10.942 11.506 10.7316 9.59539 10.0256 10.1317 14.1193 9.68196 10.7306 11.4976 11.5859 9.96622 11.9308 10.9498 10.7178 10.1311 12.4174 10.4827 9.13684 10.9931 12.4795 9.79972 8.96454 10.4152 9.62321 12.991 A0A0B8RVP5 A0A0B8RVP5_PIG NGFI-A binding protein 1 (EGR1 binding protein 1) NAB1 Sus scrofa domesticus (domestic pig) negative regulation of DNA-templated transcription [GO:0045892] nucleus [GO:0005634] transcription coregulator activity [GO:0003712] AKSEELAALGSQQPEK 0.95878 200.38 9.47395 11.0715 12.1442 9.58385 11.099 11.4833 11.6193 11.2209 12.2123 11.2282 8.01915 8.75762 11.9116 11.6335 11.2221 10.953 12.6736 11.8124 11.4797 11.4648 10.1887 11.6314 10.6791 12.401 9.45664 9.10792 10.7664 11.5181 10.6672 11.3639 11.0784 8.0486 11.1383 6.90833 7.46728 6.35542 12.2649 11.8794 11.65 4.32063 10.5331 8.42727 10.4012 9.02023 11.4391 10.706 9.56759 8.63085 10.6096 10.9715 9.11793 9.85587 10.0297 11.014 10.974 9.2461 10.1195 10.0311 8.6326 7.93109 0 8.70245 9.97513 A0A0B8RVP7 A0A0B8RVP7_PIG Myeloid differentiation primary response protein MyD88 MYD88 Sus scrofa domesticus (domestic pig) inflammatory response [GO:0006954]; MyD88-dependent toll-like receptor signaling pathway [GO:0002755]; positive regulation of canonical NF-kappaB signal transduction [GO:0043123] cytoplasm [GO:0005737] TIR domain binding [GO:0070976] CRRMVVVVSDDYLQSK 0.96432 122.61 0 11.3602 8.54404 13.3699 13.4871 13.4318 13.5234 13.2754 13.813 5.82446 13.2189 7.09972 10.656 13.6007 13.7388 13.4622 8.66764 13.4455 3.9814 9.14588 0 13.7961 13.5816 11.9109 12.5936 8.02708 10.5836 0 6.48863 9.77156 11.557 12.6725 6.62663 7.5598 8.27664 7.76188 8.5593 0 9.45611 0 7.92778 7.58391 2.79911 10.7346 8.38111 0 0 8.04652 12.694 12.5369 12.7606 7.79116 12.0329 11.7568 0 0 6.91707 0 8.43767 0 7.25739 0 7.03397 A0A0B8RVP8 A0A0B8RVP8_PIG Metal response element binding transcription factor 2 MTF2 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] metal ion binding [GO:0046872]; methylated histone binding [GO:0035064] AEKEPEGTSHEFK 0.94509 276.34 10.6912 11.753 11.6749 11.9154 10.5049 9.72368 11.4252 12.4816 12.1651 12.2229 11.1903 11.5501 10.9245 11.0702 13.401 11.4033 10.2639 9.69303 12.4414 12.2015 10.6641 10.8824 10.8477 10.224 11.9073 10.5004 10.7879 6.26697 14.0918 13.8201 12.8228 8.54624 11.834 3.9314 4.17608 9.95642 9.55488 11.9886 12.2702 9.7019 7.26407 8.86746 10.0779 8.81881 8.34643 9.13753 11.3636 8.1636 9.6565 12.3698 10.3475 8.22023 8.12578 9.76952 11.0317 10.1838 10.7909 8.83115 11.121 8.48494 9.08964 10.3681 7.80587 A0A0B8RVP9 A0A0B8RVP9_PIG Matrix metalloproteinase-14 (EC 3.4.24.80) MMP14 Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] extracellular matrix [GO:0031012]; melanosome [GO:0042470]; membrane [GO:0016020] metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270] ADADTMKAMR 0.93235 279.54 10.7482 9.82184 9.649 12.3953 13.0139 8.28549 11.6311 11.8511 11.2884 9.91003 9.61174 9.52052 11.7383 9.99294 7.51696 10.9585 10.5526 6.6879 12.9013 11.429 12.0318 10.3234 12.5761 13.5057 11.2292 12.22 12.5865 10.1055 11.1413 10.4777 10.9649 9.85985 10.922 9.71574 9.02744 8.76669 10.4453 0 10.87 9.33063 7.92719 7.23161 9.89292 11.6477 8.66199 9.20535 9.44547 10.0363 11.0536 10.7718 11.7947 8.02392 8.35667 0 11.3827 10.9334 8.04958 10.2397 0 5.35272 10.528 0 7.69237 A0A0B8RVQ1 A0A0B8RVQ1_PIG "Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A (EC 2.4.1.145) (N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa) (UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVa)" MGAT4A Sus scrofa domesticus (domestic pig) extracellular region [GO:0005576]; membrane [GO:0016020] glycosyltransferase activity [GO:0016757]; metal ion binding [GO:0046872] AASNKFSDDTLK 0.98273 192.63 9.93974 2.9164 6.65105 10.9628 10.7537 10.5767 12.1531 10.9443 10.1955 7.72472 10.0049 9.2635 11.2266 10.7079 11.6345 10.9564 10.5069 11.914 10.2954 11.0458 10.668 9.84013 12.5701 9.38254 10.047 11.1213 10.6442 10.4264 11.2441 11.6095 10.7666 9.89324 7.85742 8.23122 11.3133 7.55919 10.7782 12.2189 11.8357 9.07871 11.1248 8.43066 8.30693 6.51731 10.3047 10.7052 10.3002 10.3621 0 8.10276 8.16159 8.92475 8.74302 9.78403 9.6027 7.40514 11.4393 11.5882 12.1208 7.94457 10.113 10.0035 6.49732 A0A0B8RVQ2 A0A0B8RVQ2_PIG receptor protein-tyrosine kinase (EC 2.7.10.1) MERTK Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] membrane [GO:0016020] ATP binding [GO:0005524]; transmembrane receptor protein tyrosine kinase activity [GO:0004714] AEEGRYILNGGSEGWEDQASASLAPGPAGK 0.93253 246.74 10.0081 11.2384 10.847 12.9343 12.3902 9.56133 10.1235 12.4565 11.5989 8.84156 10.343 10.0174 9.94702 9.04677 12.0634 8.98812 12.1721 12.65 11.7918 9.52309 10.9229 9.98769 10.4156 10.1793 9.36704 7.31786 0 9.85142 9.0018 10.403 10.4093 10.7872 10.0945 8.70068 11.5363 8.45615 0 8.96849 10.1226 10.5663 10.7777 10.9069 7.89567 10.785 9.40646 11.5578 9.91076 9.69709 8.70639 10.0612 11.3739 11.5903 11.455 10.9771 12.2983 11.6958 10.8456 10.2432 9.78459 9.82617 9.58673 9.56461 10.4329 A0A0B8RVQ4 A0A0B8RVQ4_PIG Matrin 3 MATR3 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] RNA binding [GO:0003723]; zinc ion binding [GO:0008270] AVKKDANASASAASK 0.98084 323.31 6.98823 9.79529 8.45475 11.3734 12.3841 11.1827 13.1191 9.7754 12.7187 10.2198 10.0852 10.5416 14.6333 9.30563 10.693 11.2137 10.9895 8.46222 12.3674 10.1763 9.9129 13.136 12.6396 10.6752 9.13653 11.5959 12.1127 10.0088 10.5957 9.29776 11.6149 11.1981 11.0855 6.99435 10.4172 10.0174 9.51617 10.1746 9.97656 8.13781 9.97857 0 11.7484 10.8657 9.3168 9.7541 8.94342 9.45976 11.5398 11.1563 8.06883 10.5048 10.4116 7.87246 9.49911 6.23714 8.90201 9.09241 7.33905 9.50106 0 7.00158 4.98199 A0A0B8RVQ5 A0A0B8RVQ5_PIG Mitogen-activated protein kinase kinase kinase 8 MAP3K8 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674] AESLLLSGQEGPWLSSVR 0.95712 153.1 10.2655 0 4.02183 9.47828 0 10.0596 10.1566 6.24468 9.54168 8.72853 9.59608 3.77894 11.6421 10.1959 10.4193 9.07122 10.0158 9.79679 0 0 3.83734 10.4326 9.69926 6.91277 0 8.28276 0 0 10.3024 8.97401 0 9.28584 6.31281 9.37121 5.55977 0 10.6103 0 4.56016 10.5986 7.85854 0 10.3826 5.09955 10.0373 5.98882 0 0 9.92542 11.7772 3.46937 10.9476 0 0 9.0177 10.5359 6.25007 0 6.95035 10.3048 5.04317 6.84486 7.30597 A0A0B8RVQ6 A0A0B8RVQ6_PIG mitogen-activated protein kinase kinase (EC 2.7.12.2) MAP2K4 Sus scrofa domesticus (domestic pig) MAPK cascade [GO:0000165]; phosphorylation [GO:0016310] ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]; protein tyrosine kinase activity [GO:0004713] ALNHLKENLK 0.97561 183.9 13.9867 14.0382 14.1111 14.7951 14.6244 14.3815 14.927 14.972 14.9958 14.3118 7.659 12.201 12.6283 11.5237 14.8087 6.34234 14.5386 8.25366 10.1737 7.44386 0 0 0 11.8793 13.6303 13.1736 8.03886 14.7038 14.8076 14.9089 8.40378 11.4211 15.7553 14.5047 8.35244 14.613 15.1682 15.1325 15.26 13.4238 0 13.2616 12.6848 12.6841 12.6258 11.433 14.4475 14.2258 8.71912 14.1354 14.0531 9.14876 13.064 13.168 11.9377 8.22149 8.72106 11.467 11.5315 11.5793 10.3931 10.3601 10.403 A0A0B8RVQ8 A0A0B8RVQ8_PIG Tyrosine-protein kinase (EC 2.7.10.2) LYN Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] cytoplasm [GO:0005737]; plasma membrane [GO:0005886] ATP binding [GO:0005524]; non-membrane spanning protein tyrosine kinase activity [GO:0004715] AANVLVSESLMCK 0.975 264.95 7.88941 11.3944 10.733 11.4835 7.50048 12.5718 9.52636 10.505 10.026 8.49542 10.9393 9.63387 11.9658 11.0835 10.4427 9.37062 10.2667 9.21822 9.45135 13.7038 11.4409 12.9827 9.30565 7.88795 8.47784 7.03683 9.25569 9.03722 10.8082 12.6559 10.4291 13.6118 13.725 6.33004 10.368 9.46783 10.2849 10.3481 9.86528 7.06598 8.47962 9.09307 0 10.4959 9.15747 9.44031 9.51822 9.59563 10.4202 10.7363 8.48386 10.1864 9.17148 9.7198 7.8254 7.30597 7.92005 8.80436 9.55557 0 8.64461 8.07735 9.01931 A0A0B8RVR0 A0A0B8RVR0_PIG Leucine rich repeat containing 28 LRRC28 Sus scrofa domesticus (domestic pig) AAVSFVAYCCSTQCLQTFDLLS 0.95541 131.31 0 9.13699 8.76534 10.7061 9.68587 10.99 7.73512 11.3425 11.602 11.1756 9.60737 9.87687 11.0707 11.6759 11.4124 7.24631 8.97036 8.56468 10.3222 10.6684 11.5157 12.4199 11.9409 10.4556 8.09987 9.09516 9.2032 0 8.04821 11.8945 7.24451 7.89881 0 7.97516 10.1659 8.34877 11.0742 10.9613 6.88911 9.00991 5.04522 0 5.75796 10.8093 0 8.0881 7.50351 7.9279 11.2893 0 10.3676 0 5.3618 0 8.66906 10.014 8.09144 6.33181 0 0 0 5.68594 8.3127 A0A0B8RVR2 A0A0B8RVR2_PIG Leupaxin LPXN Sus scrofa domesticus (domestic pig) cytoskeleton [GO:0005856]; focal adhesion [GO:0005925] metal ion binding [GO:0046872] CISAMGYK 0.9567 103.67 7.89348 5.21894 0 7.7664 10.2244 9.39315 9.75108 9.2647 11.6009 6.29783 0 11.0152 7.16017 10.4489 9.92941 4.95424 0 0 6.58436 6.29502 9.00562 9.24729 0 5.73213 8.72904 5.1957 6.14278 0 7.69544 0 9.8892 5.06264 8.27212 6.4121 6.22537 8.82566 0 6.47432 8.72322 7.50946 0 5.98832 8.69964 9.08595 7.19643 0 0 9.25493 6.19928 0 9.91409 6.68299 0 8.35526 6.86505 7.4261 6.64861 4.03042 0 0 7.26059 0 6.4573 A0A0B8RVR4 A0A0B8RVR4_PIG "Lectin, mannose-binding, 1" LMAN1 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] AKIIYYQK 0.95833 169.52 6.12416 9.12709 10.533 7.95257 5.45963 0 8.69683 7.63749 4.17808 10.3202 10.5429 3.94972 9.54961 8.56373 9.76085 0 9.7416 9.35363 9.143 7.11155 12.8379 10.6906 8.07361 7.60222 9.97341 9.21053 9.35381 11.2069 10.1533 9.51019 11.0455 0 0 5.42287 9.83753 0 10.7102 0 3.87912 7.66156 0 8.30597 7.80465 10.1124 10.5355 8.20144 0 10.1994 12.1837 8.36746 9.77931 9.50851 0 5.44679 3.36499 5.0688 0 7.82826 9.35738 3.40722 0 0 4.23986 A0A0B8RVR6 A0A0B8RVR6_PIG Leptin receptor overlapping transcript-like 1 LEPROTL1 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] LVDDTDAMSNACK 0.99337 10.083 0 0 0 6.57711 5.20054 0 4.70835 0 0 0 0 4.87745 0 0 0 5.54257 0 0 0 1.40746 0 0 6.95047 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5.543 0 7.14812 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A0B8RVR8 A0A0B8RVR8_PIG Histone-lysine N-methyltransferase (EC 2.1.1.364) KMT2A Sus scrofa domesticus (domestic pig) methylation [GO:0032259]; regulation of DNA-templated transcription [GO:0006355] histone methyltransferase complex [GO:0035097] DNA binding [GO:0003677]; histone H3K4 monomethyltransferase activity [GO:0140945]; histone H3K4 trimethyltransferase activity [GO:0140999]; zinc ion binding [GO:0008270] AASMQVEGSAKELQTPR 0.99225 323.31 14.9093 13.8409 14.354 14.2766 15.5349 14.1775 15.3006 16.0629 13.9164 15.5048 14.9778 14.3493 17.2564 17.531 15.4901 15.5551 14.0865 14.7379 13.1451 14.2826 14.6275 12.9294 14.1208 15.0033 16.0071 13.3439 15.9273 14.1567 13.0173 13.3068 14.0535 12.273 12.6778 13.884 14.1083 14.1873 12.8291 14.522 14.0771 12.8344 13.5891 13.0242 12.685 14.1185 17.1314 13.4675 13.5957 12.6094 13.5517 12.0664 12.2175 13.0606 13.2257 13.3112 12.8396 13.2191 11.297 12.8307 12.8237 12.3641 11.7176 11.21 12.4966 A0A0B8RVS0 A0A0B8RVS0_PIG Kin17 DNA and RNA binding protein KIN Sus scrofa domesticus (domestic pig) CHCMSESHQR 0.9472 286.04 9.94361 12.505 7.46818 8.5627 14.3837 9.81769 10.3381 11.1841 11.0057 9.0618 10.5152 10.0362 11.6604 10.1683 12.0168 10.8366 10.9662 8.12944 5.24302 4.40054 11.0505 6.86839 15.1457 11.2588 10.16 9.84381 11.7321 9.77136 8.63898 10.5851 8.25338 13.6049 9.81036 10.2855 9.47729 10.9529 5.81931 10.1511 6.15389 10.445 9.72635 8.55662 10.1033 11.6457 8.06657 8.59328 10.4916 10.0006 13.467 8.34425 6.87946 10.7327 8.39913 9.72033 7.78771 10.1673 12.2814 8.22665 9.85498 7.20516 11.7117 11.3128 10.3425 A0A0B8RVS2 A0A0B8RVS2_PIG Proteasome-associated protein ECM29-like protein KIAA0368 Sus scrofa domesticus (domestic pig) proteasome assembly [GO:0043248] cytoplasm [GO:0005737]; proteasome complex [GO:0000502] molecular adaptor activity [GO:0060090] AAELALK 0.97338 323.31 10.8198 10.256 11.5902 11.5426 11.9287 11.2063 10.9722 12.7687 10.1009 11.9409 9.34868 10.9662 10.6624 12.0397 12.0511 10.5605 12.3278 10.3474 11.4906 12.1339 11.0581 12.6321 12.4309 11.2899 10.9823 11.9677 11.3931 12.6547 9.67476 10.4767 11.2123 11.6171 10.863 10.5137 10.0304 7.81314 11.919 12.3225 11.4045 8.77962 10.4379 9.82877 9.752 11.2845 12.8236 10.6878 10.3924 11.5912 9.58971 10.8311 11.7291 11.2864 10.3437 9.40746 11.6422 6.73796 8.35513 10.3669 10.1231 11.6451 12.1483 10.9276 11.5824 A0A0B8RVS4 A0A0B8RVS4_PIG [histone H3]-trimethyl-L-lysine(4) demethylase (EC 1.14.11.67) KDM5A Sus scrofa domesticus (domestic pig) methylation [GO:0032259] nucleus [GO:0005634] DNA binding [GO:0003677]; histone H3K4me/H3K4me2/H3K4me3 demethylase activity [GO:0034647]; metal ion binding [GO:0046872]; methyltransferase activity [GO:0008168] AAAAKVELVKESSEK 1.0199 323.31 12.8267 14.8271 12.2648 14.7023 13.462 13.6984 14.4062 14.7267 13.1667 14.5787 11.5095 12.1773 12.5906 12.491 13.6741 12.0326 12.8058 11.4534 12.1201 10.8153 12.2632 13.137 13.5735 14.8776 10.8096 12.2219 12.5844 13.451 12.9305 11.2389 11.7916 13.7699 12.6195 11.5406 9.86924 12.1737 10.9231 14.5277 11.7246 11.4353 10.176 11.5891 12.4228 10.23 10.2987 10.0286 10.5548 10.7111 11.6354 13.0255 11.4347 11.3705 12.2843 12.3709 12.1231 11.4233 11.7293 10.8059 10.7042 10.1549 10.3478 10.9987 10.9949 A0A0B8RVS6 A0A0B8RVS6_PIG histone acetyltransferase (EC 2.3.1.48) KAT2B Sus scrofa domesticus (domestic pig) regulation of DNA-templated transcription [GO:0006355] centrosome [GO:0005813]; nucleus [GO:0005634] histone acetyltransferase activity [GO:0004402] CANILEK 1.0039 323.31 11.4069 11.8861 11.6416 12.6131 10.928 12.7867 13.4713 11.706 13.2496 12.5626 12.6224 12.4689 13.1823 13.611 12.7029 12.4048 11.744 12.6815 11.5397 11.8603 12.0741 13.6022 12.8687 12.9311 9.89467 11.2636 11.6847 11.899 12.0967 11.2376 12.2194 11.9 13.0274 0 11.4466 11.6356 11.3079 11.1042 11.2953 10.2656 9.02699 10.6029 10.4593 10.6886 9.86864 12.0116 12.1047 11.4206 12.3905 11.9632 9.72872 11.132 11.382 11.4582 8.65281 11.4764 11.6465 9.31732 10.0564 10.3073 9.5907 2.59934 7.08555 A0A0B8RVS8 A0A0B8RVS8_PIG Jumonji domain containing 4 JMJD4 Sus scrofa domesticus (domestic pig) DTMPDWHHHCQVIMR 0.95963 114.75 6.73254 9.98042 6.05394 11.9925 9.01895 10.8389 6.71411 0 6.89869 9.38506 6.0993 0 10.7614 7.22651 6.92955 0 6.66803 10.2336 10.4987 9.45477 5.39427 7.57713 12.0892 11.5856 7.03375 3.30422 7.54117 6.44419 6.90605 8.85175 9.95905 6.65693 10.5382 0 0 3.62188 0 0 10.0658 0 0 0 0 0 0 0 0 8.08852 7.81634 5.59291 9.37158 0 0 0 0 4.72356 8.80038 0 0 0 6.29965 0 0 A0A0B8RVT0 A0A0B8RVT0_PIG Inositol-3-phosphate synthase 1 (EC 5.5.1.4) (Myo-inositol 1-phosphate synthase) ISYNA1 Sus scrofa domesticus (domestic pig) inositol biosynthetic process [GO:0006021]; phospholipid biosynthetic process [GO:0008654] inositol-3-phosphate synthase activity [GO:0004512] ACLGLPPQNHMLLEHK 0.95688 127.72 0 0 7.95582 6.55836 0 0 9.35535 7.34225 7.49458 0 9.06813 0 10.5434 12.3368 7.94971 10.7028 7.44997 7.62688 9.25637 10.8032 0 8.98231 10.9575 10.62 8.2148 9.73579 7.35368 7.49153 8.87796 9.06337 10.1577 7.12247 9.84634 5.19239 9.06563 10.3514 7.10884 11.0399 8.14165 10.3919 0 7.393 7.03903 8.90557 7.73491 0 7.47889 0 7.26997 7.15684 8.25913 8.42156 0 7.108 5.93126 8.48856 0 0 0 0 9.6127 6.32159 0 A0A0B8RVT1 A0A0B8RVT1_PIG Importin 8 IPO8 Sus scrofa domesticus (domestic pig) intracellular protein transport [GO:0006886] cytoplasm [GO:0005737] small GTPase binding [GO:0031267] ALQEVYTLAEHR 0.9771 323.31 7.57372 8.11108 8.80478 10.4931 12.3146 11.0329 7.3046 10.7282 10.6881 10.06 8.90238 9.41597 10.8632 10.4635 10.269 11.9758 11.4222 9.90946 9.03265 8.88551 9.3178 9.23683 6.24943 10.9999 8.77979 9.34924 10.1427 10.3692 9.62901 6.4108 10.3726 8.90479 9.41614 5.86094 9.15697 0 11.3491 11.3142 8.97335 10.3854 7.9241 9.66594 10.0125 10.3982 9.46015 8.96561 9.69853 10.2042 10.9023 9.19815 11.6484 9.48657 7.90827 9.43033 9.85652 9.62322 8.81353 2.84543 9.70359 8.4412 7.02115 5.72604 8.13031 A0A0B8RVT3 A0A0B8RVT3_PIG Interleukin 1 receptor accessory protein IL1RAP Sus scrofa domesticus (domestic pig) inflammatory response [GO:0006954] membrane [GO:0016020] hydrolase activity [GO:0016787]; interleukin-1 receptor activity [GO:0004908] AGLENMASRGNINVILVQYK 0.93822 238.56 13.9086 11.2343 11.0982 12.3644 8.96408 9.78447 13.2465 12.756 13.0208 11.7473 10.0614 11.4575 13.1528 13.0248 13.0064 12.6442 12.3218 10.7058 11.0834 11.9129 12.2761 13.2088 12.8525 10.8059 7.80038 10.5032 10.2595 12.6053 12.4796 11.9111 10.4179 11.2177 12.2109 6.43099 0 10.3747 8.93629 10.0217 10.6782 11.5955 11.0226 10.7813 10.9352 10.3304 10.6541 11.9576 7.25597 11.4331 11.3087 9.84194 10.8917 9.77643 11.9608 10.2057 0 11.7473 11.4011 8.24854 7.36151 11.2423 11.1255 10.9854 10.4955 A0A0B8RVT7 A0A0B8RVT7_PIG Insulin-degrading enzyme IDE Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222] AEGPQEWVFQECK 1.6101 323.31 14.0694 13.9049 13.8162 16.3187 12.9776 13.551 16.2959 16.0653 16.2076 15.7883 15.3305 15.4322 16.4285 16.4145 13.9695 13.5398 15.9139 15.7106 14.1929 14.8391 14.1948 13.3526 13.9069 15.9784 14.2242 11.5474 12.2153 12.1311 11.9413 9.83306 14.6977 13.1628 14.8488 11.2471 12.4427 10.1297 11.987 13.5775 13.805 11.9648 13.4759 11.5382 12.7626 11.1417 11.7355 13.7783 11.1914 13.6904 14.7434 14.3324 12.5242 12.3214 12.389 11.5481 13.2023 12.9276 13.2216 13.5392 12.9377 10.7195 10.7466 12.4179 9.67962 A0A0B8RVT9 A0A0B8RVT9_PIG Histocompatibility (Minor) 13 HM13 Sus scrofa domesticus (domestic pig) endoplasmic reticulum membrane [GO:0005789] "aspartic endopeptidase activity, intramembrane cleaving [GO:0042500]" DLVCLGLSSIVGVWYLLR 0.96911 77.781 10.2427 7.84185 7.55036 8.06733 10.3919 10.1094 12.1648 12.4535 11.825 10.6512 11.3636 11.4637 11.3738 12.0891 11.4419 0 9.44122 10.0215 12.512 10.3981 7.3231 0 11.7759 11.9665 10.5994 8.63507 11.2257 12.5481 0 9.95489 9.00259 10.0294 10.555 8.80787 7.08076 8.98291 9.64546 0 0 8.70698 0 0 0 0 7.0555 6.87823 8.36023 7.1102 9.00183 11.0946 10.6277 3.80766 0 6.70529 9.50464 8.95681 9.52789 7.54574 6.59991 0 0 0 0 A0A0B8RVU1 A0A0B8RVU1_PIG Homeodomain interacting protein kinase 1 HIPK1 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; DNA binding [GO:0003677]; protein kinase activity [GO:0004672] ADRREYIDLLK 0.95716 161.33 10.6242 9.82553 11.4127 11.2422 10.5188 0 0 9.49767 10.5125 5.07758 9.63052 8.87931 7.73491 10.5188 10.2109 10.0403 0 10.483 10.5453 10.157 8.27905 7.39369 8.60611 9.72579 0 5.44765 9.26444 9.16184 5.19979 0 8.51562 7.19672 9.00023 0 7.80012 4.51431 8.34292 6.78254 0 10.263 0 7.10873 0 9.30884 6.38289 9.37421 0 0 0 8.4575 7.66988 0 0 8.72877 6.60257 7.34403 6.80735 4.41061 0 0 0 7.35667 3.95149 A0A0B8RVU4 A0A0B8RVU4_PIG HECT domain containing E3 ubiquitin protein ligase 4 HECTD4 Sus scrofa domesticus (domestic pig) ubiquitin-protein transferase activity [GO:0004842] ADLIDAAGSSLGR 0.32692 323.31 12.833 11.7068 12.4657 12.4832 13.9618 12.6127 12.2871 12.8283 11.818 13.5491 11.9031 12.1916 13.7563 13.2408 14.0264 12.8338 13.2284 11.7638 12.889 12.6548 12.753 12.3701 13.4156 13.0293 12.0202 9.66802 11.237 11.6101 11.7214 11.9224 12.958 12.3166 13.4836 11.285 12.2246 11.0291 12.0758 11.7889 11.7928 11.9295 11.5334 11.1927 11.7925 12.5375 11.3225 10.7001 12.1048 11.0105 11.814 12.3751 11.2059 11.9446 11.1899 12.783 10.1384 10.8532 10.6016 8.43646 11.27 7.49602 9.17283 11.0667 10.6693 A0A0B8RVV1 A0A0B8RVV1_PIG Histone deacetylase (EC 3.5.1.98) HDAC7 Sus scrofa domesticus (domestic pig) negative regulation of transcription by RNA polymerase II [GO:0000122] histone deacetylase complex [GO:0000118] histone deacetylase activity [GO:0004407]; metal ion binding [GO:0046872] ASLEELQSVHSER 0.92889 235.18 7.37643 7.49578 11.1754 9.61557 10.5036 11.3148 12.0259 11.6417 12.28 11.4825 11.5426 12.2345 3.59156 11.392 11.7363 13.3366 13.6151 11.5045 8.51227 10.4019 9.80006 13.2338 13.198 9.96459 9.6835 9.49059 10.6831 8.60511 8.70172 6.13467 12.3453 5.38374 9.50875 9.75017 10.706 9.84101 9.68615 9.01617 10.4103 10.5144 9.45986 5.97074 8.73914 10.1675 9.69683 9.41126 9.3932 10.2633 10.1 10.7852 11.5323 9.97241 9.20699 10.2691 6.48755 9.59541 9.27296 11.6523 10.1375 2.45233 5.82823 6.4595 8.40459 A0A0B8RVV3 A0A0B8RVV3_PIG GTP binding protein 2 GTPBP2 Sus scrofa domesticus (domestic pig) GTP binding [GO:0005525]; GTPase activity [GO:0003924] ASLKTLHR 0.92927 215.91 10.0278 10.544 10.201 10.1689 9.41749 12.4014 5.90116 8.82623 10.9489 6.12889 12.53 2.59567 11.681 9.15932 10.8276 7.21082 10.2232 12.2414 8.40642 9.58673 9.42188 9.31881 7.97309 10.8953 0 9.26416 6.01246 9.91755 11.085 9.10839 12.0842 12.7622 12.1522 11.0505 11.3383 10.9856 11.616 11.7488 3.83289 10.7403 9.09901 8.40493 12.4353 10.3207 8.67719 0 10.3911 10.0728 9.23802 11.0258 10.6465 8.58301 0 6.56884 10.0853 9.0082 8.9287 0 6.83567 8.77297 8.01659 7.72219 7.61397 A0A0B8RVV7 A0A0B8RVV7_PIG Integral membrane protein GPR137 GPR137 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] ACYNLAALALAPR 0.9675 67.478 10.9734 8.97536 2.07639 7.0468 7.45582 0 7.29774 10.6705 7.36335 7.07189 0 10.7109 9.04756 9.71685 8.11187 0 0 0 5.41893 0 0 8.46532 5.2718 0 7.20506 0 5.95347 8.90041 0 8.07334 5.6444 0 5.01176 0 7.87055 8.57221 4.29175 5.77365 5.20406 6.81967 0 5.26491 9.0598 7.39489 7.34456 4.53288 8.4195 0 5.05107 0 0 0 0 0 4.46558 7.67553 6.33099 10.0575 0 7.29627 0 0 3.0927 A0A0B8RVV9 A0A0B8RVV9_PIG Golgin B1 GOLGB1 Sus scrofa domesticus (domestic pig) Golgi apparatus [GO:0005794]; membrane [GO:0016020] AAAEEQLQAVVK 0.62963 323.31 13.2193 13.3767 14.1089 14.7351 15.4888 13.9167 15.5441 14.7648 13.7678 14.1988 13.4272 13.126 14.9858 15.4713 15.2857 15.431 13.8639 15.0208 14.9427 14.696 14.4469 15.4142 14.7175 13.3301 13.8668 13.2786 13.607 13.3478 15.8454 13.635 14.1354 14.0025 14.136 13.1382 13.501 12.8072 13.3775 14.4597 14.3693 12.0461 12.4867 13.3202 13.6309 12.7496 13.5373 12.9011 12.7132 11.852 14.4062 13.5734 12.6514 12.9101 12.9824 13.0891 13.009 13.3855 13.3334 12.8396 12.6017 12.5995 12.0508 11.47 12.4395 A0A0B8RVW0 A0A0B8RVW0_PIG "Guanine nucleotide binding protein (G protein), gamma 12" GNG12 Sus scrofa domesticus (domestic pig) LTLPERK 0.98134 36.24 9.3107 0 10.1356 0 6.00762 0 0 9.39146 0 0 0 0 11.4635 0 0 5.08789 0 0 0 0 0 0 0 0 0 0 0 10.9584 10.5689 9.50631 0 0 0 0 0 0 6.29558 9.16774 6.37064 0 0 0 9.76447 0 9.8107 7.5411 9.49352 9.0608 0 8.97401 0 0 0 4.39266 15.0316 8.47228 7.11562 0 0 0 0 0 0 A0A0B8RVW2 A0A0B8RVW2_PIG Golgi apparatus protein 1 GLG1 Sus scrofa domesticus (domestic pig) Golgi membrane [GO:0000139]; microtubule organizing center [GO:0005815] ACKADIPK 0.62195 323.31 12.5068 9.03284 14.1433 12.0534 13.4168 13.8244 13.8841 12.2301 12.7235 13.3081 14.3402 13.4767 13.825 13.5058 14.9884 12.1861 13.467 13.5356 13.7592 13.7859 12.9999 14.3144 14.1126 14.0856 11.6399 13.0667 12.896 12.3358 14.3889 10.0218 10.3174 11.2525 12.344 10.6408 9.0187 10.3834 12.4119 12.325 12.3025 11.367 10.5526 11.7306 10.6687 11.3314 11.5153 11.5667 12.1861 12.1968 13.038 12.1891 12.257 8.83412 11.7178 11.6534 13.1036 10.4774 11.3925 10.5115 9.88698 8.43325 9.47853 10.5786 10.564 A0A0B8RVW3 A0A0B8RVW3_PIG GRB10 interacting GYF protein 2 GIGYF2 Sus scrofa domesticus (domestic pig) AALSSQQQQQLALLLQQFQALK 0.61446 323.31 12.9311 10.6332 11.9142 10.9156 11.2503 12.7954 12.6333 12.6458 13.0365 12.2379 13.2196 12.1452 12.8089 13.7404 12.0062 11.1579 10.8794 11.3513 10.3358 10.7432 13.6505 12.5784 12.86 11.3375 10.3542 12.154 10.9748 11.1622 11.4053 9.56904 12.1909 12.4397 13.2099 11.417 11.2878 12.6989 12.1675 10.79 11.1309 14.7845 11.078 11.8577 11.431 10.0835 14.1702 10.5173 12.0625 10.4658 11.6989 12.7292 11.1575 9.37983 10.1736 10.898 15.6907 10.4174 5.91765 11.3206 8.40242 8.77383 11.2732 4.37865 8.51357 A0A0B8RVW4 A0A0B8RVW4_PIG Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49) G6PD Sus scrofa domesticus (domestic pig) glucose metabolic process [GO:0006006]; pentose-phosphate shunt [GO:0006098] glucose-6-phosphate dehydrogenase activity [GO:0004345]; NADP binding [GO:0050661] AEQVALSR 0.93134 281.92 12.6387 11.0757 13.1237 15.6169 12.3667 12.6371 12.8558 15.2056 12.7551 13.7779 12.3138 12.3891 16.3111 16.0623 14.9466 12.3695 15.0484 12.0444 17.0389 11.769 11.9287 11.8235 12.3616 12.8317 15.8301 14.0116 14.2388 11.9746 11.5344 12.8844 12.6261 12.3579 11.855 12.4561 12.6534 12.3377 12.8685 13.0404 13.2538 13.645 12.4063 12.3712 16.6341 16.815 16.7704 13.0328 12.184 11.9257 12.3965 13.4059 13.255 12.5809 12.7812 9.9911 12.7306 12.7846 12.6837 11.6387 11.737 11.4559 13.8145 12.07 11.7624 A0A0B8RVW6 A0A0B8RVW6_PIG Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha (EC 2.5.1.58) (EC 2.5.1.59) (CAAX farnesyltransferase subunit alpha) (FTase-alpha) (Ras proteins prenyltransferase subunit alpha) (Type I protein geranyl-geranyltransferase subunit alpha) FNTA Sus scrofa domesticus (domestic pig) protein prenyltransferase activity [GO:0008318] ALELCEILAK 0.95387 151.91 11.5699 0 11.0737 13.1045 13.4376 12.7975 12.6282 13.2231 13.1203 0 12.0691 11.4209 11.0359 12.443 10.7616 12.7515 12.9755 12.3772 12.0134 10.7773 11.0488 12.7569 12.4594 11.7027 0 7.37816 8.66224 9.89535 9.87406 0 11.7016 10.6759 13.0883 8.67253 10.4711 10.8852 6.11395 9.66986 0 10.0375 9.79103 8.99101 7.83086 0 6.66505 10.5699 2.29857 8.61886 10.8411 9.04207 9.18428 10.861 10.945 10.6943 6.4692 9.40822 8.80523 9.67654 9.71246 9.32242 9.62739 9.66528 5.46218 A0A0B8RVW7 A0A0B8RVW7_PIG Protein adenylyltransferase FICD (EC 2.7.7.108) (AMPylator FICD) (FIC domain-containing protein) FICD Sus scrofa domesticus (domestic pig) membrane [GO:0016020] ATP binding [GO:0005524]; nucleotidyltransferase activity [GO:0016779] AHKLFLHALK 0.95892 143.56 9.91178 10.6053 8.69669 11.3439 6.77215 11.269 11.1933 8.24892 13.0159 13.0598 10.3377 9.41128 11.8017 9.01204 12.1297 10.8277 9.36207 12.3612 10.7321 10.4653 10.9212 9.10748 10.6469 11.1646 11.3469 9.40369 10.1946 10.9821 7.42375 11.4976 10.7988 6.79662 11.6435 11.0993 7.46769 9.73716 9.84111 11.7938 10.719 7.41354 7.9542 9.68869 10.2831 8.01324 0 9.9737 10.0565 10.4651 7.7198 10.0821 9.19439 8.06835 10.3786 10.7322 6.76168 9.51954 9.65143 9.2534 6.41806 9.34132 9.01447 8.10465 0 A0A0B8RVW8 A0A0B8RVW8_PIG DNA 3'-5' helicase (EC 5.6.2.4) FBXO18 Sus scrofa domesticus (domestic pig) ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; hydrolase activity [GO:0016787] AKGLEFDTVHVLDDFVK 0.94516 294.86 9.3875 10.4109 10.7213 12.4297 10.4731 7.62139 10.5071 14.9457 7.10192 11.4307 9.49203 9.43829 11.967 8.31863 11.9339 11.1437 7.27836 11.3358 11.1372 13.9449 11.1341 10.0437 11.3653 11.0182 9.8334 9.67566 8.97264 10.4185 10.83 10.6524 0 9.55042 10.3541 6.42496 7.25512 6.06003 9.18663 9.3926 9.52286 9.89166 0 0 8.07617 10.3452 8.69589 0 0 8.8695 8.55796 11.0262 7.1641 11.0607 10.7389 12.6727 10.512 9.52929 8.55551 9.79147 6.91097 8.9043 9.24786 0 0 A0A0B8RVX1 A0A0B8RVX1_PIG Constitutive coactivator of PPAR-gamma-like protein 1 FAM120A Sus scrofa domesticus (domestic pig) ACFGGNIELFVFFNGALEK 0.60714 323.31 11.2906 12.8074 13.0089 13.4762 12.8954 13.0953 13.2657 13.5907 12.9924 12.4754 12.5597 12.5118 14.5484 12.9485 13.7117 13.6563 12.5621 13.1482 11.4974 12.2793 11.4875 13.456 13.2305 13.6676 11.2687 12.2932 11.6567 12.1891 10.5233 10.6617 12.4869 12.4308 12.3483 10.2776 11.078 11.4755 11.8736 11.2189 12.2947 10.3944 10.6314 10.6595 13.8489 10.4368 10.4329 11.1157 10.6662 10.9747 12.2682 12.0942 12.9141 9.67288 10.6355 11.8658 11.0128 8.64965 9.50627 10.5108 9.82373 4.14364 9.97785 9.29062 5.18856 A0A0B8RVX3 A0A0B8RVX3_PIG Ectonucleoside triphosphate diphosphohydrolase 7 ENTPD7 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] ATP binding [GO:0005524]; hydrolase activity [GO:0016787] AMLNPLLAR 0.97076 170.83 7.69132 7.44352 9.53685 10.6023 11.0048 8.41105 10.7252 12.2734 5.49934 9.57577 9.97656 0 8.78018 14.8235 9.91542 9.42851 0 7.50208 9.49945 11.7947 9.81601 0 9.86431 11.3585 7.50478 13.1483 6.95117 8.02098 8.17448 10.1454 6.92505 8.17098 5.23959 7.69988 7.71074 0 9.27905 0 6.13289 10.8936 0 0 0 10.1397 0 7.99803 7.17213 3.62258 8.4424 13.1796 0 11.6166 0 8.84599 8.35804 9.255 8.87317 8.80832 8.23381 7.96457 7.49161 9.22292 7.62753 A0A0B8RVX5 A0A0B8RVX5_PIG Elongation factor RNA polymerase II ELL Sus scrofa domesticus (domestic pig) translation elongation factor activity [GO:0003746] CEYLHSK 0.95122 149.51 6.83226 8.0677 6.29396 10.8944 7.9952 10.3578 8.31773 10.6191 9.91356 8.80151 5.72836 10.4686 10.8888 9.7105 10.322 0 9.05012 5.40708 9.36503 6.57337 8.97665 11.8032 7.58097 0 10.4679 0 7.92955 6.50128 9.60413 0 13.3366 13.3419 13.4116 11.5966 11.5056 0 8.41659 10.4206 8.65542 8.59533 7.89251 9.91779 11.5954 8.82753 8.39348 9.34722 0 9.61774 10.8782 8.65349 9.98542 0 6.94825 7.48075 0 7.68285 7.46328 10.5546 0 9.40337 6.44095 8.06695 0 A0A0B8RVX7 A0A0B8RVX7_PIG hypoxia-inducible factor-proline dioxygenase (EC 1.14.11.29) EGLN3 Sus scrofa domesticus (domestic pig) "dioxygenase activity [GO:0051213]; iron ion binding [GO:0005506]; L-ascorbic acid binding [GO:0031418]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" AGVSKRHLR 0.96093 116.08 9.2987 5.21812 9.84684 7.67207 8.89118 10.581 13.044 8.81375 10.4766 10.0493 8.1036 3.14682 9.51832 9.31159 10.7071 6.59002 0 0 8.5844 9.05907 10.2312 12.8338 13.057 11.3859 8.69638 6.79129 11.4533 8.47188 6.16013 0 10.8895 9.97542 10.3306 0 0 10.1933 0 8.7962 10.2783 6.54504 8.74719 6.96313 9.80547 3.94092 0 8.97573 11.9383 5.79623 7.33029 8.51068 7.99503 5.42637 0 5.20414 7.55282 8.14685 10.3985 0 0 5.70005 0 0 6.77123 A0A0B8RVX8 A0A0B8RVX8_PIG E4F transcription factor 1 E4F1 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] AEAPGSPR 0.93484 251.72 12.4365 9.76547 10.0607 9.11577 14.1246 9.92241 14.7727 10.6446 11.1418 10.1971 13.9259 11.0602 14.639 10.857 10.3329 11.5004 10.6894 9.94809 10.5792 8.27184 14.634 12.4308 14.6818 14.8817 9.22137 13.5064 9.78844 9.56746 8.14837 9.03419 14.0941 10.1638 13.5663 5.79958 9.63845 7.03177 9.49053 7.61743 9.85507 9.62417 6.27652 5.72462 9.01299 12.0585 9.89277 6.94848 0 9.23649 4.51235 11.1963 7.92011 9.33204 9.46661 7.8896 7.94433 7.7148 9.38301 9.16315 11.4377 0 7.34899 8.78463 6.79766 A0A0B8RVY0 A0A0B8RVY0_PIG DnaJ homolog subfamily C member 5 (Cysteine string protein) DNAJC5 Sus scrofa domesticus (domestic pig) chromaffin granule membrane [GO:0042584]; melanosome [GO:0042470]; plasma membrane [GO:0005886] EINNAHAILTDATK 0.98143 35.803 0 8.79653 0 0 0 0 0 0 9.69328 0 0 6.72955 0 0 9.85014 8.59406 0 0 7.81179 6.53409 0 0 0 0 5.81173 0 0 0 0 0 0 0 7.2078 0 0 8.11894 0 0 0 6.36875 0 5.95782 5.54161 0 8.25271 0 8.39904 0 0 9.03543 8.11821 7.57675 0 0 7.09614 0 0 8.34412 0 7.87695 0 0 0 A0A0B8RVY2 A0A0B8RVY2_PIG RNA helicase (EC 3.6.4.13) DHX8 Sus scrofa domesticus (domestic pig) "mRNA splicing, via spliceosome [GO:0000398]" nucleus [GO:0005634]; organelle membrane [GO:0031090] ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; nucleic acid binding [GO:0003676]; RNA helicase activity [GO:0003724] AGRAGRTGPGK 0.6 323.31 10.7832 12.305 11.8575 11.1405 11.2856 11.8422 12.124 13.3002 14.2633 12.617 11.887 11.0964 14.4423 14.3637 10.4482 11.0911 8.73755 12.8826 12.0346 9.33347 11.1967 11.666 13.3999 12.5952 9.74599 12.0067 10.4499 10.7975 11.6204 11.4892 12.2566 10.4349 12.5152 11.074 12.4387 12.2805 10.9228 10.7035 10.8369 10.4589 11.0384 11.541 12.555 13.1271 12.9505 10.0094 8.74695 9.68238 10.1161 10.0741 11.8427 11.8916 8.76424 10.2554 10.9136 10.358 10.2079 10.3787 9.40312 10.6564 9.18138 10.2674 11.2798 A0A0B8RVY4 A0A0B8RVY4_PIG Integral membrane protein DGCR2/IDD DGCR2 Sus scrofa domesticus (domestic pig) cell adhesion [GO:0007155] membrane [GO:0016020] AESCQDKSSFLCK 0.96377 113.57 0 8.47318 0 8.83292 8.62812 8.94638 0 6.11649 7.10988 8.78323 5.14258 0 5.02773 4.79384 8.52223 4.84699 7.52576 0 6.41628 8.77466 8.77192 7.5397 8.2511 0 0 0 9.34811 4.83496 8.36593 6.72629 9.77679 10.2408 6.4005 6.00522 0 8.22279 0 8.57826 0 0 6.23588 8.02497 9.02641 7.268 7.71094 6.04632 8.15441 0 5.54884 0 7.06544 0 6.98299 5.88274 6.61133 0 0 7.44054 7.17532 8.03414 0 6.56346 0 A0A0B8RVY5 A0A0B8RVY5_PIG RNA helicase (EC 3.6.4.13) DDX42 Sus scrofa domesticus (domestic pig) ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; nucleic acid binding [GO:0003676]; RNA helicase activity [GO:0003724] AAFQSQYK 0.59302 323.31 10.311 12.7762 10.4404 11.9672 10.5738 12.6884 13.9295 9.77535 10.7895 11.202 13.3105 11.3247 11.0856 10.542 12.2487 8.36829 11.4646 10.8497 10.8699 11.6625 12.2936 13.1365 13.5352 10.9814 10.0898 10.7421 10.3916 11.7333 11.6407 11.0926 12.6963 11.3096 11.3557 12.4162 10.7947 9.5611 10.6811 11.5763 9.60164 9.12096 10.6274 8.9015 9.87241 10.4116 10.0193 10.7068 10.1981 9.77411 10.2888 11.831 10.6009 9.4165 11.3969 11.0877 9.84273 9.71833 10.4109 8.88682 8.05387 7.47289 6.75195 8.85075 7.87603 A0A0B8RVY7 A0A0B8RVY7_PIG DDB1 and CUL4 associated factor 12 DCAF12 Sus scrofa domesticus (domestic pig) centrosome [GO:0005813] AENTLSK 0.97092 183.18 3.33457 0 8.38267 12.7739 11.1737 9.06964 10.5778 11.0922 12.3383 8.4165 9.22831 0 13.9069 11.6344 7.65571 9.81911 8.8529 9.06991 9.57618 12.7122 9.73376 0 9.83842 11.3928 6.26875 7.27705 9.4116 8.6384 10.1614 8.22018 9.35606 10.1487 8.6334 10.4115 9.75904 8.7388 9.42953 10.0183 10.7834 9.71858 7.51751 0 7.33834 7.89966 0 8.57437 8.28942 4.61847 11.2538 10.0651 11.3525 8.08752 5.25365 5.77955 8.87009 8.84442 7.24375 0 7.26969 7.23525 8.11702 0 4.56846 A0A0B8RVY9 A0A0B8RVY9_PIG Cytochrome b-245 light chain (Cytochrome b(558) alpha chain) (Cytochrome b558 subunit alpha) (Neutrophil cytochrome b 22 kDa polypeptide) (Superoxide-generating NADPH oxidase light chain subunit) (p22 phagocyte B-cytochrome) (p22-phox) CYBA Sus scrofa domesticus (domestic pig) NADPH oxidase complex [GO:0043020] heme binding [GO:0020037]; metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491] AFGPLSRNYYIR 0.96765 49.322 0 10.8985 0 0 0 6.95327 0 5.86186 0 3.99928 0 0 0 0 0 0 0 0 9.77758 6.88582 0 0 0 0 0 0 8.41865 7.47127 0 0 0 0 7.57304 0 0 0 8.25569 0 0 0 0 8.28545 0 0 0 0 0 0 7.02281 0 8.71672 0 9.591 0 0 0 0 0 0.378734 0 0 0 0 A0A0B8RVZ1 A0A0B8RVZ1_PIG Cullin 4B CUL4B Sus scrofa domesticus (domestic pig) protein ubiquitination [GO:0016567]; ubiquitin-dependent protein catabolic process [GO:0006511] cullin-RING ubiquitin ligase complex [GO:0031461] ubiquitin protein ligase binding [GO:0031625] AEFKEGKK 0.58621 323.31 14.1084 13.9875 13.8474 12.055 14.9488 12.3313 14.6213 14.6352 12.1959 14.9456 14.8972 15.2428 15.2286 15.1576 14.7843 12.226 14.6455 14.7531 11.2879 9.84015 14.6728 15.6539 15.6824 15.3782 13.9446 12.7633 13.0813 15.1841 14.762 15.084 13.2292 14.4104 14.6935 12.0321 13.7465 11.4066 13.7773 12.6362 13.9753 11.2219 12.1299 12.6228 12.6358 12.3541 13.1663 12.8942 13.8015 13.0146 14.5273 14.2695 14.3336 12.6751 13.0891 13.1627 13.4132 13.2544 13.2828 13.6132 13.2907 13.289 11.9066 11.9159 12.2518 A0A0B8RVZ4 A0A0B8RVZ4_PIG "Colony stimulating factor 2 receptor, beta, low-affinity (Granulocyte-macrophage)" CSF2RB Sus scrofa domesticus (domestic pig) membrane [GO:0016020] cytokine receptor activity [GO:0004896] CSWEVRSK 0.94918 203.13 8.31687 8.45709 8.01965 9.53269 8.79935 12.2925 7.85456 8.89645 9.28836 10.444 10.7465 13.5017 7.57274 12.8582 5.07043 10.0629 8.9125 8.43759 9.6632 8.66832 10.7666 12.5152 12.4978 12.3352 10.014 5.3506 12.1066 8.36247 8.66345 9.65846 11.3602 10.2238 9.31252 7.68545 11.0027 0 9.61684 10.4824 8.94495 9.31427 3.55949 10.0311 8.81554 0 8.76138 0 0 9.79342 0 8.64187 8.63554 10.1459 9.22754 9.07052 8.16852 0 6.23003 9.34292 10.2606 9.95879 8.54195 10.021 4.14012 A0A0B8RVZ5 A0A0B8RVZ5_PIG Carnitine palmitoyltransferase 1A (Liver) CPT1A Sus scrofa domesticus (domestic pig) fatty acid beta-oxidation [GO:0006635] mitochondrial outer membrane [GO:0005741] carnitine O-palmitoyltransferase activity [GO:0004095] AAFFVTLDETEQGYRKEDPDR 0.57955 323.31 10.5736 0 9.51787 10.8155 11.7209 9.76875 12.2143 11.6193 10.443 11.1804 8.96622 10.3099 11.4786 11.5907 12.5499 9.2305 6.91791 8.37682 11.8121 8.91055 10.7059 10.5856 8.88667 12.029 12.6708 8.00602 9.44797 10.7251 11.3352 11.4005 11.4279 10.0406 9.28362 11.1357 11.3344 10.4869 10.5453 9.65202 9.21941 8.64713 10.0681 10.2695 10.6252 10.0901 9.41278 10.6138 7.44435 10.2753 10.9644 9.58207 9.22381 9.59285 11.0597 9.76155 7.7765 9.29294 0 9.06121 6.86468 8.82648 7.94058 6.9046 10.0871 A0A0B8RVZ7 A0A0B8RVZ7_PIG Nuclear envelope phosphatase-regulatory subunit 1 (Transmembrane protein 188) CNEP1R1 Sus scrofa domesticus (domestic pig) positive regulation of protein dephosphorylation [GO:0035307] cytoplasm [GO:0005737]; Nem1-Spo7 phosphatase complex [GO:0071595]; nucleus [GO:0005634] CRTVLAEYNMSCDDTGK 0.97014 49.852 8.0138 0 8.5907 0 0 7.39378 7.69905 0 0 9.70931 8.38487 5.95606 0 0 6.74349 11.3029 0 0 0 0 3.68089 0 11.3023 6.74295 0 0 8.74557 8.08656 0 0 0 8.2374 0 7.75348 9.46659 9.7226 0 8.64158 0 0 2.89617 0 0 7.33029 0 0 7.82909 0 0 0 0 6.84574 0 0 0 8.71008 0 0 0 4.32941 7.55159 0 0 A0A0B8RW00 A0A0B8RW00_PIG Cytoplasmic linker associated protein 1 CLASP1 Sus scrofa domesticus (domestic pig) negative regulation of cytoskeleton organization [GO:0051494]; negative regulation of supramolecular fiber organization [GO:1902904]; regulation of microtubule polymerization or depolymerization [GO:0031110] centrosome [GO:0005813]; Golgi apparatus [GO:0005794]; kinetochore [GO:0000776] microtubule binding [GO:0008017] AAEEAASTLASSIHPEQCIK 0.57303 323.31 12.5717 12.1534 12.2788 12.4843 11.9479 12.6071 14.4213 14.478 14.1823 12.8519 12.9989 13.1062 13.6585 13.7492 14.081 11.7446 12.5512 12.515 14.7433 11.863 11.9351 13.0739 13.4709 13.6815 11.739 10.3339 14.0785 11.139 11.0259 12.7004 12.7373 14.27 13.0149 11.6471 11.4855 10.8166 8.65363 12.0424 11.4509 10.6036 11.0444 10.799 10.4692 10.8423 9.31427 12.0018 13.5712 10.4137 11.491 11.7311 11.8068 10.6095 11.4885 10.4354 10.5686 10.7577 10.2772 10.7381 9.82807 10.6798 8.83355 10.9216 9.79799 A0A0B8RW01 A0A0B8RW01_PIG DNA helicase (EC 3.6.4.12) CHD2 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] ATP binding [GO:0005524]; ATP-dependent chromatin remodeler activity [GO:0140658] AAHFDVEWGVEDDSR 0.56667 323.31 11.1412 11.4199 12.1638 12.1332 12.7973 13.7269 15.1787 12.4711 13.88 13.0326 12.3726 13.4002 12.745 13.3522 14.0415 12.5373 11.9016 13.4472 12.7518 12.2738 11.4073 13.7151 14.3705 14.2148 11.7014 12.9162 12.0032 12.4952 11.4267 12.2321 12.99 12.0817 12.5678 12.208 12.2782 13.3697 11.4333 10.6953 11.6278 11.2401 11.877 10.5466 10.9598 11.8373 11.8119 14.0321 11.7897 11.7283 12.4468 12.64 11.8037 11.4094 10.5425 11.3917 11.144 10.881 10.8175 9.37996 11.6878 11.5461 11.5959 10.8456 11.1454 A0A0B8RW03 A0A0B8RW03_PIG "Cyclin-dependent kinase inhibitor 1A (P21, Cip1)" CDKN1A Sus scrofa domesticus (domestic pig) regulation of mitotic cell cycle [GO:0007346]; signal transduction by p53 class mediator [GO:0072331] nucleus [GO:0005634] cyclin-dependent protein serine/threonine kinase inhibitor activity [GO:0004861] ACRRLFGPVDSEQLR 0.96753 93.759 8.35412 0 6.66235 10.8612 9.88602 0 10.9153 8.0227 6.96451 7.66704 10.1491 0 0 0 10.4055 10.3489 9.73359 10.6053 8.5452 7.32193 11.2755 9.33318 8.82378 10.0049 8.44985 0 9.97484 8.56281 0 7.79259 0 0 0 0 0 9.36409 10.7428 0 0 0 7.80025 6.80219 0 0 0 4.97847 9.3684 6.82896 6.60049 0 0 8.54597 6.66761 8.63318 8.38888 8.57524 9.57514 0 0 0 0 7.45129 0 A0A0B8RW07 A0A0B8RW07_PIG Platelet glycoprotein 4 (Glycoprotein IIIb) (PAS IV) (PAS-4) (Platelet glycoprotein IV) CD36 Sus scrofa domesticus (domestic pig) cell adhesion [GO:0007155]; lipid transport [GO:0006869] apical plasma membrane [GO:0016324]; Golgi apparatus [GO:0005794]; membrane raft [GO:0045121] AEMFRNQVTGK 0.95971 128.35 10.0477 9.05726 7.25295 11.6179 8.25522 12.9367 9.23288 7.96746 12.326 12.0166 8.78709 11.46 12.3389 10.7417 11.0358 10.2292 6.95117 6.93192 7.63706 11.9691 9.01114 8.16315 8.86882 9.10518 11.7549 11.9197 7.34092 9.55809 10.2281 10.813 10.4682 9.39902 11.0904 8.79585 0 0 4.87755 8.79552 0 0 0 9.54645 8.56982 6.07236 6.34938 0 10.0761 0 9.86109 7.27072 5.58985 0 0 7.29499 0 6.18517 9.60559 8.08799 10.1369 3.5834 7.83555 0 6.03534 A0A0B8RW09 A0A0B8RW09_PIG CD163 protein CD163 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] ADETDMLNPSGDHSEVQ 0.55435 323.31 11.1102 10.1525 11.1999 6.7494 12.0275 11.9076 7.21587 12.0092 12.9988 12.2343 9.80967 9.98428 9.66794 11.4978 12.1364 12.2838 6.24125 11.7447 12.5984 11.1859 11.9291 9.24512 11.3617 11.2268 8.10161 8.23936 11.3714 8.92264 9.19254 11.156 10.8206 11.7846 5.25077 10.2856 8.59208 11.3256 8.76908 12.1688 12.0173 11.7773 12.0053 7.11385 10.0014 10.3496 10.1492 10.5609 0 9.86507 4.18499 11.2809 6.48715 0 11.0896 10.4642 12.5366 13.4634 12.1714 10.0072 12.4383 6.97074 11.9356 6.30146 8.28212 A0A0B8RW11 A0A0B8RW11_PIG C-C motif chemokine CCL23 Sus scrofa domesticus (domestic pig) immune response [GO:0006955] extracellular space [GO:0005615] chemokine activity [GO:0008009] DLKSILLK 0.97313 56.669 6.52715 0 0 0 0 0 8.98507 0 0 6.83428 0 7.3805 0 0 8.72755 6.55915 0 4.60863 0 2.92473 6.90881 0 0 0 3.50029 0 9.52531 3.82589 0 0 7.3786 0 2.93874 7.26501 0 8.38685 0 8.77969 0 0 0 0 0 0 0 0 8.51167 0 0 0 9.1122 8.98982 0 0 0 0 0 0 0 0 3.47379 0 0 A0A0B8RW12 A0A0B8RW12_PIG E3 ubiquitin-protein ligase CBL (EC 2.3.2.27) CBL Sus scrofa domesticus (domestic pig) cell surface receptor signaling pathway [GO:0007166]; protein ubiquitination [GO:0016567]; regulation of signaling [GO:0023051] calcium ion binding [GO:0005509]; phosphotyrosine residue binding [GO:0001784]; ubiquitin-protein transferase activity [GO:0004842] ADAAEFWR 0.94524 276.02 11.2561 10.643 6.39015 11.8155 10.9798 11.6173 13.6114 12.2063 10.0716 12.5731 10.9793 11.5743 12.5914 11.4079 11.9929 12.0466 12.169 9.68591 12.1282 10.5796 10.4241 10.0694 0 10.642 0 7.35984 7.60659 7.31406 7.83321 10.3188 10.8961 11.4578 10.1997 11.9543 5.21785 7.79253 8.93472 11.3754 11.2975 10.5944 8.19564 9.30565 9.45697 9.50168 8.27929 9.30024 9.04914 6.86196 6.9751 13.3619 10.6439 10.8701 9.18269 9.82674 8.15482 10.9123 11.503 7.05951 9.96463 9.8983 10.15 9.97642 8.96217 A0A0B8RW14 A0A0B8RW14_PIG "Caspase recruitment domain family, member 9" CARD9 Sus scrofa domesticus (domestic pig) regulation of apoptotic process [GO:0042981]; response to stimulus [GO:0050896] AEDDCSVERKHTLK 0.96269 322.53 9.01036 11.0151 8.11894 13.4411 11.3119 13.0707 12.6392 13.3159 12.4855 9.92278 11.9777 12.4698 11.9018 11.7453 12.307 11.1704 11.8655 11.202 11.4894 11.1415 11.3038 12.7978 12.7428 13.1338 10.0602 8.22154 9.61644 10.4142 7.65778 8.48796 10.4722 9.30986 10.1454 11.0794 11.1111 8.51625 10.1914 5.63776 11.5562 11.4255 10.5381 7.46369 10.3514 10.2398 9.45781 7.51806 10.516 8.86375 9.37786 10.73 9.32019 8.44074 10.7881 10.8273 10.9142 10.0914 8.73833 9.26108 8.92065 8.64071 9.74567 9.10656 11.0025 A0A0B8RW15 A0A0B8RW15_PIG Carbonic anhydrase (EC 4.2.1.1) CA13 Sus scrofa domesticus (domestic pig) carbonate dehydratase activity [GO:0004089]; zinc ion binding [GO:0008270] EGEEAAFLLSNHRPLQPLK 0.96847 52.06 0 7.65728 7.33923 0 0 0 0 0 9.50428 0 0 9.00518 11.3739 9.27438 0 11.4727 7.86102 7.49913 0 6.43137 8.0562 0 7.39429 12.1353 11.3219 0 0 0 0 0 0 0 0 0 8.82066 0 5.34095 7.1815 0 0 0 0 0 0 0 5.7301 0 6.9241 0 0 0 0 0 0 0 0 0 0 0 0 3.46989 0 0 A0A0B8RW16 A0A0B8RW16_PIG Complement C2 (EC 3.4.21.43) (C3/C5 convertase) C2 Sus scrofa domesticus (domestic pig) "complement activation, classical pathway [GO:0006958]; innate immune response [GO:0045087]; proteolysis [GO:0006508]" extracellular region [GO:0005576] serine-type endopeptidase activity [GO:0004252] AVISSEFNVSAK 0.97147 179.67 12.5427 6.01438 10.9314 12.3905 11.6166 11.2164 12.4858 8.26529 12.589 12.6145 12.0821 10.2316 12.4851 13.8944 12.5564 10.3465 12.1712 8.69251 6.14241 0 11.9215 10.5902 13.8683 12.8204 0 10.0966 7.94533 8.29517 10.2616 10.2684 10.2411 7.54581 9.24091 6.90905 11.0503 6.87958 11.3656 0 11.066 7.91976 8.7037 6.8212 11.8114 9.86394 7.68461 12.3346 10.5901 7.80135 11.3581 8.98439 7.51531 0 11.2748 11.771 8.78372 10.1615 8.1249 9.13617 0 8.09782 12.5042 6.55499 11.4747 A0A0B8RW18 A0A0B8RW18_PIG Bromodomain-containing protein 9 BRD9 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] AEWRSSYEDYADKPLEKPLK 0.96522 170.11 11.6617 11.0778 11.3306 11.5256 8.03843 11.0978 12.7191 11.3083 12.6286 8.75412 12.1528 11.045 10.6698 12.9566 13.6939 9.979 11.4254 11.0043 9.09719 10.7293 10.2885 11.4438 10.0614 10.8301 9.17954 8.86793 10.4639 8.557 9.52558 10.1605 10.6051 9.41035 6.31866 9.89815 9.02095 8.765 10.9002 10.4656 0 9.50952 10.6482 9.55392 9.616 8.51582 7.52223 0 9.10334 0 7.37678 11.0545 8.12076 10.7896 0 6.94696 0 7.33834 0 0 6.73485 0 9.88938 8.78129 8.15264 A0A0B8RW20 A0A0B8RW20_PIG BCL2-associated transcription factor 1 BCLAF1 Sus scrofa domesticus (domestic pig) AEGEPQEESPLK 0.49515 323.31 10.8238 11.2007 13.9673 13.7784 13.9173 13.0384 13.0556 13.4054 14.6485 12.7246 12.0702 10.9484 14.5693 14.3794 14.5564 13.5708 13.8926 13.2491 12.39 14.1547 12.9237 15.0446 14.6061 13.964 14.0342 13.5366 13.974 13.0308 15.9539 13.187 13.8237 14.2259 14.6137 13.0031 13.2309 12.282 13.6936 13.9973 13.8041 12.1608 13.0827 13.4829 12.3976 12.7054 13.2429 12.81 13.5525 11.5426 11.5873 11.5535 14.5605 12.204 12.1611 11.2907 9.89606 13.373 13.5518 15.24 15.0208 12.3782 11.3724 10.7973 6.67469 A0A0B8RW22 A0A0B8RW22_PIG Late secretory pathway protein AVL9-like AVL9 Sus scrofa domesticus (domestic pig) recycling endosome [GO:0055037] AGWRGDGVPR 0.97456 180.03 7.40003 5.32171 5.15328 6.80336 8.97616 11.458 11.0354 0 9.71187 0 5.39547 10.3444 8.39326 11.8838 12.4088 9.80845 9.40259 6.02536 6.8296 9.15765 11.1171 2.61285 4.68661 10.9911 7.73769 8.29246 9.76441 11.0421 11.1461 0 10.5079 8.80119 7.09571 0 7.86592 3.40013 10.4262 6.15567 1.87066 7.956 9.85454 0 6.48059 11.5146 7.54928 10.5009 0 9.82829 10.3527 7.80155 6.11749 10.3021 5.3618 9.48006 5.90222 5.70293 5.71152 9.65732 11.0625 0 4.98199 4.0115 3.69544 A0A0B8RW24 A0A0B8RW24_PIG ATP synthase subunit gamma ATP5C1 Sus scrofa domesticus (domestic pig) "mitochondrial inner membrane [GO:0005743]; proton-transporting ATP synthase complex, catalytic core F(1) [GO:0045261]" "proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]" ADIKVPEDK 0.95947 117.29 12.7252 12.7057 12.7546 13.2341 14.0814 13.4289 13.309 0 13.3098 13.0433 13.0652 13.865 10.7796 13.7689 13.6945 12.9824 13.8352 13.1538 12.2585 12.5432 12.5353 13.2159 13.1396 13.7459 11.2916 0 11.4236 12.2502 0 12.2377 0 13.7597 13.7616 5.69156 11.4764 0 8.2009 0 5.91586 12.2333 6.90749 12.9096 12.1924 12.2767 11.4807 9.72646 12.6137 12.5767 12.2958 12.4785 13.4231 12.5295 0 9.58016 8.15927 12.1929 10.4372 11.8625 11.5681 11.3905 10.766 11.4413 11.771 A0A0B8RW25 A0A0B8RW25_PIG Autophagy-related protein 9 ATG9A Sus scrofa domesticus (domestic pig) autophagy [GO:0006914]; lipid transport [GO:0006869] late endosome membrane [GO:0031902]; mitochondrion [GO:0005739]; phagophore assembly site membrane [GO:0034045] APSTMTGSGVDAR 0.93456 220.97 0 9.49091 10.9948 11.8645 10.344 9.8348 11.5507 11.4542 11.3701 9.83273 11.1883 10.7259 12.1218 11.0693 11.3313 11.768 9.20068 12.8187 10.371 9.60598 8.23324 2.91357 11.3473 0 9.42373 9.11163 9.33862 10.4182 10.6692 8.96564 11.0252 0 9.73113 11.0808 11.3754 0 10.5505 9.95864 11.7145 7.65757 8.0398 8.65335 7.32148 8.21432 8.64692 8.32206 8.55171 8.16068 3.9865 8.93655 10.3332 9.31345 11.8641 11.6344 6.3376 9.67892 8.05262 9.66814 0 8.43246 7.88856 9.08385 6.95571 A0A0B8RW28 A0A0B8RW28_PIG Activating signal cointegrator 1 complex subunit 3 ASCC3 Sus scrofa domesticus (domestic pig) gene expression [GO:0010467]; nucleic acid metabolic process [GO:0090304] ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; helicase activity [GO:0004386]; nucleic acid binding [GO:0003676] ADLIVTTPEKWDGVSR 0.54839 323.31 14.0077 12.2905 12.1268 13.6678 13.5605 13.7157 14.3885 13.6214 12.5179 14.1908 14.415 12.7962 16.4884 13.8296 12.655 13.1173 13.0579 12.7487 13.6808 12.42 12.6887 12.6646 13.2084 13.9416 12.3259 11.9728 12.253 12.8759 12.2319 11.0527 11.6788 12.5372 12.987 13.7482 14.2686 13.9148 12.9748 11.0443 10.3953 15.4721 10.8623 10.5344 9.45697 11.5496 11.18 11.3229 11.8841 11.258 13.6711 12.9383 11.5814 11.6417 12.5136 15.797 10.8728 11.3572 11.2762 9.96809 11.5542 10.6626 9.56497 9.71084 11.6565 A0A0B8RW31 A0A0B8RW31_PIG Amyloid beta (A4)-like protein 1 APLP1 Sus scrofa domesticus (domestic pig) endomembrane system [GO:0012505]; membrane [GO:0016020] heparin binding [GO:0008201]; transition metal ion binding [GO:0046914] AALEGFLAALQGDPPQPERILLALR 0.94423 210.65 10.05 10.1497 12.2657 13.3552 12.2278 11.3132 9.91986 12.1493 13.017 11.7413 11.0328 12.1382 12.2454 12.8555 12.267 11.7393 11.3199 11.209 12.0739 0 9.6235 12.7076 11.6469 12.151 11.1026 8.86012 5.20563 9.17817 11.4522 11.267 11.8967 12.8405 9.61436 10.4586 0 12.829 11.5356 10.6143 11.8096 8.90968 9.07337 9.71876 9.24353 11.3697 11.3527 9.8448 11.8853 11.8612 11.1186 11.4284 10.9389 9.50396 11.2454 8.26172 8.85087 11.0624 7.10915 8.00248 8.45014 9.55438 11.251 11.0326 8.5979 A0A0B8RW33 A0A0B8RW33_PIG Acyloxyacyl hydrolase (Neutrophil) AOAH Sus scrofa domesticus (domestic pig) acyloxyacyl hydrolase activity [GO:0050528] AEQLSSTLKR 0.97487 188.36 12.2634 10.7381 12.4674 12.495 10.6823 13.0027 16.953 11.6688 17.0743 11.4915 16.2834 16.2593 16.9918 10.578 12.1912 12.3467 0 7.29002 11.2655 9.58937 7.9542 11.7945 12.2159 13.9 12.8811 9.07583 11.8125 11.7027 9.92788 10.4871 9.90546 0 4.42881 8.1979 9.50458 9.71442 11.9427 9.91015 12.1342 10.0763 4.68072 7.91199 5.83471 7.75969 9.55888 7.23783 11.669 0 9.62536 15.2866 9.46236 0 0 0 3.50589 9.27668 10.6727 0 8.58718 8.23506 5.91891 7.72192 7.57735 A0A0B8RW37 A0A0B8RW37_PIG 5-aminolevulinate synthase (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-ALA synthase) (Delta-aminolevulinate synthase) ALAS1 Sus scrofa domesticus (domestic pig) protoporphyrinogen IX biosynthetic process [GO:0006782] mitochondrial inner membrane [GO:0005743]; mitochondrial matrix [GO:0005759] 5-aminolevulinate synthase activity [GO:0003870]; pyridoxal phosphate binding [GO:0030170] AEVQQAPDGSQR 0.926 219.21 8.66274 8.24536 8.8141 10.9906 11.2252 9.61888 10.575 8.19751 8.85353 6.50868 9.71591 0 11.4474 9.9477 11.6991 10.6651 8.91498 7.00023 9.23149 8.41865 12.2609 10.2096 10.7039 11.2668 8.23324 10.1519 10.1144 11.8919 11.5681 11.2124 11.9508 10.351 10.9791 7.76414 10.1381 6.7987 9.96528 11.9164 11.7971 6.66035 0 9.01853 9.51489 7.99492 9.92613 9.9164 10.8262 10.0417 9.84718 10.608 8.12552 9.35284 9.42038 7.82769 6.78816 8.08921 8.86963 7.38267 6.64001 7.22882 0 0 7.74994 A0A0B8RW41 A0A0B8RW41_PIG 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51) AGPAT2 Sus scrofa domesticus (domestic pig) phospholipid biosynthetic process [GO:0008654] membrane [GO:0016020] 1-acylglycerol-3-phosphate O-acyltransferase activity [GO:0003841] DVWPWLSAALLLLLLLVQLSRSAK 0.95412 101.25 8.90752 0 9.07063 3.87519 11.178 0 8.06872 8.17468 8.75552 8.44265 7.88374 0 7.16068 0 7.64017 6.45523 0 7.49745 7.87252 8.44029 7.5938 8.75576 0 9.22018 0 0 0 8.43334 4.72814 6.55678 9.46381 0 0 0 0 8.40156 0 11.4597 4.99973 0 0 0 0 10.7955 0 0 7.63764 7.40803 8.05447 9.34396 0 4.41664 0 0 8.54666 0 5.67364 5.07125 0 0 0 9.17607 0 A0A0B8RW44 A0A0B8RW44_PIG adenylate cyclase (EC 4.6.1.1) ADCY7 Sus scrofa domesticus (domestic pig) cAMP biosynthetic process [GO:0006171]; intracellular signal transduction [GO:0035556] plasma membrane [GO:0005886] adenylate cyclase activity [GO:0004016]; ATP binding [GO:0005524]; metal ion binding [GO:0046872] AIPLRRHWAPDR 0.54255 323.31 11.1025 8.72523 6.14629 11.0685 11.9701 10.0334 11.2938 10.7125 9.99181 11.607 11.4334 10.5012 10.8715 12.2482 12.2065 8.94603 10.8206 11.6409 10.505 10.3741 10.0589 10.7154 11.0544 9.50954 9.3317 8.84298 11.0123 10.5059 10.4415 11.0751 10.8792 13.243 10.5086 8.23544 7.94163 10.9925 7.75375 10.9276 11.2816 10.8341 10.6618 11.013 11.4037 9.8561 10.6298 7.99345 9.26087 10.168 10.8879 9.81322 10.4199 11.0806 9.2077 10.7108 9.45098 9.91683 9.47184 7.21965 6.00811 10.186 4.34653 3.82802 8.09919 A0A0B8RW47 A0A0B8RW47_PIG Adenosine deaminase (EC 3.5.4.4) (Adenosine aminohydrolase) ADA Sus scrofa domesticus (domestic pig) nucleotide metabolic process [GO:0009117]; purine ribonucleoside monophosphate biosynthetic process [GO:0009168] anchoring junction [GO:0070161]; cytoplasmic vesicle lumen [GO:0060205]; plasma membrane [GO:0005886] 2'-deoxyadenosine deaminase activity [GO:0046936]; adenosine deaminase activity [GO:0004000] AKEGVVYVEVRYSPHLLANSK 0.95416 147.65 0 6.5638 12.9695 10.8935 11.9965 11.2409 12.0043 10.7463 11.3166 10.6137 8.3557 10.4337 11.3958 9.79341 10.4667 10.3768 10.5282 10.6707 10.0501 10.3644 6.8166 11.45 11.7217 10.919 9.74594 10.4356 10.3493 0 9.34092 4.44069 11.4615 10.5747 10.4081 8.76049 0 9.8389 10.5172 11.136 9.8978 8.08884 8.56472 8.43313 10.2566 0 7.86096 9.73742 8.68685 10.7783 8.99904 8.10166 9.28914 8.10423 7.21412 7.58316 7.16621 0 8.63923 0 9.67472 9.72704 9.60075 9.87192 5.99032 A0A0B8RW50 A0A0B8RW50_PIG long-chain-fatty-acid--CoA ligase (EC 6.2.1.3) ACSL4 Sus scrofa domesticus (domestic pig) fatty acid metabolic process [GO:0006631] nucleotide binding [GO:0000166] AEWMIAAQTCFK 0.92693 224.43 10.7826 6.59039 10.7764 12.147 11.7107 11.9096 12.0968 11.4101 11.5933 13.0291 10.7944 12.9002 11.8197 12.0242 13.91 11.5527 13.025 12.8287 12.5284 12.6536 11.4919 0 14.3466 12.0247 8.8479 9.46675 10.9707 11.1048 9.49093 7.76626 12.4765 10.4554 9.71773 10.3243 7.76222 11.4083 8.89285 8.27137 9.58952 10.3656 7.2878 7.61809 9.5927 9.93575 9.73171 8.57187 8.42387 9.66306 12.3875 10.127 12.4438 9.31329 10.097 8.47362 9.20305 9.78895 9.33561 5.46672 8.96431 8.00169 6.50403 9.32679 5.40122 A0A0B8RW53 A0A0B8RW53_PIG ATP-citrate synthase (EC 2.3.3.8) (ATP-citrate (pro-S-)-lyase) (Citrate cleavage enzyme) ACLY Sus scrofa domesticus (domestic pig) acetyl-CoA biosynthetic process [GO:0006085]; citrate metabolic process [GO:0006101]; lipid metabolic process [GO:0006629]; tricarboxylic acid cycle [GO:0006099] cytosol [GO:0005829] ATP binding [GO:0005524]; ATP citrate synthase activity [GO:0003878]; lyase activity [GO:0016829]; metal ion binding [GO:0046872] ADEVAPAK 0.53684 323.31 7.47541 7.84618 11.9393 11.2464 10.0518 11.3688 11.0347 9.62341 10.6806 9.29818 11.6448 10.1213 10.7289 17.6664 10.0715 9.83093 10.8878 10.7048 9.64021 11.6781 11.0951 8.81791 10.8525 11.6576 9.76143 10.2372 9.86349 11.3934 10.886 12.1747 12.6564 12.1555 12.1665 11.6411 10.3187 10.065 11.7606 10.9079 10.5485 11.1404 10.3514 7.32229 10.1773 10.6039 10.7217 5.48307 11.0887 9.18013 8.6858 10.6492 9.39767 10.8106 10.0626 7.67948 15.1288 7.9952 7.49697 8.92258 10.1624 10.0388 9.911 8.21631 9.07767 A0A0B8RW56 A0A0B8RW56_PIG Acetyl-CoA carboxylase 1 (EC 6.4.1.2) ACACA Sus scrofa domesticus (domestic pig) fatty acid biosynthetic process [GO:0006633]; malonyl-CoA biosynthetic process [GO:2001295] cytoplasm [GO:0005737] acetyl-CoA carboxylase activity [GO:0003989]; ATP binding [GO:0005524]; metal ion binding [GO:0046872] AAEEVGYPVMIKASEGGGGK 0.53125 323.31 12.4961 12.7699 12.9438 14.3672 15.9684 14.4265 14.3859 14.1869 14.2078 14.5796 14.5952 13.6632 13.6689 13.9088 14.339 14.285 15.2261 14.4663 13.4189 13.0072 13.349 14.7751 14.5015 14.553 12.9307 12.1606 12.7617 11.9078 12.0277 11.4442 12.9693 12.6282 13.3063 12.9279 11.8173 12.6921 12.2764 12.6979 13.2716 11.663 11.9358 12.0502 11.7301 11.8585 12.7889 11.573 12.6412 12.6726 12.8341 12.9696 13.3824 12.14 12.6258 11.8969 11.6757 11.3188 10.7558 11.8123 11.1993 8.99845 11.0006 11.0258 11.6113 A0A0B8RW59 A0A0B8RW59_PIG "Angio-associated, migratory cell protein" AAMP Sus scrofa domesticus (domestic pig) AFVWRLSDGELLFECAGHK 0.96759 86.385 0 0 11.4191 9.78088 0 9.77554 0 11.3204 0 9.04554 0 0 0 7.99039 0 9.35112 8.52399 8.1497 9.61671 0 0 9.44168 6.39306 9.89363 10.6673 0 6.34977 10.2776 0 4.54312 10.2261 8.33539 5.71644 10.5667 4.46923 0 11.5699 0 0 7.98516 4.53157 0 0 0 6.35371 8.0252 7.81038 8.7106 9.3718 11.9782 9.4266 0 0 0 0 0 0 0 8.71905 0 6.92172 0 8.56438 A0A0B8RYZ1 A0A0B8RYZ1_PIG Zinc finger protein 558 ZNF558 Sus scrofa domesticus (domestic pig) regulation of DNA-templated transcription [GO:0006355] DNA binding [GO:0003677]; metal ion binding [GO:0046872] AFNNLSAVK 0.96448 198.6 12.3937 13.0992 12.6267 10.1688 10.0676 8.93269 13.1805 11.653 10.2535 12.9153 10.4189 12.9715 11.8672 13.3281 9.3456 10.882 12.7774 12.727 10.4992 12.4271 13.2707 13.9902 8.84408 13.2686 12.9482 5.11082 9.51808 12.7868 11.3422 9.31845 13.2346 13.223 0 12.7599 5.56294 7.43521 8.69971 0 7.11478 11.8914 11.9301 5.11137 12.2808 8.06743 11.8022 12.0964 13.2379 12.7203 5.90855 11.9182 12.9713 12.8703 11.7916 5.51497 10.8038 5.64423 10.8025 11.3965 6.95907 0 10.9691 10.6905 10.9649 A0A0B8RYZ2 A0A0B8RYZ2_PIG mRNA decay activator protein ZFP36 (Zinc finger protein 36) ZFP36 Sus scrofa domesticus (domestic pig) "3'-UTR-mediated mRNA destabilization [GO:0061158]; positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay [GO:1900153]" cytoplasm [GO:0005737]; exosome (RNase complex) [GO:0000178]; nucleus [GO:0005634]; ribonucleoprotein complex [GO:1990904] metal ion binding [GO:0046872]; mRNA 3'-UTR AU-rich region binding [GO:0035925] ATPSSIWGPLGGLPR 0.95775 106.18 9.0886 0 0 0 11.7145 11.5454 0 6.23465 10.9267 7.05972 6.36896 8.64832 11.2209 10.8971 9.40045 10.8711 8.97289 0 0 10.7311 9.58551 7.46385 9.39603 11.6553 10.9259 0 5.8523 5.68336 9.23728 10.4163 9.9635 11.2575 8.57001 6.25471 0 0 9.73474 8.00371 9.06684 0 5.40385 7.43455 5.81698 10.4184 6.81673 8.28776 8.90457 5.89421 10.0639 0 9.26945 5.77703 8.0994 3.31759 0 0 0 6.66633 5.84368 3.24227 8.22689 6.30763 8.77693 A0A0B8RYZ4 A0A0B8RYZ4_PIG Zinc finger CCCH-type containing 11A ZC3H11A Sus scrofa domesticus (domestic pig) metal ion binding [GO:0046872] AEVETSGIGDSMLNVK 0.52577 323.31 15.6022 12.0633 11.0316 17.6353 11.959 17.6436 17.9157 17.8077 10.8615 17.4615 11.5892 17.498 14.4869 17.9828 18.162 10.8773 12.1832 10.9327 17.3808 13.7978 10.5408 18.12 11.9524 17.6476 17.0021 16.5435 16.9538 13.9175 4.05355 12.0853 12.4428 14.0535 17.0614 15.0895 15.4227 15.2135 11.3304 15.9189 13.8854 10.743 11.2365 8.06829 16.6259 15.4381 15.9317 11.5176 15.9565 16.1893 11.4673 16.8577 12.672 11.2175 8.25068 11.2016 11.955 12.337 12.5725 11.8588 11.7039 11.5065 13.4381 11.4528 10.3767 A0A0B8RYZ6 A0A0B8RYZ6_PIG Protein yippee-like YPEL2 YPEL Sus scrofa domesticus (domestic pig) nucleolus [GO:0005730] AHLANHDELISKSFQGSQGR 0.96328 73.114 8.5972 8.83996 8.92716 8.26688 0 8.61268 0 9.01625 10.2026 0 7.89518 0 9.5321 8.95902 0 9.20772 10.2966 4.28437 8.54048 0 8.50247 8.61607 7.60659 0 8.7848 9.62049 8.45783 9.88717 7.69683 9.62134 8.85237 8.89615 8.40527 8.11744 8.54059 0 9.92689 7.59515 0 8.16355 9.84183 8.03771 0 7.87781 0 0 7.16993 7.45992 0 3.64455 8.55332 0 8.48244 6.20698 0 5.0784 0 8.953 0 4.4446 0 0 7.47273 A0A0B8RYZ9 A0A0B8RYZ9_PIG WD repeat domain 36 WDR36 Sus scrofa domesticus (domestic pig) rRNA processing [GO:0006364] small-subunit processome [GO:0032040] AADGRLVFAAYGNVFSAFARNK 0.93304 235.57 8.54948 11.1975 11.7526 13.5593 12.7341 13.2601 13.6973 7.08513 10.0276 9.60378 7.19022 9.47261 0 13.3938 0 9.33876 3.82731 13.2492 10.9109 12.7221 13.3508 4.43035 11.8624 11.2114 13.3498 9.28214 0 8.73291 10.852 8.6157 11.2331 0 0 11.6472 10.7556 10.2557 9.95024 9.8687 10.347 0 8.19145 9.10756 15.2861 15.5656 15.4086 10.4527 0 9.6217 8.53356 8.00753 3.90198 0 11.965 10.0953 10.8722 10.6327 4.33999 0 9.70087 10.5 8.89473 9.78968 0 A0A0B8RZ02 A0A0B8RZ02_PIG Vacuolar protein sorting-associated protein 37A VPS37A Sus scrofa domesticus (domestic pig) catabolic process [GO:0009056]; protein transport [GO:0015031] ESCRT I complex [GO:0000813]; late endosome membrane [GO:0031902] DDLVKNIEELAR 0.96103 118.18 4.68162 0 7.81231 12.3788 9.50595 11.7312 5.07677 13.0152 11.7976 7.31669 9.17562 7.01246 13.2608 10.9929 11.1228 8.8443 11.6975 11.89 12.2546 12.0037 8.13499 13.5187 0 8.80474 8.92733 9.5227 11.0452 9.87441 7.54411 9.91019 11.4459 8.64634 11.4235 4.81383 0 6.94953 7.34784 7.12122 8.6812 0 0 6.97166 9.31438 7.82744 8.8679 0 0 6.46418 12.0876 12.2604 8.74779 0 0 6.11207 8.31741 6.77952 8.77419 6.66917 0 6.93605 4.19661 0 7.5744 A0A0B8RZ05 A0A0B8RZ05_PIG Vav 3 guanine nucleotide exchange factor VAV3 Sus scrofa domesticus (domestic pig) intracellular signal transduction [GO:0035556] guanyl-nucleotide exchange factor activity [GO:0005085]; metal ion binding [GO:0046872] AEEAHPPKCPENDIR 0.52041 323.31 10.4172 10.9951 11.2696 10.9583 11.3255 10.9058 12.9339 12.7716 10.8143 10.457 10.4214 11.6773 11.8531 11.9622 12.4653 10.998 9.61646 10.4112 10.458 11.6463 9.93213 12.6959 8.35165 11.7633 11.4634 10.3282 10.9486 11.1104 11.99 10.4546 9.97398 10.7484 11.4042 8.17388 10.5263 12.8323 10.1759 11.228 10.1624 9.74393 9.53306 9.77811 11.5074 12.6189 10.9417 10.916 9.31225 11.9656 11.6221 10.326 10.4752 7.82197 10.8391 9.09424 7.93328 9.93662 9.28154 11.1823 9.73005 2.96805 8.98085 8.56815 6.20201 A0A0B8RZ07 A0A0B8RZ07_PIG ubiquitinyl hydrolase 1 (EC 3.4.19.12) USP12 Sus scrofa domesticus (domestic pig) cysteine-type deubiquitinase activity [GO:0004843] CLTCETISSK 0.95238 160.48 12.3883 12.8389 3.1036 12.5394 9.49448 8.54894 8.45972 9.8185 4.95219 12.9392 7.51798 9.83884 14.4442 13.7603 14.8444 10.3455 5.44265 12.799 12.9401 8.22675 9.90421 13.3129 10.3576 13.2667 12.8788 12.4255 0 12.7406 9.94555 7.94644 13.3056 14.3427 10.4124 12.7652 9.25212 7.7364 9.06064 6.57503 9.52507 9.32039 9.2906 11.0087 8.67165 6.93404 14.6793 6.22891 10.3774 12.7134 6.0803 10.5926 10.4105 11.8591 10.4535 0 11.6311 12.3306 11.248 10.2259 11.7548 0 11.5373 7.98687 6.94181 A0A0B8RZ08 A0A0B8RZ08_PIG Ubinuclein 1 UBN1 Sus scrofa domesticus (domestic pig) AAEGESR 0.51515 323.31 12.8526 11.0944 10.9677 11.1501 13.8472 12.4264 11.8538 14.2329 11.1255 12.5026 12.8463 11.1454 14.036 13.9439 14.465 12.5223 12.7156 12.5806 13.3779 11.8444 12.707 12.0423 14.0457 11.0716 12.2814 12.3609 10.9452 11.4021 12.0182 10.929 9.25734 13.2757 13.5969 10.8958 12.2857 10.8698 11.0022 10.1233 10.3797 11.713 11.8529 11.8113 9.80534 11.0169 9.1629 11.4847 10.3493 10.7908 13.361 10.8499 10.1573 6.95292 10.9784 10.2704 10.2789 8.82254 9.64918 9.45884 7.86177 12.0447 9.73748 10.7301 8.62604 A0A0B8RZ10 A0A0B8RZ10_PIG Ubiquitin-like modifier-activating enzyme 1 (EC 6.2.1.45) (Ubiquitin-activating enzyme E1) UBA1 Sus scrofa domesticus (domestic pig) ATP binding [GO:0005524]; ubiquitin activating enzyme activity [GO:0004839] AAVATLLQSVHVPEFTPK 0.51 323.31 8.97762 8.1918 12.2969 9.68273 10.8274 7.83333 9.63483 13.153 10.8308 10.4921 10.5245 11.0384 12.0174 8.12609 11.1629 11.4785 8.23611 11.3896 10.8115 5.71512 7.455 11.9719 10.057 9.56409 10.4853 8.49173 8.6755 9.54535 10.6166 9.24524 11.8936 10.9446 13.0149 10.6658 11.9527 9.87987 9.75373 9.65439 10.8011 6.89615 0 11.085 15.2787 9.50398 9.43033 9.24745 9.1874 7.91666 9.1219 10.4599 6.84875 6.04028 10.0618 9.02978 0 7.32957 5.90101 9.87391 0 0 9.35819 9.4708 8.26997 A0A0B8RZ12 A0A0B8RZ12_PIG Tetratricopeptide repeat domain 17 TTC17 Sus scrofa domesticus (domestic pig) ADCAESYPR 0.50495 323.31 13.6974 11.5874 11.3123 14.3318 11.5996 13.75 12.9973 12.9261 15.8814 12.2423 10.7856 15.0259 15.156 11.5101 15.4418 12.1204 14.7477 14.0921 14.5979 13.7142 10.4984 15.5625 11.7642 12.37 14.8888 13.8323 13.9095 10.6165 10.297 13.464 9.72537 14.2785 10.1139 9.80164 11.8022 8.41388 7.75134 12.6592 12.6141 9.49374 12.8933 9.99647 7.93952 12.4525 12.0357 10.2606 12.423 10.3077 9.43538 11.4462 10.3261 9.38055 10.084 9.96723 12.7224 11.7569 9.18757 11.9086 7.04089 12.174 10.9008 6.94872 8.1641 A0A0B8RZ14 A0A0B8RZ14_PIG E3 ubiquitin-protein ligase (EC 2.3.2.26) TRIP12 Sus scrofa domesticus (domestic pig) DNA repair [GO:0006281]; protein ubiquitination [GO:0016567]; ubiquitin-dependent protein catabolic process [GO:0006511] nucleoplasm [GO:0005654] ubiquitin protein ligase activity [GO:0061630]; zinc ion binding [GO:0008270] AASKDTISNNR 0.5 323.31 13.6733 12.5213 12.1251 13.7095 13.037 12.6522 14.054 13.7363 13.7616 12.3083 13.3571 11.2744 13.0355 13.5041 13.1939 13.2277 11.0535 11.5882 12.2925 12.4123 12.361 12.7041 14.0668 13.1802 10.8485 9.19626 12.1495 11.5925 12.4103 10.5728 13.1197 11.9673 12.3361 11.636 11.3417 11.9076 13.167 16.0882 11.0196 11.3167 11.8181 11.8522 11.2584 14.172 11.9005 11.9358 12.6252 11.0772 12.1135 12.0856 12.5536 12.3172 10.9632 12.3292 12.1876 12.235 12.6736 10.8219 11.535 11.2773 11.3433 10.5155 9.91619 A0A0B8RZ16 A0A0B8RZ16_PIG Tropomyosin 3 TPM3 Sus scrofa domesticus (domestic pig) cytoskeleton [GO:0005856] actin binding [GO:0003779] AADESERGMK 0.6375 323.31 12.7577 15.8477 12.8499 14.8625 14.4788 14.6404 14.8914 14.4216 14.4511 14.3639 14.3261 14.1127 14.4374 14.4937 14.6315 13.9385 14.1968 13.565 13.904 13.9587 13.3748 13.7243 14.5112 14.1579 12.7213 12.7283 13.3716 14.9387 14.1039 13.8332 14.4843 14.4006 14.0726 13.7104 11.8228 13.3559 14.0998 14.072 13.8101 12.6637 12.7327 12.6974 12.5936 11.9547 11.582 15.371 11.8946 12.9999 13.2276 13.3426 13.4414 12.5227 12.0057 12.6523 12.3168 12.4256 12.4483 12.428 12.1392 11.7816 11.6191 11.7611 14.6449 A0A0B8RZ18 A0A0B8RZ18_PIG "Tumor necrosis factor receptor superfamily, member 10b" TNFRSF10B Sus scrofa domesticus (domestic pig) apoptotic process [GO:0006915]; signal transduction [GO:0007165] membrane [GO:0016020] TRAIL binding [GO:0045569] ARNTGDALYEMLETWVRR 0.93279 220.54 13.1952 10.233 8.44551 9.98854 8.88209 0 7.39386 11.3286 10.0452 7.50391 10.92 8.89766 6.64818 9.95169 9.2551 11.2644 10.9201 0 14.9328 9.5628 10.9836 10.8032 9.12177 7.57456 10.9576 11.0839 8.95777 9.94487 8.96423 4.49889 11.4879 7.99509 12.578 6.25378 7.94439 8.905 10.8864 6.84524 9.1821 10.4543 11.2935 7.79331 3.35685 9.49017 7.90665 10.2612 8.53072 11.181 4.95768 0 9.01853 9.48089 9.51031 9.1738 9.48774 9.86446 0 0 8.39767 9.83629 8.60047 8.68124 4.24336 A0A0B8RZ21 A0A0B8RZ21_PIG Transmembrane protein 140 TMEM140 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] ATDKSLAAASPV 0.99227 28.215 0 0 0 0 0 0 0 6.89142 0 0 0 0 0 0 0 0 5.30082 0 0 0 0 4.26213 3.25722 0 0 8.2032 0 0 0 4.37789 0 0 6.45136 0 0 7.61978 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.90995 0 4.99309 0 0 0 4.81829 0 5.39927 0 0 0 0 A0A0B8RZ23 A0A0B8RZ23_PIG THUMP domain containing 3 THUMPD3 Sus scrofa domesticus (domestic pig) methylation [GO:0032259]; RNA modification [GO:0009451]; tRNA processing [GO:0008033] cytoplasm [GO:0005737] methyltransferase activity [GO:0008168]; RNA binding [GO:0003723] AANNISSLLTK 0.93029 246.59 11.2908 12.4171 9.01803 11.5072 12.0172 11.1999 10.7544 9.41498 12.6168 11.5867 10.8045 11.1137 11.732 11.4031 11.0719 11.8401 12.199 11.6373 11.6157 11.3112 12.0426 10.6111 12.4119 11.7244 10.2234 11.345 11.5542 8.29572 7.07543 9.66342 6.60028 12.1828 10.7217 6.75074 9.11803 4.23619 10.5857 8.46871 9.87928 8.53419 9.08587 10.0373 10.0139 9.14624 10.9284 8.38603 10.3545 5.82703 0 11.0008 11.2982 7.94369 10.451 11.6414 0 8.01837 8.37404 9.43139 0 0 9.28891 5.78861 7.84348 A0A0B8RZ25 A0A0B8RZ25_PIG "TBC1 domain family, member 2" TBC1D2 Sus scrofa domesticus (domestic pig) ADAEEGTFEIKTPSR 0.56044 323.31 12.2884 9.95184 11.0895 16.3918 12.8101 12.3445 12.1102 10.8126 12.5037 11.7346 11.5229 12.0608 11.8209 13.4095 13.5627 12.4734 12.3302 13.1402 11.6785 11.2703 12.5239 12.495 12.6473 13.8589 10.6462 12.2931 11.9944 8.5267 12.1624 11.8285 9.28415 10.8479 11.9639 11.8972 10.2888 11.06 11.1308 10.5277 10.1358 10.6048 12.0848 11.2585 11.3445 12.5096 11.3444 9.44615 11.6408 11.2425 11.9194 11.5873 11.603 9.04086 7.64753 10.6806 12.1607 9.83322 10.3657 10.8198 10.2365 11.2229 10.1483 6.77965 8.4851 A0A0B8RZ27 A0A0B8RZ27_PIG TGF-beta activated kinase 1/MAP3K7 binding protein 3 TAB3 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] kinase activity [GO:0016301]; metal ion binding [GO:0046872]; ubiquitin binding [GO:0043130] AEVNGMEHDLMQRR 0.95471 202.41 10.507 6.90147 8.33713 13.3501 11.0534 10.9461 7.38939 10.3665 10.931 7.41912 9.564 10.5232 10.3397 7.77169 10.6128 10.9025 9.29937 9.045 8.61051 10.5996 10.4764 11.7462 9.29395 12.048 10.7023 10.4282 11.6156 0 11.5789 0 10.8751 11.4043 9.89282 0 11.0729 9.98698 7.6664 11.4686 13.0238 3.20237 10.2826 0 9.64458 10.8114 9.51625 10.7899 9.84884 11.0323 9.12228 9.70988 10.3724 9.2814 5.53303 10.5742 7.54373 9.91648 8.96774 9.87808 0 6.88484 8.45002 7.99848 7.93275 A0A0B8RZ29 A0A0B8RZ29_PIG Surfeit locus protein 4 SURF4 Sus scrofa domesticus (domestic pig) protein transport [GO:0015031] endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; Golgi membrane [GO:0000139] ESSPKQYMQLGGR 0.96806 51.792 0 0 7.4451 9.26526 0 8.46033 7.84668 7.79565 0 8.51798 0 0 0 0 10.033 6.88105 10.2623 0 0 6.39472 0 10.0342 0 8.60947 0 0 0 9.03064 8.88686 0 8.4696 0 4.98213 0 0 0 0 0 0 0 0 3.49198 0 0 0 0 0 0 0 0 7.51861 0 0 0 0 0 0 0 0 0 0 0 5.48668 A0A0B8RZ30 A0A0B8RZ30_PIG Syntaxin binding protein 5 (Tomosyn) STXBP5 Sus scrofa domesticus (domestic pig) exocytosis [GO:0006887] cytoplasm [GO:0005737]; plasma membrane [GO:0005886] AIELSSK 0.96364 316.94 12.2925 10.9524 8.659 10.7673 14.6118 14.6011 12.6698 10.5962 14.6588 10.8123 9.44066 14.122 9.03576 10.1729 10.431 12.4198 12.7659 14.5994 8.94506 13.3146 9.79445 10.0486 14.5577 14.0306 11.8975 12.8589 10.752 9.83889 10.2931 15.2374 10.4917 0 13.4385 12.3181 6.79844 10.1457 15.7377 8.49557 16.0309 4.65541 11.5957 9.67021 10.4897 11.5448 9.43365 9.5769 10.1812 8.49933 16.766 10.1675 9.85674 16.0578 8.1164 7.9279 9.87306 7.50661 8.15467 9.36881 9.32652 12.1489 13.2559 0 9.63985 A0A0B8RZ32 A0A0B8RZ32_PIG Stress-induced-phosphoprotein 1 (Hsc70/Hsp90-organizing protein) STIP1 Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737] AAALEAMK 0.64557 323.31 14.0513 13.7865 13.7724 14.4005 13.2433 15.1461 14.7232 14.125 13.7902 13.9423 12.6805 13.7096 13.1029 14.1562 14.1399 13.4524 12.6285 15.0602 13.7695 12.5315 12.1571 13.4738 13.9372 12.2707 14.342 10.7202 14.0728 14.1713 14.0455 14.3207 14.1678 14.3965 14.8243 13.7449 13.7755 13.5445 13.8691 13.6295 13.5951 13.0776 13.2054 13.1692 12.7295 12.2563 13.0227 13.5808 13.8984 13.8511 13.5415 14.4424 13.5774 12.9293 13.7305 13.7931 13.2731 13.2202 12.799 12.5162 12.888 12.8458 12.1861 11.33 11.6662 A0A0B8RZ34 A0A0B8RZ34_PIG protein-serine/threonine phosphatase (EC 3.1.3.16) SSH2 Sus scrofa domesticus (domestic pig) dephosphorylation [GO:0016311]; negative regulation of actin filament polymerization [GO:0030837] actin binding [GO:0003779]; myosin phosphatase activity [GO:0017018]; protein tyrosine/serine/threonine phosphatase activity [GO:0008138] ADVNVHLLPLEELTSRLK 0.78462 323.31 10.9665 11.242 11.5864 12.0342 9.88655 12.7354 12.6068 11.4777 11.7404 11.5168 9.44334 11.188 9.80408 12.7679 10.8206 10.9268 10.6747 10.8482 12.2854 11.1217 9.85084 11.1787 12.4702 13.1119 11.5395 8.40335 8.81012 7.86326 9.2043 5.28333 11.86 10.6083 11.0323 9.60429 10.8163 7.58316 8.77653 9.71299 11.8171 8.1873 8.85708 7.1914 11.777 10.1965 11.2563 10.0987 10.385 7.00079 10.1236 9.64578 10.598 6.87234 6.53705 10.0146 4.81491 4.8187 9.88993 8.95079 6.80568 10.7559 9.24805 0 7.21801 A0A0B8RZ36 A0A0B8RZ36_PIG "Spectrin, alpha, non-erythrocytic 1" SPTAN1 Sus scrofa domesticus (domestic pig) actin filament capping [GO:0051693] cell cortex [GO:0005938]; cytoskeleton [GO:0005856] calcium ion binding [GO:0005509]; calmodulin binding [GO:0005516] AAAQRKAK 0.92727 323.31 13.9636 13.1541 13.6224 14.4626 14.5396 14.8545 14.5399 14.7334 14.3302 14.3884 15.3457 14.0226 14.2919 16.1743 15.1718 13.9399 15.043 13.9697 13.181 13.9418 14.6898 14.6818 13.8244 13.7715 13.8777 13.2254 13.7492 14.1029 14.0993 13.7067 13.187 14.732 14.1262 13.6356 13.4144 13.6267 14.7135 14.6296 14.4987 12.1681 13.5492 13.0314 12.6066 12.7778 13.4273 13.4265 13.7376 14.1601 13.6767 13.7923 13.7294 12.1619 13.6063 13.8082 12.7596 12.8057 12.7938 11.6926 11.8414 13.1854 13.1227 13.7962 12.1645 A0A0B8RZ38 A0A0B8RZ38_PIG Sperm associated antigen 9 SPAG9 Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737] MAP-kinase scaffold activity [GO:0005078] AEAEDARQK 0.91071 323.31 12.2687 12.5346 13.5639 12.4295 14.1998 12.6634 13.6498 12.9331 12.537 13.2349 13.4907 13.2869 13.0111 12.5797 12.9818 12.7038 13.0607 12.6591 12.8081 12.4709 12.1143 14.177 13.3979 13.9803 12.737 12.2569 12.7069 12.5104 11.8774 11.9335 12.8797 12.8272 11.7546 11.0733 10.8806 11.7761 13.2826 9.26632 10.9388 11.5906 10.8492 10.1804 11.3535 11.8961 9.31456 10.4467 11.4484 10.3835 12.6131 11.7756 11.9465 11.0603 9.57626 10.8775 11.7785 12.0129 9.52129 9.93351 10.3385 10.6691 10.0314 10.1667 10.4096 A0A0B8RZ40 A0A0B8RZ40_PIG SON DNA binding protein SON Sus scrofa domesticus (domestic pig) regulation of cell cycle [GO:0051726]; regulation of RNA splicing [GO:0043484] RNA binding [GO:0003723] AAPVTGGMGAVLMR 0.89474 323.31 15.6573 12.9732 15.1762 17.9662 16.0934 13.4198 17.9847 18.2518 13.9616 17.9019 15.9647 15.9499 16.2069 18.2718 16.221 15.9966 16.2323 16.3062 15.0821 15.8205 10.6923 16.3905 16.4732 16.467 14.7238 10.2759 15.006 13.2686 8.01992 11.6013 15.0534 12.9841 15.1586 12.9932 12.8986 13.1773 14.2704 14.097 13.6877 11.2873 12.0665 11.8038 8.71407 11.2131 11.9118 11.1107 10.1293 11.2538 11.8188 12.2081 12.0147 12.2409 12.0197 12.2712 11.3521 10.1854 11.4223 10.8754 11.0664 9.60279 14.0541 13.9677 7.79747 A0A0B8RZ42 A0A0B8RZ42_PIG non-specific serine/threonine protein kinase (EC 2.7.11.1) SMG1 Sus scrofa domesticus (domestic pig) "nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]; phosphorylation [GO:0016310]" ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674] AEHAVAK 0.87931 323.31 12.6178 12.5654 11.0128 13.6818 12.6799 13.7835 14.7567 12.9235 12.8396 12.8875 12.3647 12.6977 12.9246 13.0247 13.5406 13.2696 12.9826 13.346 12.7007 12.0391 12.0868 12.7944 13.692 13.1523 12.7244 12.9834 11.7856 12.7732 11.6507 12.9878 12.8548 14.6633 14.22 13.1431 10.9565 13.0453 14.1084 11.89 13.7466 10.6984 11.9374 12.7811 12.1089 12.7112 12.5637 11.9003 12.7209 11.8461 12.2304 12.0972 12.477 11.4184 11.8772 12.1825 11.6825 12.0661 11.7771 9.21595 10.9743 10.6926 10.117 11.2041 12.2467 A0A0B8RZ43 A0A0B8RZ43_PIG Solute carrier organic anion transporter family member SLCO2B1 Sus scrofa domesticus (domestic pig) monoatomic ion transport [GO:0006811]; transmembrane transport [GO:0055085] plasma membrane [GO:0005886] AMMGTEDTPGGK 0.95271 101.04 0 6.24618 0 12.4601 11.7372 9.30995 8.53368 8.36763 8.37321 8.15031 11.1411 9.99181 0 9.3791 9.13494 7.79799 8.85555 7.38948 5.2223 0 0 8.99738 8.21028 10.8681 0 6.87946 8.41608 4.89409 6.28753 8.76931 11.066 6.14822 8.92997 8.41912 6.59222 0 0 8.23419 10.97 0 9.007 0 0 6.61195 0 6.38018 0 5.46395 7.29444 6.47174 9.03969 7.20056 0 0 0 0 0 0 7.0863 5.2407 0 0 0 A0A0B8RZ48 A0A0B8RZ48_PIG "Solute carrier family 45, member 3" SLC45A3 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] ALPTRPIMVQR 0.96355 72.543 0 0 0 0 0 7.69098 10.5617 0 9.39455 7.48639 0 0 8.48667 9.1936 9.908 8.14134 0 7.49025 0 0 7.79077 9.58708 0 7.93115 0 9.29207 6.24962 0 0 8.97977 0 8.0499 8.05181 0 0 0 0 0 0 0 6.8622 5.15413 8.20618 9.84667 0 0 0 8.84449 8.0077 0 0 9.40495 0 0 0 0 5.61909 0 0 0 0 0 6.37043 A0A0B8RZ52 A0A0B8RZ52_PIG UDP-sugar transporter protein SLC35A5 (Solute carrier family 35 member A5) SLC35A5 Sus scrofa domesticus (domestic pig) carbohydrate transport [GO:0008643] Golgi membrane [GO:0000139] pyrimidine nucleotide-sugar transmembrane transporter activity [GO:0015165] DLNCSLWER 0.96335 97.348 9.85456 0 10.0478 0 0 11.9093 9.62311 9.61349 0 0 6.80903 0 9.49201 8.79377 0 0 0 0 5.30674 0 8.27989 0 0 11.4139 0 6.35048 9.09014 0 4.53872 7.91271 0 7.51586 11.632 11.2852 9.02547 11.1836 7.20653 8.16204 0 0 0 0 7.49993 0 0 0 0 7.3726 0 0 9.52519 0 3.97141 0 0 0 0 0 7.21558 0 0 0 0 A0A0B8RZ57 A0A0B8RZ57_PIG "Solute carrier family 2, facilitated glucose transporter member 12 (Glucose transporter type 12)" SLC2A12 Sus scrofa domesticus (domestic pig) carbohydrate transport [GO:0008643] endomembrane system [GO:0012505]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886] transmembrane transporter activity [GO:0022857] AAETDGSDR 0.96083 140.75 9.75792 10.0562 10.6683 11.2573 11.506 11.4666 12.2384 12.5291 12.3053 11.7716 9.10347 12.3259 11.5711 12.3231 14.047 10.7821 7.98071 10.6455 11.8168 11.3124 11.4694 12.6231 11.7376 12.3338 10.0716 9.40818 7.74933 9.46948 11.7772 9.56356 10.8411 10.7591 11.1046 11.4543 8.03573 9.80103 10.977 6.89263 10.2543 9.56512 7.70839 8.81689 0 10.3653 10.441 10.9723 9.92128 10.5914 10.4501 0 10.1191 11.955 11.5818 11.9127 9.59956 9.57539 6.82845 10.0458 8.88868 9.09128 5.63369 8.09782 7.95093 A0A0B8RZ59 A0A0B8RZ59_PIG Solute carrier family 12 member 9 SLC12A9 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] chloride:monoatomic cation symporter activity [GO:0015377] AEVQEVVWGEGAGSEEPEEEEEGDFVNGR 0.95657 128.53 8.48301 8.87237 0 0 9.71158 0 11.6677 7.95774 8.69164 5.71981 8.72055 0 8.72948 9.43329 6.33841 0 7.30688 6.02445 6.22352 10.4119 6.10773 9.40442 8.25786 10.0685 10.7683 0 0 0 8.01998 8.97757 7.78966 0 10.7606 0 0 12.2009 0 10.4437 10.264 5.31219 5.48049 7.51672 8.81144 0 0 8.458 9.43813 7.87492 0 10.5449 10.2263 0 6.26763 2.60158 0 0 0 2.48731 9.33112 9.25271 5.66803 3.28626 9.21471 A0A0B8RZ60 A0A0B8RZ60_PIG Signal-regulatory protein beta 1 SIRPB1 Sus scrofa domesticus (domestic pig) cellular response to stimulus [GO:0051716] membrane [GO:0016020] ALQLVGVSVIFVHK 0.96389 134.09 0 9.33952 4.88132 7.85643 8.65639 0 9.94558 7.73958 10.2999 9.91922 9.07732 4.67209 10.4784 9.89924 12.3292 9.77655 10.7669 9.17123 8.94761 8.8416 5.7105 8.10659 9.38883 9.65698 9.28172 3.93631 5.37837 8.34292 9.80153 10.2812 9.3704 7.44634 10.3292 6.95443 5.97593 5.12639 0 0 0 6.70833 8.63517 3.8537 9.6531 10.5908 9.6632 6.88728 7.28475 10.2691 9.80945 0 7.29407 6.87135 0 10.3998 8.10008 8.03963 7.27025 6.97039 0 7.90905 10.1186 6.66761 0 A0A0B8RZ62 A0A0B8RZ62_PIG [histone H3]-lysine(36) N-trimethyltransferase (EC 2.1.1.359) (SET domain-containing protein 2) SETD2 Sus scrofa domesticus (domestic pig) methylation [GO:0032259]; regulation of DNA-templated transcription [GO:0006355] chromosome [GO:0005694]; nucleus [GO:0005634] histone H3K36 trimethyltransferase activity [GO:0140955] AAGGKMKK 0.86441 323.31 12.5504 12.0193 14.7498 15.094 14.9777 14.2461 13.743 14.1167 13.1744 13.4914 13.3341 13.2534 15.6408 14.0271 14.4027 15.1317 13.8177 13.938 13.9088 13.3919 13.2472 14.181 15.8823 12.9531 13.6235 13.1429 12.5854 12.0737 12.2601 12.6442 14.025 13.5089 12.8893 13.1933 13.2715 11.7028 13.52 12.2184 11.6435 10.9731 13.768 10.8733 12.9178 12.1716 10.4437 12.3412 13.3978 11.5404 12.2162 12.7255 12.4597 12.2881 14.0425 11.6833 11.3953 11.0373 11.3849 10.3401 12.6237 11.1726 10.7476 10.773 10.3656 A0A0B8RZ66 A0A0B8RZ66_PIG Chemokine (C-C motif) ligand 14 SCYL2 Sus scrofa domesticus (domestic pig) ATP binding [GO:0005524]; protein kinase activity [GO:0004672] ASLTLEEKQK 0.85 323.31 13.2693 11.9388 13.2708 11.5319 14.0504 11.284 14.3527 12.6834 16.1076 14.5074 12.4036 10.3258 15.8457 15.9024 15.9398 14.3603 12.0551 14.1384 13.8399 11.3485 11.0025 15.3972 9.51635 13.1871 12.4995 3.35868 10.2241 12.0532 12.2149 7.96255 8.32103 14.5703 13.4259 11.8969 7.12298 10.3267 8.72812 12.5782 10.2602 7.56598 12.1023 7.2266 10.8721 11.3142 11.2612 11.9453 12.0499 11.6614 11.9091 13.4512 10.8462 12.1823 12.4196 13.1621 8.33347 10.1717 9.41295 11.0577 9.37905 11.9177 9.25453 9.11351 9.52849 A0A0B8RZ68 A0A0B8RZ68_PIG Protein S100 (S100 calcium-binding protein) S100A4 Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737]; extracellular region [GO:0005576]; nucleus [GO:0005634] calcium ion binding [GO:0005509]; transition metal ion binding [GO:0046914] ALDVMVSTFHK 0.96631 44.643 8.42853 8.1984 5.32056 8.94111 0 0 0 0 0 0 6.77597 0 8.95102 0 0 0 6.65478 0 0 0 0 0 7.1809 0 9.61747 6.15005 0 0 0 0 7.94977 0 7.55903 0 10.1489 0 0 10.9587 8.91657 6.59234 11.4849 12.299 0 0 0 0 0 11.9465 0 0 0 0 0 0 7.6241 11.8104 0 0 11.4165 0 0 0 0 A0A0B8RZ70 A0A0B8RZ70_PIG Ribosomal protein S6 kinase (EC 2.7.11.1) RPS6KB1 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310]; signal transduction [GO:0007165] mitochondrial outer membrane [GO:0005741] ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674] AERNILEEVK 0.97811 188.56 9.61014 10.4896 8.2465 12.4653 0 11.0727 11.0051 12.0234 12.4654 9.20579 12.0445 11.1083 11.3363 11.6395 11.8607 12.6009 12.5955 12.3805 11.1777 10.5694 11.3308 0 7.18259 12.2504 8.15416 0 9.17145 0 6.3553 0 11.9056 10.6986 11.1077 8.13047 9.15028 0 11.3114 6.6953 9.07724 6.40764 8.76785 0 9.81444 7.0935 0 8.14129 9.29225 8.60685 10.6786 10.7546 0 7.05745 8.30255 9.41445 9.47713 0 10.2619 0 0 5.70072 0 8.17488 9.81356 A0A0B8RZ72 A0A0B8RZ72_PIG Large ribosomal subunit protein uL11 (60S ribosomal protein L12) RPL12 Sus scrofa domesticus (domestic pig) translation [GO:0006412] ribonucleoprotein complex [GO:1990904]; ribosome [GO:0005840] structural constituent of ribosome [GO:0003735] ALKEPPRDR 0.93191 213.25 11.6719 10.651 11.7475 13.0051 13.0567 12.7229 12.8862 13.0151 13.1023 12.6529 12.7544 12.7312 13.2727 13.3669 13.207 11.8613 12.1131 11.8966 12.7226 12.4438 12.0067 12.7576 12.6147 12.755 11.2079 10.5398 10.9003 11.7511 12.0534 11.28 12.8161 12.8798 11.6585 11.7568 11.6196 11.5558 11.0995 10.5774 10.3385 10.7241 10.6701 10.477 8.67002 10.2299 6.93699 11.9094 11.7564 11.8589 11.387 10.2236 11.1308 11.5772 11.393 11.6357 8.80494 9.24503 0 8.0614 9.67862 7.4099 7.46263 0 4.47975 A0A0B8RZ74 A0A0B8RZ74_PIG Serine/threonine-protein kinase RIO3 (EC 2.7.11.1) RIOK3 Sus scrofa domesticus (domestic pig) innate immune response [GO:0045087]; phosphorylation [GO:0016310] ATP binding [GO:0005524]; metal ion binding [GO:0046872]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674] AASFLKDDGGPPVLYDE 0.93656 282.81 9.94452 13.0685 8.13673 8.23974 10.0395 9.00487 9.18686 14.2878 6.60908 9.00974 8.42433 8.1443 11.252 11.7055 10.6112 10.4894 9.56171 6.59301 9.79912 10.3405 11.1841 14.5553 8.67395 8.60733 8.97269 10.8539 11.134 9.99972 10.4441 10.4628 10.8636 11.3533 8.07119 9.81162 8.34029 10.9217 11.0268 9.33213 9.21342 0 9.56468 6.12906 11.9419 10.8346 10.0249 9.27004 9.30182 10.0143 10.1396 11.9781 10.0267 6.77386 11.2735 8.50192 9.77548 7.69091 5.48868 9.62919 9.27011 7.02647 0 7.70065 8.82502 A0A0B8RZ76 A0A0B8RZ76_PIG Retinol dehydrogenase 13 (All-trans/9-cis) RDH13 Sus scrofa domesticus (domestic pig) "oxidoreductase activity, acting on CH-OH group of donors [GO:0016614]" AAYCQSK 0.96702 119.79 5.82199 6.22539 9.93032 10.4941 10.8787 11.8268 0 0 9.84806 4.20672 0 9.7333 6.84021 0 11.1764 12.199 6.73566 0 0 10.5698 11.0058 5.24986 10.8031 0 11.2531 10.9148 11.5338 8.76894 9.02934 6.96578 14.6476 9.75944 6.16736 0 0 9.16342 8.25781 5.66971 0 9.4183 9.90829 9.49063 8.91181 8.63314 9.39066 5.07039 0 0 9.12451 6.93393 8.43204 4.76771 4.55139 10.6799 6.72206 0 8.18279 6.20658 6.49176 6.28309 0 9.32843 6.89008 A0A0B8RZ78 A0A0B8RZ78_PIG RNA binding motif protein 10 RBM10 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] metal ion binding [GO:0046872]; RNA binding [GO:0003723] AAERREK 0.83607 323.31 13.9204 13.7605 13.9765 12.7457 10.8577 10.1143 13.7846 13.9885 13.9971 12.4373 13.6865 13.7896 14.368 12.0476 13.6227 13.4119 13.0347 13.0509 11.4137 10.0381 10.1398 13.1177 13.6515 12.3762 10.4083 13.5161 13.5918 7.424 9.28459 10.3998 13.3983 13.0906 13.0011 12.5567 12.2986 12.7765 13.495 12.4965 13.8457 12.4522 11.9869 11.8763 11.7339 11.258 9.08398 12.6609 12.8843 11.5671 10.7899 14.0461 13.8484 11.9995 11.747 8.52184 9.31492 8.55317 12.3524 8.41642 7.93416 9.26686 8.93832 6.25795 9.11681 A0A0B8RZ80 A0A0B8RZ80_PIG N/A RANBP Sus scrofa domesticus (domestic pig) AGLGSCSFAR 0.95922 112.2 7.60088 7.64587 6.24853 8.30012 10.9238 8.56289 0 9.81219 6.93628 8.69066 8.59712 0 7.33181 0 10.1499 6.95838 8.3706 0 0 7.00832 13.0811 11.7842 4.57125 7.81673 9.44911 8.31402 0 9.19242 8.64476 9.08356 10.605 10.4565 7.86096 8.32769 7.74463 9.01992 0 9.48466 8.3217 7.15634 5.97595 7.85474 10.2437 9.0774 8.73863 0 7.92748 8.66551 8.38323 8.59522 9.36862 11.8815 12.0347 7.6295 0 5.58773 0 6.77703 5.90999 6.86307 9.70309 5.39719 0 A0A0B8RZ82 A0A0B8RZ82_PIG RAB3A interacting protein (Rabin3)-like 1 RAB3IL1 Sus scrofa domesticus (domestic pig) guanyl-nucleotide exchange factor activity [GO:0005085] AGPRKGHLR 0.97193 196.61 13.4803 10.8776 13.1545 0 10.6914 8.79071 9.26374 7.69202 11.9648 10.1539 12.0853 13.9322 10.7819 11.3745 10.4201 13.9544 14.0435 8.86712 13.2325 13.165 13.2286 9.84081 14.359 14.2482 12.4789 7.27006 12.5373 11.9278 0 11.3354 9.06698 13.3142 13.3625 11.1792 11.826 3.57216 12.4827 9.31492 12.2215 9.79082 11.9877 11.7408 11.2504 11.1423 8.70843 7.56712 8.93702 9.09908 12.8204 7.59731 10.0562 12.0824 12.1517 12.2124 8.92205 0 10.8098 9.44818 0 11.0722 12.0095 7.97676 11.6506 A0A0B8RZ84 A0A0B8RZ84_PIG protein-tyrosine-phosphatase (EC 3.1.3.48) PTPRC Sus scrofa domesticus (domestic pig) dephosphorylation [GO:0016311]; T cell receptor signaling pathway [GO:0050852] plasma membrane [GO:0005886] protein tyrosine phosphatase activity [GO:0004725] AFASGNK 0.82258 323.31 13.1193 13.1576 12.1172 10.681 16.912 12.3181 13.911 17.2019 11.1532 13.9537 16.5246 16.6024 16.6572 12.3834 16.7155 17.526 14.5127 17.3547 11.9033 11.4537 13.5494 17.0066 11.8789 16.8066 16.2063 11.7523 13.7125 11.2953 12.4783 12.8503 13.1292 11.6301 13.0885 10.7847 14.6455 11.4472 10.6699 13.4682 14.9254 12.5344 15.0084 8.35089 15.012 11.7237 14.8347 15.143 9.73578 8.75852 13.3478 11.8544 16.0556 15.4886 13.2614 10.5785 11.3065 14.8176 11.5179 10.1025 11.266 12.1702 10.5796 13.5316 10.1068 A0A0B8RZ86 A0A0B8RZ86_PIG "Proteasome (Prosome, macropain) activator subunit 4" PSME4 Sus scrofa domesticus (domestic pig) DNA repair [GO:0006281] proteasome complex [GO:0000502] lysine-acetylated histone binding [GO:0070577]; peptidase activator activity [GO:0016504]; proteasome binding [GO:0070628] AIRFFVENLNHDAIVVR 0.80952 323.31 10.5343 10.5201 13.1428 11.5712 10.3343 14.6656 11.042 9.72591 12.4499 10.8274 9.08887 12.3303 12.424 10.9293 12.5425 10.9175 10.9085 10.5974 11.45 11.2614 12.9633 12.5647 11.9352 11.7298 8.75482 0 8.54955 9.56881 10.8384 12.3947 11.0564 11.2551 11.6807 10.6639 11.378 10.1605 10.1324 10.8546 9.02882 11.1777 8.65757 13.7338 11.5011 10.8831 10.2708 10.2102 8.57705 11.1567 12.231 10.7812 12.3639 10.3679 8.37751 9.32411 8.78277 10.3802 8.67016 10.5546 10.5968 8.75292 9.62624 8.8558 9.41967 A0A0B8RZ88 A0A0B8RZ88_PIG Prune exopolyphosphatase PRUNE Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737] metal ion binding [GO:0046872]; pyrophosphatase activity [GO:0016462] AKFDVSGLTTEQMLR 0.95797 102.82 9.49127 0 9.61244 10.4887 11.1058 11.1925 0 11.047 10.3974 10.7756 11.0685 10.0751 8.57084 11.327 9.76476 11.2481 10.5347 11.103 10.6868 10.6304 10.9213 11.5324 8.46879 10.5296 9.98996 9.29916 9.82812 10.2767 7.97499 0 10.4972 10.5885 9.37421 10.1798 10.4319 0 10.9759 9.46604 10.0871 10.4667 7.51948 7.84292 6.50414 8.33414 9.23472 9.33519 9.95271 7.65306 10.431 9.64194 9.9095 8.60188 8.90731 11.2348 7.4287 10.9916 9.48754 6.29877 9.73483 9.44867 7.52834 9.80986 0 A0A0B8RZ89 A0A0B8RZ89_PIG Protein kinase C delta type (EC 2.7.11.13) (nPKC-delta) PRKCD Sus scrofa domesticus (domestic pig) apoptotic process [GO:0006915]; cell cycle [GO:0007049]; phosphorylation [GO:0016310]; regulation of metabolic process [GO:0019222]; response to stimulus [GO:0050896] nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471] ATP binding [GO:0005524]; diacylglycerol-dependent serine/threonine kinase activity [GO:0004697]; metal ion binding [GO:0046872]; protein serine kinase activity [GO:0106310] AAEEPVSEVTVGVSVLAERCK 0.79688 323.31 7.76726 9.21718 12.2044 11.9353 12.3452 12.7843 10.24 11.7901 11.3593 7.8976 11.1218 10.9549 10.7335 11.9996 12.2322 8.595 11.3139 8.17542 9.47204 11.5604 8.92309 12.0533 9.96508 11.5145 10.9692 11.7683 10.2358 10.1412 10.1731 9.81094 11.7584 12.417 11.7884 9.79162 9.15952 11.536 11.9218 11.1219 9.53123 11.2955 10.0873 0 10.4922 11.4599 10.1864 9.75315 10.2736 8.85499 9.49187 10.9487 9.41316 6.15583 6.26701 8.15259 9.73417 3.68952 9.75429 7.41996 8.18582 9.51391 5.19468 7.82349 5.79774 A0A0B8RZ91 A0A0B8RZ91_PIG "Protein phosphatase 1, regulatory (Inhibitor) subunit 2" PPP1R2 Sus scrofa domesticus (domestic pig) regulation of signal transduction [GO:0009966] protein phosphatase inhibitor activity [GO:0004864] AASTASHRPIK 0.96792 90.669 0 9.72535 8.68569 10.1482 12.5913 13.2033 10.1487 10.2289 8.30756 9.2534 9.65003 8.24117 9.10394 11.8612 9.62353 10.0183 8.59272 9.10565 9.84698 8.41177 8.25399 0 9.97785 12.7784 10.0007 10.6631 10.1393 8.53539 9.2673 12.1145 7.95484 8.27998 0 9.17802 6.38453 12.1047 11.1582 10.658 10.41 0 0 0 0 8.69791 0 7.70176 0 10.6695 7.92612 7.5205 8.25475 0 5.58734 0 0 0 7.99752 5.82591 8.08028 7.53115 0 6.37264 0 A0A0B8RZ95 A0A0B8RZ95_PIG Patatin-like phospholipase domain containing 8 PNPLA8 Sus scrofa domesticus (domestic pig) lipid catabolic process [GO:0016042] phospholipase activity [GO:0004620] AEQAVSGDRSTEEK 0.77273 323.31 13.9464 12.8139 0 15.5878 12.7663 15.7782 15.129 13.5744 15.3451 14.2725 14.4016 14.2753 14.4876 14.1591 14.0013 12.4445 15.0324 14.6187 10.6669 13.8113 14.0575 15.6082 14.724 15.76 15.0311 14.7687 14.5248 14.5107 12.8449 11.5519 13.5188 14.1654 13.2326 9.34589 12.9547 10.5086 11.6569 13.8563 13.9697 10.5345 11.3643 10.7934 11.2713 10.9769 10.831 8.95108 12.8835 9.76253 13.3076 3.32265 12.1322 12.3579 11.2944 7.91343 12.1774 10.0945 11.1136 10.5535 9.60134 10.7322 8.88448 7.38629 8.48224 A0A0B8RZ97 A0A0B8RZ97_PIG Phosphoinositide phospholipase C (EC 3.1.4.11) PLCL2 Sus scrofa domesticus (domestic pig) "intracellular signal transduction [GO:0035556]; lipid catabolic process [GO:0016042]; regulation of synaptic transmission, GABAergic [GO:0032228]" "GABA receptor binding [GO:0050811]; inositol 1,4,5 trisphosphate binding [GO:0070679]; phosphatidylinositol phospholipase C activity [GO:0004435]" AAMEFHEHLHSIGTK 0.66234 323.31 8.95242 11.0709 11.7007 12.0353 9.33715 9.29572 12.1272 13.0092 8.15076 11.1845 10.787 10.7932 12.8841 11.8436 10.9429 12.8996 12.1057 10.9547 12.3989 10.0108 11.672 12.5121 9.41466 11.1973 7.57486 8.84043 11.7116 8.55417 11.0064 11.5727 11.4287 8.24494 11.2348 12.2511 9.45878 12.6352 7.82909 9.33619 7.81109 9.54926 8.89479 10.5604 13.0479 10.1997 10.3197 11.8879 11.9196 10.2309 10.0493 11.2722 8.49305 8.26318 10.2795 11.513 8.0899 8.96959 8.7197 11.4744 4.56126 9.34029 10.5361 8.28151 10.5527 A0A0B8RZ99 A0A0B8RZ99_PIG Phospholipase A2 group XV (EC 3.1.1.32) (EC 3.1.1.4) (EC 3.1.1.5) (1-O-acylceramide synthase) (LCAT-like lysophospholipase) (Lysophospholipase 3) (Lysosomal phospholipase A and acyltransferase) (Lysosomal phospholipase A2) PLA2G15 Sus scrofa domesticus (domestic pig) lipid metabolic process [GO:0006629] lysosome [GO:0005764]; membrane [GO:0016020] hydrolase activity [GO:0016787]; O-acyltransferase activity [GO:0008374] GAPYDWRR 0.96964 55.619 0 8.42055 9.93909 9.34676 7.91115 10.6966 9.28914 0 8.04581 9.38275 0 9.05558 0 0 10.6819 0 9.8549 10.4189 10.9753 10.8319 0 9.67825 9.5373 11.2278 0 9.71805 8.96258 7.62191 0 9.30383 6.79207 8.98268 9.82552 9.64174 0 9.4949 9.78406 12.0621 9.72144 0 0 9.38003 8.7787 8.66438 9.0663 0 8.96255 8.59973 9.70969 7.68349 8.91809 8.60733 8.55102 8.98741 0 0 0 0 6.32438 0 8.93233 10.2222 0 A0A0B8RZA1 A0A0B8RZA1_PIG Serine/threonine-protein kinase (EC 2.7.11.1) PIM1 Sus scrofa domesticus (domestic pig) negative regulation of apoptotic process [GO:0043066]; phosphorylation [GO:0016310] cytoplasm [GO:0005737]; nucleus [GO:0005634] ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674] DIKDENILIDLNR 0.964 80.821 8.94658 6.05126 6.32222 6.49237 10.6138 9.20249 10.6568 0 6.00513 0 5.80733 0 10.0557 7.27305 0 0 8.2976 0 0 10.0412 9.18842 6.83555 5.73696 11.1844 10.6499 6.23124 6.85811 6.87061 0 9.97513 8.82566 11.1189 0 0 10.1558 0 9.42888 10.1836 0 6.18678 0 0 7.47387 0 8.99865 7.56529 0 0 8.96457 8.42899 0 0 5.99111 9.89107 5.085 6.05814 0 0 0 0 0 8.43542 0 A0A0B8RZA3 A0A0B8RZA3_PIG Prohibitin PHB Sus scrofa domesticus (domestic pig) mitochondrial inner membrane [GO:0005743]; plasma membrane [GO:0005886] AAIISAEGDSK 0.96699 89.741 7.92641 0 8.96841 0 8.55693 8.26627 12.4692 12.8445 7.90244 8.57505 0 0 9.56297 11.9537 0 0 0 0 8.38288 0 0 8.40846 10.56 0 10.6268 6.83479 0 9.28979 8.05017 8.02364 9.33941 8.41789 0 0 8.04816 7.69342 0 8.17951 8.03067 5.27176 7.45689 0 7.90153 6.66732 10.852 6.22298 0 6.03439 9.57268 6.31036 0 0 0 0 0 0 0 8.00596 8.68713 7.52904 7.2502 0 7.69738 A0A0B8RZA5 A0A0B8RZA5_PIG C-X-C motif chemokine PF4 Sus scrofa domesticus (domestic pig) defense response [GO:0006952]; immune response [GO:0006955] extracellular space [GO:0005615] chemokine activity [GO:0008009]; heparin binding [GO:0008201] ASRPWLSPR 0.96729 50.147 8.97516 11.0397 0 0 10.9591 0 0 0 7.80426 0 8.55298 0 9.75136 0 0 0 0 0 0 0 7.58346 0 0 0 8.75255 0 0 0 7.77755 0 10.9597 9.44824 2.86033 0 3.41859 8.39558 0 8.70079 0 8.0984 3.22305 0 0 0 0 7.84987 9.77964 0 8.373 6.79533 0 6.19771 0 0 0 0 7.97854 0 9.303 9.03419 0 9.17403 9.89673 A0A0B8RZA7 A0A0B8RZA7_PIG Programmed cell death 1 ligand 2 PDCD1LG2 Sus scrofa domesticus (domestic pig) regulation of immune system process [GO:0002682] membrane [GO:0016020] ALFHIPQVHVR 0.9653 80.577 8.89348 0 0 0 8.57747 0 8.4799 8.87058 0 0 8.85237 0 0 10.2549 11.3717 8.89597 0 5.81637 0 0 0 9.6158 7.65306 0 0 5.00589 0 3.02936 0 0 0 8.75017 8.94977 0 0 0 5.21366 0 0 0 0 4.36001 8.57293 4.301 0 9.25814 8.08305 0 0 0 5.62425 0 0 0 0 0 5.94409 8.42345 0 7.90032 0 0 7.21742 A0A0B8RZA8 A0A0B8RZA8_PIG Poly [ADP-ribose] polymerase (PARP) (EC 2.4.2.-) PARP1 Sus scrofa domesticus (domestic pig) DNA repair [GO:0006281]; immune system process [GO:0002376]; regulation of DNA metabolic process [GO:0051052] chromosome [GO:0005694]; nucleus [GO:0005634] DNA binding [GO:0003677]; NAD binding [GO:0051287]; NAD+ ADP-ribosyltransferase activity [GO:0003950]; NAD+-protein-histidine ADP-ribosyltransferase activity [GO:0140815]; NAD+-protein-serine ADP-ribosyltransferase activity [GO:0140805]; NAD+-protein-tyrosine ADP-ribosyltransferase activity [GO:0140808]; nucleotidyltransferase activity [GO:0016779]; zinc ion binding [GO:0008270] AEKTLGDFAAEYAK 0.76119 323.31 12.6461 11.5379 12.6424 11.8172 14.5069 12.1445 15.3534 14.2536 13.4319 12.634 10.9061 13.3989 13.9616 13.2881 14.8264 8.99557 11.8692 11.6567 12.8844 12.8116 11.6465 14.7372 13.9743 13.3185 11.9932 10.0725 11.6279 10.4516 10.6718 12.5843 13.8517 12.4599 12.2098 9.85647 13.5005 10.1033 10.5261 11.2091 13.3316 9.24284 10.2031 11.4334 14.166 13.8182 13.4401 11.9751 11.9914 12.4984 12.1367 11.9316 11.8683 11.9658 10.9727 9.07484 11.7603 11.8321 9.79041 10.5744 11.5866 11.8793 8.71665 7.00663 9.44251 A0A0B8RZA9 A0A0B8RZA9_PIG "Proliferation-associated 2G4, 38kDa" PA2G4 Sus scrofa domesticus (domestic pig) AAHLCAEAALR 0.75 323.31 10.6618 10.7276 11.2577 10.9157 9.92779 12.1284 9.33271 11.1949 9.6722 8.6995 8.25668 7.58714 8.79964 10.9809 11.2397 10.8554 9.81959 12.6961 8.81288 9.35451 0 9.96311 10.5104 7.57099 9.85518 7.07852 9.56815 10.3997 9.75149 11.1794 13.0503 13.7314 12.9477 11.5758 11.0743 10.9569 10.7914 10.053 7.4759 11.0202 10.4948 11.3288 11.4573 10.8173 11.3894 9.44137 12.7988 9.71235 10.5015 10.2596 9.83224 9.10949 12.1461 8.75405 9.32152 0 11.4003 7.52842 6.29101 0 0 0 6.38972 A0A0B8RZB1 A0A0B8RZB1_PIG Oxidative stress induced growth inhibitor family member 2 OSGIN2 Sus scrofa domesticus (domestic pig) CILQNISGLK 0.96104 169.82 9.97083 10.6672 9.83692 11.8352 9.46972 9.12104 11.7996 8.22747 12.4374 10.2633 9.63847 10.6699 10.2096 12.0565 12.3909 8.09392 9.99788 11.9911 10.186 11.6424 6.27969 12.1619 11.9048 7.97166 8.24982 7.19633 7.79915 6.20996 4.79634 0 10.0333 9.82791 7.3231 13.9852 8.59055 0 8.15015 9.42689 9.87069 6.44715 0 8.23314 8.83804 7.80323 9.76022 8.80239 0 0 5.73893 9.10544 9.84599 0 5.6386 6.35985 9.31134 9.00273 8.58935 8.72301 0 9.07197 9.39701 5.10873 7.18071 A0A0B8RZB2 A0A0B8RZB2_PIG Oxidized low-density lipoprotein receptor 1 (Lectin-like oxidized LDL receptor 1) (Lectin-type oxidized LDL receptor 1) OLR1 Sus scrofa domesticus (domestic pig) inflammatory response [GO:0006954] extracellular region [GO:0005576]; membrane raft [GO:0045121]; plasma membrane [GO:0005886] carbohydrate binding [GO:0030246] AANFSGPCPQDWLWHEENCYK 0.96226 105.37 6.95012 9.00885 7.10706 11.8063 9.29428 11.4162 9.76386 10.7485 9.77703 6.4306 5.52832 0 0 8.72656 6.87787 9.06151 8.65388 9.13912 9.91216 9.04688 6.53557 0 11.0393 11.0137 9.42721 6.40477 8.82534 5.82759 7.54272 8.54678 7.64731 9.66057 0 6.39137 6.38464 8.74443 6.14631 7.3679 0 0 8.42823 0 0 7.05148 8.98336 6.27434 0 8.3435 10.1485 6.60835 8.47946 0 7.58052 0 0 0 0 0 5.16928 7.41591 0 7.7443 0 A0A0B8RZB4 A0A0B8RZB4_PIG Nuclear pore complex protein Nup205 NUP205 Sus scrofa domesticus (domestic pig) nuclear pore [GO:0005643] ADNVVNIAR 0.73913 323.31 12.5704 11.8923 12.2907 13.2287 12.2562 13.2435 12.8955 8.89045 10.9413 11.8727 11.8719 10.0111 12.805 14.0158 13.1743 11.3674 12.2077 11.4346 13.8756 10.6221 11.1691 12.7715 11.6945 15.5298 11.9385 7.73552 9.16852 10.5383 8.47679 9.01235 13.2855 10.0512 13.0243 9.70886 9.2442 9.50613 10.4712 11.7982 14.8406 9.67165 10.757 10.5162 9.11061 11.2873 10.2456 9.64978 11.0562 5.17891 11.8601 13.0217 11.688 10.597 9.43813 8.53458 9.32977 6.69265 11.138 11.3446 8.99896 12.8847 7.69926 7.75482 9.42748 A0A0B8RZB6 A0A0B8RZB6_PIG Nuclear receptor binding SET domain protein 1 NSD1 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] histone methyltransferase activity [GO:0042054]; metal ion binding [GO:0046872] AAAPPEHPWQAVK 0.72857 323.31 14.7002 14.1963 14.9116 15.7726 16.3993 18.3535 15.6523 15.1725 14.6313 14.1798 14.4043 14.7092 16.7303 16.7448 16.7937 14.3785 13.8565 14.9691 14.6055 14.0233 14.6605 14.8092 14.2438 14.3961 12.9414 15.1613 15.5961 13.8929 14.4574 13.9766 14.5172 14.6192 14.1545 14.0295 14.8783 14.7246 17.0258 13.5057 13.463 13.9393 14.1649 13.6101 17.3091 17.2466 13.4065 14.2279 14.1103 14.2286 14.2827 14.1313 14.9747 13.0967 13.0754 14.5003 12.6249 14.5297 14.6681 13.141 12.8493 13.4995 12.2584 12.3426 12.2187 A0A0B8RZB8 A0A0B8RZB8_PIG Neuroplastin NPTN Sus scrofa domesticus (domestic pig) membrane [GO:0016020] AAPDITGHK 0.95843 98.552 7.53504 6.6025 0 0 9.77857 0 8.29223 7.59738 0 9.90486 9.86402 6.28046 0 2.75318 9.27373 10.9704 9.41939 5.54021 0 0 4.8528 0 7.23936 6.79999 0 6.38719 6.08975 3.65524 0 3.58328 0 8.67342 9.42019 7.3175 0 0 10.5156 8.58289 8.42034 9.95619 0 0 0 7.30989 4.55219 0 0 0 6.62883 0 8.26505 0 8.69279 0 0 0 7.1234 0 0 4.78916 4.7582 7.75522 8.33011 A0A0B8RZC0 A0A0B8RZC0_PIG Mitogen-activated protein kinase (EC 2.7.11.24) NLK Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; isomerase activity [GO:0016853]; MAP kinase activity [GO:0004707]; protein serine kinase activity [GO:0106310] APEILMGSR 0.97694 185.7 11.3041 11.0056 10.7342 9.94657 11.6645 10.2648 10.9564 12.2858 11.08 11.6934 10.1633 7.46344 12.6956 11.4814 11.435 11.183 5.31709 10.9982 10.2875 9.88644 10.0143 6.98891 10.7658 10.8776 11.1229 0 10.2627 9.54643 11.72 9.80684 2.65313 0 10.5712 11.9069 8.18889 6.5458 9.76235 10.5254 8.956 5.73482 9.79502 9.61903 10.5861 6.71534 10.4097 6.09453 8.58969 7.59276 8.84533 8.20511 10.8161 10.0566 0 8.98202 3.66346 10.5936 9.74062 6.49721 8.34855 7.25039 0 7.82725 10.6447 A0A0B8RZC2 A0A0B8RZC2_PIG "Neural cell expressed, developmentally down-regulated 1" NEDD1 Sus scrofa domesticus (domestic pig) AGLPRSVNTDILSK 0.96736 172.55 9.42597 0 10.8014 12.2006 12.0997 9.86576 12.1084 11.297 11.0778 10.9186 0 0 11.0907 11.7026 10.9564 9.51521 11.2799 8.48498 12.3835 10.1789 0 13.0142 9.67737 9.05325 9.87923 0 10.1392 0 9.36339 9.60789 10.5431 7.23869 9.60147 10.2095 8.80603 0 7.05192 7.78444 7.76653 6.38681 7.22429 8.82785 11.6936 12.1256 0 9.69441 11.9728 8.12526 8.60592 4.19676 6.04054 10.7041 6.47007 6.39686 7.81756 7.01302 6.30065 9.93328 0 0 6.46007 9.21242 9.97528 A0A0B8RZC4 A0A0B8RZC4_PIG Neuron navigator 3 NAV3 Sus scrofa domesticus (domestic pig) neurogenesis [GO:0022008] ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887] AAVSRLGNMAQMDTSEK 0.71831 323.31 11.35 13.0717 12.5517 13.7935 14.4411 14.6861 15.2689 14.3703 13.959 13.5272 13.9041 13.8082 14.5902 14.3327 14.4148 13.9815 15.0018 13.2587 11.0265 13.3775 12.9075 14.5563 14.0369 14.3733 13.5194 11.7514 11.7681 11.6721 12.7339 12.5583 12.6514 14.8515 13.3798 12.3441 13.7535 11.8849 10.4603 13.2166 12.7382 12.8327 12.6645 13.3806 12.6856 12.7373 12.4166 12.4644 12.3743 8.71008 12.9845 13.7685 12.7418 11.5248 11.9995 11.6667 10.9741 9.64665 12.3789 12.3497 11.5759 7.34403 11.4238 11.7199 11.4894 A0A0B8RZC6 A0A0B8RZC6_PIG N-acylethanolamine-hydrolyzing acid amidase (EC 3.5.1.23) (EC 3.5.1.60) (Acylsphingosine deacylase NAAA) NAAA Sus scrofa domesticus (domestic pig) fatty acid metabolic process [GO:0006631]; lipid catabolic process [GO:0016042] lysosome [GO:0005764]; membrane [GO:0016020] ceramidase activity [GO:0102121]; fatty acid amide hydrolase activity [GO:0017064]; N-acylsphingosine amidohydrolase activity [GO:0017040] AEAPGARPALALLLLLAGAR 0.97073 120.19 7.20887 8.06663 0 8.43509 10.0289 0 9.26416 0 0 10.9557 8.43003 0 7.0847 7.40028 0 10.5105 7.86493 11.2239 0 0 0 10.3425 0 0 7.9542 9.72293 0 7.51104 5.86572 0 0 0 0 0 5.80746 7.79961 0 5.6808 9.83971 0 0 3.78367 9.56986 0 0 8.87397 9.35173 7.31633 9.09178 9.24674 10.4112 7.17552 10.2252 9.03936 0 7.56262 3.51816 7.54179 0 8.56974 0 6.06279 0 A0A0B8RZC8 A0A0B8RZC8_PIG Multivesicular body subunit 12A (ESCRT-I complex subunit MVB12A) (Protein FAM125A) MVB12A Sus scrofa domesticus (domestic pig) protein transport [GO:0015031] ESCRT I complex [GO:0000813]; late endosome membrane [GO:0031902] SH3 domain binding [GO:0017124] APRPVPKPRALSR 0.96688 73.916 8.39086 12.037 0 8.25885 10.103 6.47862 7.53224 11.0049 8.83033 9.9378 10.1179 11.0375 9.24826 11.505 9.5046 8.98587 7.59119 9.79069 8.84511 6.6744 8.83051 10.7412 7.08789 12.4262 6.79403 8.57096 0 9.91912 6.79649 7.00562 7.79993 12.1127 9.06692 8.93139 0 7.34296 0 4.59042 6.86059 10.4022 8.97662 8.01352 9.11853 8.51108 8.32899 6.95361 7.33949 7.95437 8.80087 8.03919 8.43492 10.2489 9.32238 6.9222 0 8.25484 8.88664 0 0 0 0 0 5.56584 A0A0B8RZD4 A0A0B8RZD4_PIG Membrane magnesium transporter MMGT1 Sus scrofa domesticus (domestic pig) early endosome membrane [GO:0031901]; EMC complex [GO:0072546]; Golgi membrane [GO:0000139] APSLWKGLVGIGLFALAHAAFSAAQHR 0.98265 35.704 0 0 8.49869 0 0 0 4.74744 0 0 6.50925 0 0 8.81025 8.64191 8.7848 0 0 8.95678 0 8.31872 0 7.21043 8.26256 0 0 0 4.91715 0 0 0 9.08124 0 0 0 0 0 0 0 0 6.33312 0 0 7.61765 0 8.1442 6.34472 0 0 0 0 4.79836 0 0 0 0 0 0 0 0 0 0 0 0 A0A0B8RZD5 A0A0B8RZD5_PIG Maltase-glucoamylase (Alpha-glucosidase) MGA Sus scrofa domesticus (domestic pig) positive regulation of DNA-templated transcription [GO:0045893] MLL1 complex [GO:0071339] DNA-binding transcription factor activity [GO:0003700]; protein dimerization activity [GO:0046983]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978] AAERSRK 0.70833 323.31 17.9913 18.2066 12.806 16.3775 14.6717 15.1352 18.4423 18.5443 15.1216 18.5972 18.4995 13.7061 18.5255 16.1136 18.7481 14.6953 18.424 18.5993 18.5967 13.0278 16.1812 14.2972 14.806 18.6349 18.4814 18.044 13.2015 12.5731 12.8015 10.8823 18.499 18.6141 18.7069 12.1846 18.192 12.0632 18.6083 11.865 18.5972 18.0345 12.4812 12.6873 11.7623 12.7039 12.7786 17.7833 18.0044 18.7247 12.5126 13.8135 18.4504 12.9441 12.3651 11.5186 16.9541 17.5581 17.7469 17.3454 17.2335 17.419 10.997 14.5681 14.625 A0A0B8RZD7 A0A0B8RZD7_PIG Mediator of RNA polymerase II transcription subunit 23 (Mediator complex subunit 23) MED23 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] AQNDNSKLQIPIPHSLK 0.69863 323.31 10.3131 10.9158 11.9475 13.3826 12.2925 11.6933 13.6755 11.5625 12.3107 13.6211 12.0838 11.2096 13.675 12.1806 11.6913 11.8961 12.2686 11.1729 10.0825 11.1678 12.6822 11.8404 15.4464 12.5819 10.6315 8.82142 10.3174 11.1644 11.2075 10.9167 11.1548 12.1433 11.0473 11.1275 10.3346 10.9705 11.1636 9.75537 9.73342 9.03977 9.89735 9.943 9.05528 11.4214 11.0355 10.5199 10.5091 10.7266 11.5292 12.1323 9.44779 9.45514 10.904 10.0147 10.0432 10.4113 10.7286 10.5925 7.55321 8.97206 8.56602 5.54238 10.562 A0A0B8RZD8 A0A0B8RZD8_PIG Stress-activated protein kinase JNK (EC 2.7.11.24) MAPK9 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310]; rhythmic process [GO:0048511] cytoplasm [GO:0005737] ATP binding [GO:0005524]; MAP kinase activity [GO:0004707]; protein serine kinase activity [GO:0106310] APEVILGMGYK 0.95844 156.98 8.20794 9.99845 8.96988 10.9304 8.64681 10.4788 8.38935 9.64821 9.64326 0 6.19977 7.1374 9.88018 0 11.0926 0 10.2905 0 0 0 0 9.71029 0 0 0 0 0 0 9.20256 9.85905 0 10.2055 7.35041 9.43619 10.9688 0 9.19921 8.82165 7.20301 0 3.16065 0 0 7.11603 10.3484 7.62965 0 0 0 0 8.97212 8.70953 9.99025 9.77849 0 8.5324 9.06628 9.0601 10.6775 8.81951 10.2373 10.0307 8.02735 A0A0B8RZE0 A0A0B8RZE0_PIG mitogen-activated protein kinase kinase kinase (EC 2.7.11.25) MAP3K5 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; MAP kinase kinase kinase activity [GO:0004709] AFILKCFEPDPDK 0.68919 323.31 11.2891 11.401 11.6524 11.2013 11.6081 12.7562 10.8371 11.6338 12.1303 10.4081 11.0545 13.0841 12.732 11.583 10.7056 10.8426 10.1586 11.4862 9.36803 10.6088 0 11.9311 9.62669 11.9008 11.0477 9.80032 11.3722 8.47917 11.943 9.60574 9.96223 9.15036 9.6496 9.64146 9.68478 9.42385 10.1871 7.28983 9.42928 10.0283 10.9614 5.58809 7.46655 9.66991 10.856 10.3656 10.441 8.77887 10.634 10.8086 11.2381 11.0457 9.38394 11.2956 9.65139 11.6977 9.76431 10.6314 9.6762 9.33309 5.27049 6.91755 8.58455 A0A0B8RZE3 A0A0B8RZE3_PIG Beta-mannosidase (EC 3.2.1.25) (Lysosomal beta A mannosidase) (Mannanase) MANBA Sus scrofa domesticus (domestic pig) carbohydrate metabolic process [GO:0005975] lysosome [GO:0005764] beta-mannosidase activity [GO:0004567] AEVTYQIR 0.94148 253.99 11.8226 6.60009 6.15636 13.1494 9.7963 9.92096 10.92 14.3252 8.81275 10.3336 9.61167 9.37962 6.94369 12.3359 13.3971 13.8418 12.8585 10.5618 7.06684 8.10821 12.6192 11.0796 10.4732 10.3784 8.75215 10.8271 7.66263 7.86388 5.22149 12.9078 7.26209 10.1003 12.5196 0 9.78195 10.6524 6.25022 10.9035 7.66363 12.22 11.8084 7.19594 9.83616 10.3184 9.39821 7.02425 11.3622 9.77271 5.77866 5.23565 12.7278 7.07307 5.61589 10.3841 10.165 8.21398 8.11847 9.34798 11.1972 10.6722 9.41094 10.1813 7.33985 A0A0B8RZE5 A0A0B8RZE5_PIG Leucine zipper protein 1 LUZP1 Sus scrofa domesticus (domestic pig) AANGPESDTNSPNSK 0.68 323.31 12.4782 14.39 13.2018 15.4806 12.5893 15.1493 15.0299 14.9358 15.6419 12.1151 12.314 12.8799 14.0564 14.9444 13.8718 14.0973 11.9822 14.7318 14.0605 13.8849 13.8241 15.3869 13.0387 16.0507 13.4337 13.2741 13.2067 13.1289 12.8477 13.3899 13.8989 14.2674 13.6731 11.617 12.4843 11.9038 13.313 12.5872 12.4536 11.3314 12.8743 10.9833 11.7093 13.1099 12.3086 12.7919 11.0067 12.7547 12.0348 14.252 12.57 11.3911 12.6965 10.4396 10.6322 11.4709 11.9858 10.929 11.2794 10.3473 11.2282 9.94882 10.7106 A0A0B8RZE6 A0A0B8RZE6_PIG Leucine rich repeat containing 25 LRRC25 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] ADCNCVLFSWHK 0.97029 77.849 0 0 9.99873 9.90893 10.9304 8.94293 12.0383 0 8.86716 10.066 10.1267 10.3396 0 0 8.91642 10.5062 0 10.5017 0 0 11.3243 0 11.9332 11.974 10.6174 10.5514 8.78562 6.59869 0 8.99393 10.355 10.257 9.87383 0 8.14624 9.18041 10.3854 10.2971 9.08178 8.44501 8.59656 8.54531 8.28184 7.61934 0 9.82863 9.75881 10.8392 10.7367 0 6.71273 8.69603 8.72294 0 10.621 8.13371 8.40998 9.42679 0 0 0 5.35354 9.43091 A0A0B8RZE8 A0A0B8RZE8_PIG Lipoprotein lipase (LPL) (EC 3.1.1.34) LPL Sus scrofa domesticus (domestic pig) triglyceride catabolic process [GO:0019433] chylomicron [GO:0042627]; plasma membrane [GO:0005886]; very-low-density lipoprotein particle [GO:0034361] heparin binding [GO:0008201]; lipoprotein lipase activity [GO:0004465]; metal ion binding [GO:0046872] AGETQKK 0.94019 207.49 11.8409 13.9168 11.547 11.8627 12.6666 9.809 12.7028 11.3467 10.4743 8.03832 9.4015 11.3597 10.7044 11.3013 11.5809 9.15477 10.294 11.3446 9.22973 8.20227 10.5302 11.6477 10.1619 9.21868 7.51207 8.70131 12.2326 12.6986 10.1136 10.4587 3.72498 11.2794 0 9.55867 10.4399 9.44712 10.3106 11.359 10.0232 9.57807 0 8.35746 14.4714 14.7566 6.92017 10.1174 10.4715 9.69768 8.75702 11.01 10.5395 10.3774 9.0777 12.3405 0 10.4923 9.34454 9.87429 8.81941 9.72385 9.17325 10.39 8.5014 A0A0B8RZF0 A0A0B8RZF0_PIG Lipase LIPA Sus scrofa domesticus (domestic pig) lipid catabolic process [GO:0016042] "hydrolase activity, acting on ester bonds [GO:0016788]" DLFGVKEFLPQSAFLK 0.96951 54.822 6.92588 5.96077 0 0 8.33891 13.474 0 7.94609 0 8.27831 0 7.147 0 10.4581 0 6.18249 9.92362 0 6.8189 8.30296 0 0 0 9.05333 6.75502 6.47706 6.38262 0 0 6.37114 4.03729 0 6.4039 0 0 0 4.35544 0 0 0 6.78686 0 0 0 0 0 0 5.58862 10.3404 4.71748 0 0 0 7.47184 8.16113 0 8.33883 0 0 6.71672 7.10171 6.65206 0 A0A0B8RZF2 A0A0B8RZF2_PIG leucine--tRNA ligase (EC 6.1.1.4) (Leucyl-tRNA synthetase) LARS2 Sus scrofa domesticus (domestic pig) leucyl-tRNA aminoacylation [GO:0006429] aminoacyl-tRNA editing activity [GO:0002161]; ATP binding [GO:0005524]; leucine-tRNA ligase activity [GO:0004823] ACGKIPVPQQVAQDQDK 0.67105 323.31 11.0014 11.6133 11.8689 13.9422 0 10.7153 11.5674 12.8073 9.38696 11.6627 11.6115 12.1831 12.2266 13.0507 12.3772 11.4732 7.65764 10.5949 11.6994 8.81208 10.6645 11.7835 12.6309 10.9172 12.0261 9.805 8.44655 10.1077 10.9269 13.9325 11.5452 11.7886 10.535 9.54809 10.6042 9.34532 11.8317 11.9208 7.90111 11.3954 9.18391 10.2678 11.6307 10.4882 9.91885 8.39176 10.8964 9.05794 9.97728 9.13881 11.2497 9.47936 9.7767 10.5033 10.5977 8.1811 9.24805 9.2971 9.90234 11.0259 7.6732 9.395 10.6338 A0A0B8RZF3 A0A0B8RZF3_PIG Kelch-like family member 9 KLHL9 Sus scrofa domesticus (domestic pig) AACRWLRLEDPR 0.94118 254.97 10.2055 10.7093 5.22056 12.4363 12.3802 13.1245 13.5765 11.82 11.9988 12.1948 11.6272 10.0612 9.1954 13.2609 11.4807 10.3231 11.4202 9.56883 10.3798 12.0338 12.0441 12.6851 11.8612 12.165 11.6373 11.285 9.368 10.6854 8.76321 0 13.271 11.3972 13.0903 9.64506 10.6274 10.2935 10.1283 9.70082 10.8587 10.3209 9.13589 10.6375 11.6089 9.74352 9.77423 11.1233 10.1714 10.0287 11.2998 11.2206 10.4725 10.9324 9.18772 9.63149 9.36133 10.2726 9.01371 0 8.26665 8.62629 6.29897 9.84433 8.31728 A0A0B8RZF4 A0A0B8RZF4_PIG Kinesin-like protein KIF3C Sus scrofa domesticus (domestic pig) microtubule-based movement [GO:0007018] microtubule [GO:0005874] ATP binding [GO:0005524]; microtubule binding [GO:0008017]; microtubule motor activity [GO:0003777] AAIQDDR 0.65385 323.31 11.7857 11.0582 10.9602 11.2093 12.0649 8.50287 11.578 12.8042 9.01684 8.41777 10.0374 10.1548 10.8609 12.5804 11.3607 7.76487 10.0771 12.2431 10.5015 9.58295 10.2734 9.28376 7.6017 11.4103 10.1429 10.8359 8.95664 9.15201 10.4425 11.0036 10.1227 8.71589 10.807 10.0355 9.53865 9.38571 10.3755 9.73457 9.55209 10.848 8.83156 0 8.19923 9.75465 10.0201 0 10.63 10.5911 4.98728 11.3025 16.5723 12.2411 10.003 10.8483 10.2768 9.69719 10.5538 10.2047 9.09706 8.50434 0 9.28052 8.34873 A0A0B8RZF5 A0A0B8RZF5_PIG Uncharacterized protein KIAA0355 KIAA0355 Sus scrofa domesticus (domestic pig) AAMQLKDVQEHVMEAASRLTSAIKPEIAK 0.96042 258.2 8.66544 11.9765 11.1938 11.6369 12.614 13.1588 12.4292 11.7725 13.5563 10.8163 11.8037 13.4589 10.8156 14.3049 11.8566 13.0775 13.412 10.8537 9.2511 11.8225 11.0201 13.8153 10.437 10.5872 9.9857 12.3004 12.5329 9.07588 9.54129 11.1913 10.966 10.9479 13.1111 10.6088 11.1238 9.81769 12.6411 10.9929 8.8947 9.77189 10.2239 0 11.3277 13.3537 9.75046 8.8382 11.4411 11.943 12.0739 13.0751 11.6404 10.4577 10.4632 10.6795 9.79602 3.84077 11.176 9.31628 6.14906 8.9812 9.37695 8.20701 10.0792 A0A0B8RZF6 A0A0B8RZF6_PIG Lysine (K)-specific demethylase 4B KDM4B Sus scrofa domesticus (domestic pig) chromatin organization [GO:0006325]; methylation [GO:0032259] nucleus [GO:0005634] dioxygenase activity [GO:0051213]; methyltransferase activity [GO:0008168]; zinc ion binding [GO:0008270] AAEDSGR 0.48571 323.31 12.4587 12.5513 12.4999 13.7141 13.9395 14.1527 14.0289 13.7886 13.6877 13.5314 13.2719 13.096 14.0373 14.1454 14.2737 11.5435 13.7522 13.0647 12.8893 12.7467 12.4792 13.3541 13.7641 13.9042 11.7538 10.7073 11.4148 11.7759 11.8359 10.7498 11.1739 12.0081 8.52986 10.6008 8.65023 11.5867 10.1664 12.5403 12.1329 11.2105 7.15876 11.0676 10.4977 10.7341 10.1779 12.3306 9.63481 10.1819 11.8637 10.4267 9.96323 7.90683 9.74948 10.5604 9.00096 10.5275 8.59608 12.2257 10.4952 12.1832 10.6514 10.6344 10.5002 A0A0B8RZF7 A0A0B8RZF7_PIG histone acetyltransferase (EC 2.3.1.48) KAT2A Sus scrofa domesticus (domestic pig) regulation of DNA-templated transcription [GO:0006355] centrosome [GO:0005813]; nucleus [GO:0005634] histone acetyltransferase activity [GO:0004402] ANRRVLLWLVGLQNVFSHQLPR 0.39231 323.31 12.4153 11.1288 10.6149 12.0163 11.8191 11.5977 10.5767 11.5538 11.2997 11.0156 11.6581 11.7486 12.4142 11.5952 13.0369 10.4248 10.7478 9.92548 10.4788 11.4685 10.9038 10.598 13.085 11.8112 9.6151 0 10.9211 11.3385 11.1482 12.5966 12.2456 12.3281 11.9563 8.51928 9.40237 9.09252 8.80587 10.2429 8.65453 10.788 7.51325 10.1794 10.9941 10.3978 10.6178 0 6.74806 10.8885 11.4277 11.0529 11.1389 10.5654 8.24584 10.2292 9.11894 9.33501 0 8.91492 9.23419 2.93953 8.47788 8.74769 8.60829 A0A0B8RZF9 A0A0B8RZF9_PIG Tyrosine-protein kinase (EC 2.7.10.2) JAK3 Sus scrofa domesticus (domestic pig) cytokine-mediated signaling pathway [GO:0019221]; intracellular signal transduction [GO:0035556]; phosphorylation [GO:0016310] cytoskeleton [GO:0005856]; membrane [GO:0016020] ATP binding [GO:0005524]; non-membrane spanning protein tyrosine kinase activity [GO:0004715] ALRRVAACQADR 0.48113 323.31 10.8545 10.5826 10.4458 12.6277 10.6712 11.2509 11.0356 9.99958 10.9231 12.0218 9.49835 9.57266 12.0777 12.5643 11.4857 10.6519 10.6468 12.8774 11.3275 9.8596 11.4391 11.7873 10.4255 12.4158 9.05425 9.23991 9.52906 8.80452 7.78477 10.4378 11.912 11.7453 11.7174 9.43788 10.69 9.34029 9.36001 10.9304 10.8438 11.0642 10.7093 8.59313 8.34682 0 7.01592 10.4495 8.45525 9.53792 11.6717 8.91776 8.94052 8.71836 10.7693 11.0576 9.83856 10.746 6.81801 7.33092 9.89744 8.6831 9.17545 9.49893 8.99966 A0A0B8RZG1 A0A0B8RZG1_PIG Cis-aconitate decarboxylase IRG1 Sus scrofa domesticus (domestic pig) lyase activity [GO:0016829] AGFGAFYANYSPK 0.96172 116.45 10.8662 13.0947 8.17098 11.7947 9.96766 9.26545 0 9.6661 6.3913 11.8774 6.76474 10.5986 12.2245 7.09571 9.43047 11.5658 8.60415 9.76731 5.13282 0 10.6133 9.70957 12.2965 9.00708 6.2746 9.66493 10.6692 5.18761 9.84301 0 8.45068 12.2924 8.02348 5.45457 9.45284 0 9.31191 0 10.4848 6.0014 0 0 0 0 0 8.60589 0 10.2395 5.73509 8.52364 3.55311 11.4489 0 5.87671 11.8261 10.295 11.6316 13.0584 10.2634 4.60987 13.3787 8.23501 0 A0A0B8RZG3 A0A0B8RZG3_PIG Kinase (EC 2.7.-.-) IP6K1 Sus scrofa domesticus (domestic pig) inositol phosphate biosynthetic process [GO:0032958]; phosphorylation [GO:0016310] kinase activity [GO:0016301] ASLSLETSESPQEAK 0.95 205.54 6.46061 8.38845 8.94457 8.43296 11.3944 11.672 10.1249 10.8621 9.24949 9.32921 10.3353 9.91069 9.18071 11.7345 10.1457 11.2657 11.0922 9.30736 11.4728 12.4994 10.7144 11.1311 9.67973 12.023 10.3115 8.95742 7.12763 7.41659 11.4292 9.94253 10.4808 9.48331 8.22386 7.25842 7.09603 6.46782 10.3111 6.24314 8.3031 9.7922 8.55132 8.71297 9.24807 7.21091 11.3557 10.2065 0 8.83779 9.27109 0 11.3599 9.59727 6.07525 8.70532 8.03667 9.4237 10.648 8.66839 8.07815 8.57365 10.0217 0 6.67426 A0A0B8RZG5 A0A0B8RZG5_PIG Interleukin-1 IL1A Sus scrofa domesticus (domestic pig) fever generation [GO:0001660]; immune response [GO:0006955]; positive regulation of cell division [GO:0051781] cytosol [GO:0005829]; extracellular space [GO:0005615]; nucleus [GO:0005634] cytokine activity [GO:0005125]; interleukin-1 receptor binding [GO:0005149] DETSLLFFWEKHGNMDYFK 0.96839 93.189 9.4565 9.69401 9.55926 11.1841 10.9573 11.5147 11.6938 11.3281 10.7738 11.2205 10.4646 10.367 11.8546 0 11.8439 10.5379 10.4096 9.99081 10.2985 9.42895 10.6329 10.8066 10.1828 10.2866 9.65442 9.49492 9.98939 9.979 9.8247 9.51944 11.3462 11.1935 10.7861 10.1754 11.0265 9.48977 10.8002 10.8702 10.7099 9.59861 9.40056 9.39979 9.41654 9.19889 9.17655 9.63149 9.81975 10.1178 9.92656 11.0493 9.29581 9.39416 9.25604 9.74766 9.87243 10.6172 10.5754 9.89441 9.57215 0 7.17413 8.75515 8.46818 A0A0B8RZH0 A0A0B8RZH0_PIG Insulin-like growth factor 2 mRNA binding protein 3 IGF2BP3 Sus scrofa domesticus (domestic pig) mRNA transport [GO:0051028]; regulation of translation [GO:0006417] cytoplasmic stress granule [GO:0010494]; nucleus [GO:0005634]; P-body [GO:0000932] RNA binding [GO:0003723] AEEEIMK 0.92857 281.87 10.7686 10.1982 7.71918 11.4361 11.8468 10.1109 8.98769 12.1322 14.7696 14.2005 0 10.9827 12.3896 11.9237 14.3871 11.0133 13.5888 10.4606 6.68117 8.32513 14.0283 14.4086 14.4397 10.4413 6.8301 8.85453 9.90892 10.1959 9.98356 9.43045 13.5948 14.002 13.8194 10.6498 8.39025 6.10043 5.07711 7.16239 9.27429 12.9907 11.0914 10.4915 9.58551 0 11.8951 12.9842 9.13868 12.9253 10.5513 10.2842 13.6671 7.57486 9.62941 7.73931 11.4399 11.9511 4.22766 10.1552 9.37321 5.81934 8.62399 9.34791 9.24472 A0A0B8RZH4 A0A0B8RZH4_PIG isoleucine--tRNA ligase (EC 6.1.1.5) (Isoleucyl-tRNA synthetase) IARS2 Sus scrofa domesticus (domestic pig) isoleucyl-tRNA aminoacylation [GO:0006428] aminoacyl-tRNA editing activity [GO:0002161]; ATP binding [GO:0005524]; isoleucine-tRNA ligase activity [GO:0004822]; tRNA binding [GO:0000049] AAIEKQKSAFIR 0.93939 283.08 10.4935 11.0067 8.46708 9.51714 11.3428 8.66793 8.35579 11.7083 9.86062 11.0601 10.9786 8.48462 11.9068 11.0164 11.1273 7.90527 0 8.69943 9.9432 8.59518 9.9529 10.0986 9.07858 11.3107 6.59273 0 8.5433 11.5334 10.5509 11.8228 8.77762 9.89001 10.3445 8.39103 9.9249 8.90075 10.3667 10.1653 9.75837 0 7.48261 10.5583 11.0156 9.9857 5.43159 8.34319 8.71538 9.00649 2.50584 11.6822 9.23009 7.76029 11.1341 12.4972 9.37447 9.6476 10.5681 8.91588 7.95332 7.59462 9.27356 5.16471 0 A0A0B8RZH6 A0A0B8RZH6_PIG hexokinase (EC 2.7.1.1) HK3 Sus scrofa domesticus (domestic pig) glycolytic process [GO:0006096]; hexose metabolic process [GO:0019318]; intracellular glucose homeostasis [GO:0001678] cytosol [GO:0005829]; mitochondrial outer membrane [GO:0005741] ATP binding [GO:0005524]; glucose binding [GO:0005536]; hexokinase activity [GO:0004396] AAQLCGAGVAAVVEKIR 0.93516 251.24 11.664 11.3538 10.8514 6.42531 11.0091 9.07173 10.8318 8.37682 12.7957 0 13.5748 12.141 13.1337 11.0389 12.9626 12.9644 9.60807 13.1017 9.97068 13.2504 12.6359 12.6555 14.4541 11.0558 10.1659 9.52337 11.5678 12.199 10.8119 9.48915 11.4737 8.90274 11.9995 10.2569 8.30081 8.17627 10.9937 11.1174 10.7795 9.17946 11.3834 10.6577 11.3889 12.879 10.0482 10.3936 12.3277 8.0337 5.8098 10.3232 10.9123 7.848 6.91791 10.4999 11.3873 11.5616 11.5839 8.00562 10.7304 10.944 10.1105 9.9952 7.87713 A0A0B8RZH9 A0A0B8RZH9_PIG Huntingtin interacting protein 1 HIP1 Sus scrofa domesticus (domestic pig) endocytosis [GO:0006897] cytoplasm [GO:0005737] actin binding [GO:0003779]; clathrin binding [GO:0030276]; phospholipid binding [GO:0005543] AAEQVVQEALR 0.38346 323.31 12.0434 10.6961 11.5677 12.1358 13.6495 13.2636 13.2343 10.7739 11.0142 11.7382 12.5483 12.8297 14.753 11.5623 12.4301 12.1471 12.4112 10.9901 12.135 12.4084 12.1375 12.0659 11.3912 11.7596 11.406 9.75059 9.95182 12.4657 11.7195 12.5477 13.2478 11.3797 12.3691 11.7507 12.3617 11.0386 12.0434 11.3769 11.5004 5.8098 11.1944 11.2652 9.14313 10.7628 10.4354 12.0623 11.645 11.347 11.3473 10.8142 10.7602 9.46177 11.3831 10.9304 8.11067 8.08619 9.91311 10.7386 11.1251 7.05105 8.51534 7.94796 9.57847 A0A0B8RZI2 A0A0B8RZI2_PIG HEAT repeat containing 5B HEATR5B Sus scrofa domesticus (domestic pig) AAARQPAPTVHSAPTIKLK 0.3806 323.31 10.275 10.7994 10.3367 11.9576 12.6911 10.2936 11.8266 7.25607 12.6759 12.2001 8.43492 11.7686 10.6655 12.6006 12.9604 9.83674 11.2654 10.4512 11.2255 12.3376 11.2241 12.301 11.8581 12.3131 14.5735 9.66615 14.3624 9.66906 8.06921 9.85758 0 10.9217 12.549 10.0688 8.85106 9.32499 11.1068 11.9887 9.83619 11.6194 11.7255 7.14507 10.2476 16.8506 7.53052 10.5668 7.68643 12.9587 10.3811 7.99774 8.26913 11.5603 12.4411 9.3054 7.98908 7.01044 10.0812 9.20535 5.09997 7.42475 7.59619 8.2305 9.23709 A0A0B8RZI7 A0A0B8RZI7_PIG Hydroxycarboxylic acid receptor 2 HCAR2 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] G protein-coupled receptor activity [GO:0004930] EPLSPSDLTPASH 0.95325 126.59 7.7985 12.6808 0 9.36069 0 9.65998 9.45304 10.1548 9.48091 11.014 10.6036 9.43118 12.0052 11.8228 9.8167 8.85446 0 8.8708 9.33237 10.2046 9.60338 11.5735 10.24 10.816 10.2929 7.97842 9.78547 8.64259 7.71445 8.69533 10.0717 11.2056 10.7244 8.57244 10.712 8.53609 10.8401 0 9.21956 10.5671 10.4464 8.73998 0 7.20281 7.50653 0 9.51859 8.43012 4.29668 8.06059 9.18653 7.77327 7.71301 8.49438 0 9.89092 0 0 5.37993 0 0 0 7.20134 A0A0B8RZJ1 A0A0B8RZJ1_PIG GTP-binding protein 1 GTPBP1 Sus scrofa domesticus (domestic pig) GTP binding [GO:0005525]; GTPase activity [GO:0003924] DDVIVTASNFSSER 0.95968 161.62 9.68069 10.076 8.99328 10.9226 12.3233 12.1527 9.67737 9.17478 11.8455 11.3296 9.5478 8.9279 10.9981 11.4157 12.1549 10.1089 11.4725 9.56283 8.93896 10.5378 9.18807 11.0203 4.20226 10.0892 9.71488 10.4816 6.70183 9.24579 9.12851 9.31304 10.4299 8.5904 8.72089 9.94638 10.1619 8.66988 4.5642 0 0 7.76142 7.9374 8.58943 9.1705 0 8.59287 10.1812 6.61565 10.5478 11.1124 8.73356 7.82991 8.41045 5.31056 9.51199 7.36667 7.70453 7.98082 9.00602 10.0669 0 8.36001 0 6.47504 A0A0B8RZJ3 A0A0B8RZJ3_PIG G1 to S phase transition 1 GSPT1 Sus scrofa domesticus (domestic pig) GTP binding [GO:0005525]; GTPase activity [GO:0003924] AYFETEK 0.93415 248.02 9.98556 11.6042 0 9.45947 11.5025 11.1114 10.0526 11.8732 11.4588 10.8548 11.9629 9.88527 12.5045 12.1645 11.4097 10.2628 11.8239 11.2051 10.8149 11.6399 9.87041 12.0901 10.5254 12.2283 10.4075 7.3203 10.9165 12.5614 11.9884 9.34815 10.4013 11.447 9.78722 11.0008 8.1374 9.54288 9.70371 9.66613 8.97232 10.5221 0 8.96786 9.42991 9.7444 9.20943 9.51412 0 8.85103 10.3291 8.33584 8.50414 8.16832 9.34778 9.7465 7.60355 5.84877 7.17572 5.73541 10.0891 7.48422 0 0 7.66071 A0A0B8RZJ5 A0A0B8RZJ5_PIG G-protein coupled receptor 126 GPR126 Sus scrofa domesticus (domestic pig) cell surface receptor signaling pathway [GO:0007166] membrane [GO:0016020] G protein-coupled receptor activity [GO:0004930] AQFTFFNKTGLFQDVETK 0.92445 218.45 11.0294 11.6618 0 11.4261 10.0326 9.42683 10.9399 12.6528 10.7595 10.183 10.3244 10.662 11.0341 11.2193 11.4303 10.0914 10.8234 13.62 9.64454 10.3351 11.9668 12.0511 10.5994 10.0713 9.98598 9.72467 9.26887 9.5415 12.2352 7.72758 12.9021 11.6829 11.3471 9.6598 5.91901 9.24172 7.83529 9.87949 9.57832 4.74114 9.56866 11.0046 10.7978 8.17183 9.99223 10.4245 0 3.80488 9.5691 9.44785 9.46934 9.48144 7.36545 10.3021 9.22956 0 8.06113 6.73498 7.48736 0 0 0 7.42358 A0A0B8RZJ6 A0A0B8RZJ6_PIG Golgin A4 GOLGA4 Sus scrofa domesticus (domestic pig) AEMDEQIKAIEK 0.37778 323.31 13.0184 13.6288 13.1058 14.969 16.331 15.3682 14.3327 14.929 13.2851 14.099 13.5074 13.8012 15.4242 13.4156 15.0574 15.115 13.0174 14.1964 13.4115 12.1525 14.3297 14.9022 14.9766 15.2613 12.936 13.1534 13.794 13.7562 13.3617 13.528 14.555 13.8 14.3137 12.6899 12.938 12.8844 12.7206 13.0728 13.5105 13.2316 13.6145 13.711 13.0214 12.5723 13.2633 13.2923 13.4235 14.5938 12.3551 13.3144 14.3381 13.1675 13.1862 12.0267 13.5887 14.587 13.9649 12.0045 12.0271 12.0754 12.2355 12.7923 12.2003 A0A0B8RZJ8 A0A0B8RZJ8_PIG Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 (Transducin beta chain 1) GNB1 Sus scrofa domesticus (domestic pig) signal transduction [GO:0007165] ADRAGVLAGHDNR 0.96305 105.38 5.84499 8.97008 0 11.1839 10.0496 0 10.8079 0 10.2297 9.49582 10.4295 6.23508 10.1877 10.8095 0 8.89718 7.21315 8.62943 6.60066 9.94288 10.3915 10.4306 0 8.6744 8.38883 7.38931 0 10.5279 10.1487 10.2098 0 10.926 11.4219 10.4125 10.0412 9.05338 9.69 10.1924 10.645 0 9.25267 5.06587 9.68916 9.71721 10.2574 0 10.9454 9.84995 10.1657 9.75183 10.7049 11.8083 11.6929 8.93537 7.02691 8.24992 12.4147 0 8.41979 9.7628 0 8.85019 5.27478 A0A0B8RZK0 A0A0B8RZK0_PIG heparosan-N-sulfate-glucuronate 5-epimerase (EC 5.1.3.17) GLCE Sus scrofa domesticus (domestic pig) heparan sulfate proteoglycan biosynthetic process [GO:0015012]; heparin biosynthetic process [GO:0030210] heparosan-N-sulfate-glucuronate 5-epimerase activity [GO:0047464] AIQFPRHLSSGFR 0.92825 235.87 10.772 9.35019 10.2859 12.1175 10.6442 13.0388 12.0102 11.268 10.5129 10.4922 10.069 10.6848 6.5365 9.8747 9.27896 7.46418 10.9457 9.79542 8.64021 0 11.3341 10.3397 12.7632 11.9087 10.9982 7.83883 10.3741 9.78446 10.3947 7.52818 10.9905 10.6137 10.0137 9.73035 9.56447 9.52311 8.39669 0 9.96249 7.29682 9.83491 10.211 10.8761 10.2019 13.2353 8.75602 9.04519 10.097 10.1679 8.84562 6.11944 0 8.12531 8.7501 4.18793 10.0616 8.85755 6.24458 0 7.62293 7.92368 7.43954 5.51491 A0A0B8RZK2 A0A0B8RZK2_PIG "Glucosaminyl (N-acetyl) transferase 1, core 2" GCNT1 Sus scrofa domesticus (domestic pig) Golgi membrane [GO:0000139] glycosyltransferase activity [GO:0016757] AIYMPQNFYCIHVDK 0.95561 158.18 8.00523 12.1614 0 8.73961 11.4856 10.0752 9.18889 10.7414 8.96662 10.7456 9.26569 9.66775 9.07329 7.66092 9.70523 10.1694 10.4753 8.4154 11.8297 9.21653 0 10.297 0 10.1393 8.24878 9.02989 7.07157 7.56598 8.10988 7.2034 10.4085 10.7111 3.23553 9.24196 6.63741 11.4852 10.1549 7.69579 9.77747 9.27023 0 0 0 9.18847 9.81441 10.2341 0 0 10.8969 7.90219 10.3761 8.15173 0 0 9.80649 9.73407 8.99673 7.33396 8.57217 7.17113 9.84895 9.16674 8.33602 A0A0B8RZK4 A0A0B8RZK4_PIG Frizzled-4 FZD4 Sus scrofa domesticus (domestic pig) plasma membrane [GO:0005886] Wnt receptor activity [GO:0042813] AWRGTGPR 0.94953 130.66 9.23609 7.63125 0 11.0814 9.22959 10.8648 8.51033 9.58993 10.0772 9.95807 10.0892 0 11.2514 8.25281 9.3271 9.69592 9.57179 5.94064 8.63862 9.3969 9.58712 10.2825 10.5531 8.99013 8.67997 10.707 0 9.65017 8.84587 8.23735 8.8544 4.7941 8.78535 8.3699 7.74025 9.35059 5.87723 4.99557 9.89662 8.09566 0 0 7.13042 9.17931 9.30982 0 8.15891 0 0 9.10769 5.57198 0 6.92671 0 0 0 0 8.64699 0 3.67841 0 4.74739 0 A0A0B8RZK6 A0A0B8RZK6_PIG Fibronectin type III domain containing 3B FNDC3B Sus scrofa domesticus (domestic pig) membrane [GO:0016020] APIDNGSK 0.94207 283.89 10.0676 11.065 10.4017 14.5041 13.6677 13.6367 14.1267 14.6956 13.5203 12.7713 12.5448 10.9612 14.3762 14.9619 13.9437 14.797 14.5074 13.5804 12.802 12.9486 12.2129 13.8489 13.5889 13.5006 12.3117 8.64024 9.83088 11.5362 9.85954 12.5599 10.2534 13.0811 13.9093 12.2378 10.6414 10.2298 9.17373 10.4245 10.5384 11.7136 9.42074 4.26963 10.6934 10.8714 11.2301 10.9951 7.11134 10.9642 11.8735 9.90779 12.1461 8.0365 8.7925 9.61539 11.0429 12.4759 10.4012 6.86592 10.2263 6.6659 8.30159 8.73298 9.31983 A0A0B8RZK8 A0A0B8RZK8_PIG Adrenal ferredoxin (Ferredoxin-1) FDX1 Sus scrofa domesticus (domestic pig) cholesterol metabolic process [GO:0008203]; P450-containing electron transport chain [GO:0140647]; steroid biosynthetic process [GO:0006694] mitochondrion [GO:0005739] "2 iron, 2 sulfur cluster binding [GO:0051537]" AGNRGPGGSIWLGLGGR 0.96498 96.875 9.34259 5.98504 0 18.1993 0 0 7.49881 0 0 9.52403 0 9.69478 10.8347 8.54361 9.70841 0 0 0 16.9855 0 7.51924 10.6892 10.1051 10.785 5.74835 0 0 8.67825 0 7.69794 0 8.32733 7.66477 9.30437 0 0 0 0 0 0 0 0 8.63238 11.2466 10.4298 11.9709 9.2045 0 9.84156 7.98704 10.6555 0 0 8.43354 0 0 6.66235 0 0 0 0 5.8362 0 A0A0B8RZK9 A0A0B8RZK9_PIG FAST kinase domains 5 FASTKD5 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310]; regulation of mitochondrial mRNA stability [GO:0044528] mitochondrion [GO:0005739] kinase activity [GO:0016301] AFVTLGIPHSHSVLDVFETR 0.94603 291.07 12.7694 11.4935 11.9785 12.5294 12.3786 11.4014 12.6586 13.2104 11.1551 11.2327 12.6417 11.4961 14.2048 14.2889 14.3244 12.4548 10.2213 13.1159 13.1816 11.3828 11.2127 10.9789 12.6163 13.1715 13.6632 13.3551 13.0603 13.4962 13.3915 12.3618 11.6997 11.559 12.9492 12.9577 13.1834 12.6911 10.9786 12.8029 12.5807 12.2577 11.6766 10.5555 14.7459 14.89 14.5522 12.3001 12.2153 12.2285 12.6441 12.6396 12.0045 11.5478 12.2965 12.211 12.1088 12.1253 12.5618 11.8642 11.6765 12.1632 11.3221 11.2033 11.2029 A0A0B8RZL0 A0A0B8RZL0_PIG "Family with sequence similarity 60, member A" FAM60A Sus scrofa domesticus (domestic pig) AKSSSSRFTDSK 0.96767 136.45 0 9.92214 11.2603 9.19436 9.12291 10.4749 9.95056 10.0992 10.9481 10.0211 11.9039 10.2563 10.1794 10.7757 10.2957 9.93317 11.1869 10.0146 0 10.2411 10.0591 0 10.3874 10.6977 10.5672 10.0007 11.1618 9.18906 9.72943 10.5119 11.0875 6.2801 9.62783 10.3372 7.75515 9.48291 10.1033 0 9.53559 5.85609 7.62768 6.96162 8.48329 6.87885 7.82661 9.18478 0 7.09265 8.20208 9.49444 8.86614 7.96596 8.73742 9.52056 0 6.88582 0 0 7.29866 8.11447 5.91023 5.5572 7.12897 A0A0B8RZL2 A0A0B8RZL2_PIG Protein FAM111A FAM111A Sus scrofa domesticus (domestic pig) AVTDEIK 0.96233 306.43 8.69988 6.51734 11.7316 11.5291 11.1132 12.4285 12.4795 11.3447 10.4595 10.7395 9.31658 13.2907 9.00279 12.4029 11.1461 12.3779 10.4659 6.72055 8.66285 10.4216 11.5552 9.03623 10.3323 10.2845 9.77497 11.13 10.7889 9.93701 9.24947 9.14175 12.8841 6.07893 11.136 8.16947 9.7499 7.19288 11.1524 8.10779 8.53419 9.36113 10.5062 9.74096 9.48484 10.5228 9.3458 8.99907 6.81365 9.40941 7.66881 10.2897 11.1139 7.39549 0 9.63921 7.6664 8.56358 9.55695 9.61583 5.95203 9.72561 4.98937 9.21104 9.27095 A0A0B8RZL3 A0A0B8RZL3_PIG Ectonucleoside triphosphate diphosphohydrolase 1 (EC 3.6.1.5) (ATP diphosphohydrolase) (Ecto-ATP diphosphohydrolase 1) (Ecto-apyrase) (Lymphoid cell activation antigen) (Nucleoside triphosphate diphosphohydrolase 1) ENTPD1 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] "ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616]" ARTVVPK 0.95954 153.31 9.80016 6.10457 8.71617 10.7107 10.697 11.0726 9.72267 11.6699 10.8241 0 10.3985 7.11009 11.2081 11.2417 12.6249 10.1709 10.297 9.98242 10.1517 0 9.66998 9.64012 10.4034 10.936 0 10.0963 0 10.1102 0 9.02876 9.59811 10.4295 9.67345 8.87212 7.33459 0 7.08183 0 0 7.67426 5.78869 7.96872 0 8.39176 0 0 7.9308 11.8237 3.57616 0 0 8.84358 7.4614 4.77368 8.83482 6.97911 9.36067 7.96798 8.30163 0 6.07146 7.74672 0 A0A0B8RZL4 A0A0B8RZL4_PIG Eukaryotic translation initiation factor 3 subunit C (eIF3c) (Eukaryotic translation initiation factor 3 subunit 8) (eIF3 p110) EIF3C EIF3S8 Sus scrofa domesticus (domestic pig) formation of cytoplasmic translation initiation complex [GO:0001732] eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852] RNA binding [GO:0003723]; translation initiation factor activity [GO:0003743]; translation initiation factor binding [GO:0031369] AKELLGQGLLLR 0.375 323.31 10.9699 9.62571 12.4713 10.9575 11.1903 12.4509 10.9878 9.81038 13.1683 11.1702 11.1994 9.60392 12.1109 14.6558 10.9953 12.6062 11.4193 11.6434 11.0757 11.1587 6.45493 10.5199 11.3704 12.4648 13.8543 9.69742 9.26903 11.3058 11.9207 12.3901 9.52875 11.1125 11.7467 12.9006 11.5163 11.6055 11.84 11.2283 11.2783 8.91241 11.1924 11.704 16.6439 16.7251 15.8925 10.4494 12.1662 11.692 12.0564 12.4437 11.0427 12.1483 12.1641 10.9915 12.6271 11.9586 11.5811 10.4975 10.4205 10.391 11.5285 10.2414 11.7775 A0A0B8RZL6 A0A0B8RZL6_PIG Eukaryotic elongation factor 2 kinase (EC 2.7.11.20) EEF2K Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; calmodulin binding [GO:0005516]; elongation factor-2 kinase activity [GO:0004686]; translation elongation factor activity [GO:0003746] AAEAGDR 0.37226 323.31 9.82392 9.63332 10.1663 12.5702 10.715 10.5462 11.6991 12.1977 12.768 10.8754 9.11619 10.6883 7.84925 10.6944 10.2802 11.2108 10.9861 10.7829 9.5001 8.74282 8.88212 11.016 12.8539 11.5458 10.7137 9.39298 9.56039 11.1555 11.971 9.70008 11.0522 11.5348 11.187 10.0058 11.1542 7.87197 10.3749 10.4272 9.74534 10.4275 9.42591 10.973 5.5513 9.88319 9.867 9.80684 8.59302 9.03133 8.894 10.4742 9.91028 5.54529 9.65805 9.89875 10.1874 6.90617 9.30481 9.04305 11.6338 10.2206 8.66885 8.77729 8.92131 A0A0B8RZL7 A0A0B8RZL7_PIG Dual specificity protein phosphatase (EC 3.1.3.16) (EC 3.1.3.48) DUSP1 Sus scrofa domesticus (domestic pig) dephosphorylation [GO:0016311] nucleus [GO:0005634] MAP kinase tyrosine/serine/threonine phosphatase activity [GO:0017017]; myosin phosphatase activity [GO:0017018]; protein tyrosine phosphatase activity [GO:0004725] AAQCLLLDCR 0.95078 110.02 8.37143 10.0417 9.42805 12.3213 12.3948 10.9498 12.8028 0 10.6831 0 2.86786 5.48446 9.31612 8.19923 12.0794 9.12399 9.96636 0 8.61132 8.61184 8.91459 7.58406 8.61246 11.264 10.352 7.58646 8.01703 9.76354 7.69481 10.4932 10.1426 10.3046 9.12184 8.90614 0 6.87197 8.92538 0 8.84222 7.43779 0 9.25389 0 6.37535 6.57169 7.61397 0 10.3867 9.08359 5.16261 8.64357 0 10.3323 8.52081 6.00081 7.87129 12.7068 8.35535 6.88618 9.00633 6.52392 8.26627 6.81545 A0A0B8RZL8 A0A0B8RZL8_PIG Delta-like protein DLL1 Sus scrofa domesticus (domestic pig) anatomical structure development [GO:0048856]; Notch signaling pathway [GO:0007219] membrane [GO:0016020] calcium ion binding [GO:0005509]; Notch binding [GO:0005112] AGFSGRHCEDNVDDCASSPCANGGACR 0.95561 256.69 7.84712 8.53555 4.67039 11.2919 10.4332 9.99661 10.9204 11.2878 5.20293 10.3848 7.30588 7.66527 8.874 8.35685 8.79093 13.6266 10.0429 13.0595 8.04505 7.54102 7.24012 11.7724 11.0005 8.62359 10.6834 8.43688 10.9951 10.68 7.77821 11.2708 13.1462 10.3917 6.8835 5.9384 0 5.74865 9.48452 9.59195 0 0 8.52841 8.25413 8.82467 0 7.30907 7.33771 6.44468 9.36562 11.1913 3.14661 9.27368 7.28744 9.81806 8.09777 7.29884 6.98197 7.29563 6.66661 7.4121 8.2436 7.60837 8.12913 10.54 A0A0B8RZM0 A0A0B8RZM0_PIG RNA helicase (EC 3.6.4.13) DHX37 Sus scrofa domesticus (domestic pig) ATP binding [GO:0005524]; nucleic acid binding [GO:0003676] ADCRDTLLAAWR 0.36957 323.31 15.9781 16.0109 15.7404 11.4816 18.3365 12.8344 13.0242 14.1377 10.5489 12.8908 17.6467 12.8279 13.5172 13.1764 18.6368 18.0538 12.8487 17.9217 13.1004 13.3487 11.3033 13.3775 14.0733 16.5612 13.2284 12.9479 12.9907 12.8802 9.85108 12.6965 13.2854 13.0918 7.08044 14.0525 12.9603 13.1987 15.5058 11.293 15.6013 13.7892 13.3049 11.3828 8.82381 12.6802 19.0037 15.9661 15.1461 7.81992 16.6348 12.6087 14.3907 15.4192 15.3336 14.7342 15.279 15.9428 16.0738 14.5112 7.72676 15.1281 13.3425 13.1982 13.17 A0A0B8RZM1 A0A0B8RZM1_PIG Derlin DERL1 Sus scrofa domesticus (domestic pig) proteasomal protein catabolic process [GO:0010498]; response to organic substance [GO:0010033]; response to stress [GO:0006950] endoplasmic reticulum membrane [GO:0005789] AADQNGGGGR 0.97484 57.939 0 9.29951 8.04368 0 0 0 0 8.31615 0 12.0917 8.04979 0 4.15218 0 9.2833 4.72732 0 0 0 0 0 6.0552 0 8.21776 0 7.19663 9.58811 0 0 0 9.58408 9.68089 0 8.80255 7.62666 0 0 0 0 0 0 0 8.12774 8.12634 0 4.89161 4.67378 0 9.0276 0 8.26716 5.89639 0 0 0 0 0 0 6.09233 0 0 0 9.32629 A0A0B8RZM2 A0A0B8RZM2_PIG RNA helicase (EC 3.6.4.13) DDX27 Sus scrofa domesticus (domestic pig) ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; nucleic acid binding [GO:0003676]; RNA helicase activity [GO:0003724] AATTLDEKIEKVR 0.36691 323.31 9.56818 9.26191 12.917 10.5113 11.1445 10.6615 11.9451 11.8392 8.84244 11.0675 9.44863 10.6553 12.781 13.5042 12.7759 16.0053 11.4341 9.99421 7.98105 10.5912 14.4465 10.8736 12.399 11.0318 10.973 12.4661 8.926 10.0081 8.64857 9.08034 8.62607 10.4016 14.1215 9.69244 10.347 11.4433 10.8192 7.86239 11.8979 8.89866 12.3557 3.34951 12.0025 12.5964 12.7265 12.7736 9.5489 9.84804 10.666 13.782 15.0627 12.5996 12.2917 10.9485 11.5225 10.2592 12.86 10.3675 8.87971 8.36072 9.75961 11.809 9.14667 A0A0B8RZM4 A0A0B8RZM4_PIG non-specific serine/threonine protein kinase (EC 2.7.11.1) DAPK1 Sus scrofa domesticus (domestic pig) cellular response to chemical stimulus [GO:0070887]; innate immune response [GO:0045087]; phosphorylation [GO:0016310]; regulation of response to stimulus [GO:0048583]; response to organic substance [GO:0010033]; signal transduction [GO:0007165] cytoplasm [GO:0005737] ATP binding [GO:0005524]; GTP binding [GO:0005525]; protein serine/threonine kinase activity [GO:0004674] ALCEAGCNVNIK 0.36429 323.31 11.0855 11.0723 12.4994 12.0733 13.4217 15.1657 13.397 12.2205 12.9947 12.0958 12.1606 12.4025 14.4844 12.8735 12.6109 12.6694 11.4141 11.6123 13.5852 10.8035 12.4977 11.6151 10.6282 11.7394 12.6972 10.0045 10.1878 11.9186 12.266 10.6784 12.7121 12.0285 12.3225 11.2554 12.0384 9.19687 12.8628 12.4761 13.5056 11.5967 9.75072 11.3728 11.7208 11.0091 13.419 11.7608 12.6006 10.7601 9.92796 12.1956 11.5926 8.80845 10.8953 11.7598 11.4931 10.9733 12.4252 9.68463 7.81179 9.12972 11.3789 10.9695 8.72765 A0A0B8RZM5 A0A0B8RZM5_PIG C-X-C chemokine receptor type 2 (High affinity interleukin-8 receptor B) CXCR2 Sus scrofa domesticus (domestic pig) chemotaxis [GO:0006935] plasma membrane [GO:0005886] C-X-C chemokine receptor activity [GO:0016494]; interleukin-8 binding [GO:0019959] AIHPPYSSPVCYEDMGANTTK 0.96683 90.138 7.25087 0 0 6.17369 9.18795 0 8.46667 8.74184 7.39369 9.16143 0 0 0 8.8089 7.95797 0 5.01961 9.55434 0 5.00724 5.5575 0 0 10.7601 9.67326 8.91749 7.95873 6.63375 0 0 7.7037 8.17383 0 18.1023 0 0 0 18.6086 6.01094 0 6.44798 7.182 9.00576 7.70016 0 6.19877 4.72972 0 0 18.3946 0 0 0 0 0 0 0 0 0 4.69789 6.17367 6.8212 0 A0A0B8RZM6 A0A0B8RZM6_PIG Cytoplasmic tRNA 2-thiolation protein 2 CTU2 NCS2 Sus scrofa domesticus (domestic pig) protein urmylation [GO:0032447]; tRNA thio-modification [GO:0034227]; tRNA wobble uridine modification [GO:0002098] cytoplasm [GO:0005737] nucleotidyltransferase activity [GO:0016779]; tRNA binding [GO:0000049] ACVIEQLCYGCR 0.96885 177.9 10.0953 10.6087 10.1769 9.53691 8.36593 13.917 10.7391 10.2677 8.42874 11.0324 9.44417 9.51088 0 10.2103 9.33479 10.6343 11.1941 11.4726 9.75146 0 11.227 9.05439 0 11.4787 0 10.228 0 9.65336 8.87873 9.32611 0 0 6.62152 9.39187 7.00315 0 7.09455 6.0485 7.77551 6.69404 7.63916 7.24451 0 11.1576 5.07711 7.26669 0 0 0 8.78931 0 0 8.25861 5.62123 4.98709 0 0 8.72819 9.29953 0 0 0 0 A0A0B8RZM8 A0A0B8RZM8_PIG Exportin-2 (Chromosome segregation 1-like protein) (Importin-alpha re-exporter) CSE1L Sus scrofa domesticus (domestic pig) intracellular protein transport [GO:0006886] cytoplasm [GO:0005737] small GTPase binding [GO:0031267] AADEEAFEDNSEEYIR 0.94352 303.02 10.1643 12.2998 12.21 14.4976 14.5804 14.5758 13.8826 13.9633 14.0131 14.0208 14.2358 14.1961 14.4596 14.2344 14.1566 14.6685 15.2414 14.658 13.9302 14.0895 14.242 14.9182 15.2188 15.2357 14.1553 13.9867 14.2294 11.8402 11.6005 11.9269 12.3325 12.4636 12.4997 11.0429 11.4419 11.1877 14.0088 14.0414 13.8993 11.1869 7.59969 10.4687 12.3459 12.5492 12.535 11.1665 11.7329 11.5522 13.401 13.5396 13.3625 10.1128 9.89772 10.8464 10.8304 11.4483 11.2026 12.0296 12.0607 11.8677 9.92936 9.06504 9.95447 A0A0B8RZN0 A0A0B8RZN0_PIG Cytoplasmic polyadenylation element binding protein 4 CPEB4 Sus scrofa domesticus (domestic pig) mRNA 3'-UTR binding [GO:0003730]; translation regulator activity [GO:0045182] ADNIFPFPDRPR 0.96482 161.82 9.59628 5.88723 0 9.05338 10.3639 7.25361 11.1995 10.5036 11.7052 9.68324 11.3354 9.89654 11.9754 10.3097 9.76368 10.4553 10.2118 0 10.4237 8.26035 6.03593 10.7263 9.73948 10.4726 0 6.8071 0 0 12.4839 9.17308 9.18896 11.8172 9.07267 0 9.45039 8.30533 0 7.92813 9.47139 0 0 0 6.6476 8.5006 6.43744 8.99994 10.6007 6.61282 0 9.57433 0 8.87317 0 6.81673 0 0 6.20167 7.53076 10.5049 7.46336 6.93216 0 5.45454 A0A0B8RZN2 A0A0B8RZN2_PIG N-acylneuraminate cytidylyltransferase (EC 2.7.7.43) (CMP-N-acetylneuraminic acid synthase) CMAS Sus scrofa domesticus (domestic pig) N-acetylneuraminate metabolic process [GO:0006054] N-acylneuraminate cytidylyltransferase activity [GO:0008781] AVGYICK 0.94836 241.33 12.1105 11.0264 12.3631 12.7686 10.9003 9.72948 13.0615 13.4393 13.3701 11.3372 11.2088 10.6291 11.9977 12.2408 12.7144 9.10876 11.4817 11.1829 10.2683 11.6541 11.6435 11.9112 11.5648 12.4077 7.55758 11.9243 10.18 11.1366 9.58449 6.98368 10.1907 9.9051 9.639 10.754 6.92362 10.1083 8.49454 10.0945 9.46532 8.57247 10.7328 10.7049 10.707 2.12125 8.75128 10.3563 9.97427 7.92 11.416 6.38414 10.996 10.7296 9.53619 10.3416 8.31111 11.9144 0 9.45113 3.86701 7.26209 10.2144 10.4251 9.74564 A0A0B8RZN4 A0A0B8RZN4_PIG Chloride intracellular channel protein CLIC4 Sus scrofa domesticus (domestic pig) anchoring junction [GO:0070161]; centrosome [GO:0005813]; chloride channel complex [GO:0034707]; cytoplasmic vesicle membrane [GO:0030659]; mitochondrion [GO:0005739]; nucleus [GO:0005634]; plasma membrane [GO:0005886] chloride channel activity [GO:0005254] AGSDGESIGNCPFSQR 0.96013 132.55 8.37243 8.49161 8.05561 9.59255 9.69615 9.1873 8.00045 7.78647 0 9.17083 9.13686 0 9.19316 10.7039 9.57103 10.0971 0 10.5081 0 6.80361 5.43055 10.9335 2.16787 6.25125 10.9093 11.0042 4.73758 9.68324 8.32085 7.23582 5.96671 0 0 0 2.95259 0 0 8.62724 9.71273 8.07066 0 0 8.24046 6.25839 6.07219 8.18408 0 8.00383 9.66026 8.37461 5.94387 0 0 0 0 7.75802 0 7.74886 0 4.54745 6.8674 6.23496 8.63815 A0A0B8RZN7 A0A0B8RZN7_PIG Anamorsin (Cytokine-induced apoptosis inhibitor 1) (Fe-S cluster assembly protein DRE2 homolog) CIAPIN1 Sus scrofa domesticus (domestic pig) apoptotic process [GO:0006915]; hemopoiesis [GO:0030097]; iron-sulfur cluster assembly [GO:0016226]; negative regulation of apoptotic process [GO:0043066] mitochondrial intermembrane space [GO:0005758]; nucleus [GO:0005634] "2 iron, 2 sulfur cluster binding [GO:0051537]; 4 iron, 4 sulfur cluster binding [GO:0051539]; electron transfer activity [GO:0009055]; metal ion binding [GO:0046872]" AASCGEGK 0.96033 115.18 8.32939 12.7771 12.7835 12.3191 0 6.36324 7.76335 8.97163 15.9364 8.10303 14.3531 14.0647 9.58009 8.93242 10.4661 6.09529 6.85723 13.9441 13.7624 13.6376 13.3009 15.3367 11.1582 7.19604 6.80155 9.15725 5.95882 8.16224 10.1408 0 8.67666 6.00986 0 9.10279 0 0 6.93074 0 0 11.7866 8.56426 0 0 0 4.39108 7.64227 8.20149 3.97755 0 6.93887 9.06525 0 0 6.79857 12.1926 0 0 11.8198 11.8537 0 11.2061 9.22697 7.03705 A0A0B8RZN8 A0A0B8RZN8_PIG Complement factor properdin CFP Sus scrofa domesticus (domestic pig) ACDRPTPK 0.96437 72.025 10.3613 0 8.66768 0 0 7.31805 6.8515 0 0 0 0 0 10.2336 9.416 0 6.15957 8.45685 9.68085 0 8.86932 6.77531 9.21259 6.01172 9.00759 0 9.55815 5.90239 9.7398 0 8.74739 8.39793 8.59126 0 0 0 0 0 0 0 4.45562 0 6.07889 0 0 0 8.19854 0 0 0 0 0 0 0 0 0 0 0 0 0 7.10266 0 9.99308 0 A0A0B8RZP0 A0A0B8RZP0_PIG Cyclin-dependent kinase 9 CDK9 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674] AFSLAKNSQPNRYTNR 0.93217 212.64 10.6527 9.0739 9.79693 11.7181 11.6377 12.2987 11.3405 11.2118 10.9521 0 6.9629 10.8046 11.1523 10.9898 11.3895 12.0872 9.72666 11.1843 10.4422 10.7662 11.6255 12.8212 12.9026 12.4266 12.9865 9.17125 10.2437 7.29269 9.32811 7.90857 8.97991 11.1452 12.0915 0 8.19766 9.3338 10.6421 7.8042 6.4867 8.10024 0 5.21335 10.4906 11.6162 8.67306 10.2537 7.52865 6.02861 10.3414 11.1643 0 0 4.90574 0 9.31793 9.1766 9.38569 8.00607 9.03282 5.00225 6.84624 0 0 A0A0B8RZP2 A0A0B8RZP2_PIG Tetraspanin CD63 Sus scrofa domesticus (domestic pig) protein transport [GO:0015031] cell surface [GO:0009986]; late endosome membrane [GO:0031902]; lysosomal membrane [GO:0005765]; melanosome [GO:0042470]; multivesicular body [GO:0005771]; plasma membrane [GO:0005886] AEFNKDFQQQMQNYPK 0.96495 71.896 8.28734 0 8.2305 0 9.69839 0 0 9.9691 8.99115 7.47151 0 0 0 0 9.69187 0 6.34534 8.083 0 9.38133 0 9.49183 0 0 6.71108 7.20144 0 0 0 7.55213 7.7828 0 8.29792 8.47147 8.72185 0 7.95878 8.17523 0 0 0 5.23362 0 5.28351 0 4.44645 0 0 8.19825 8.51869 0 0 0 8.52297 0 4.8489 0 0 8.08587 0 0 0 0 A0A0B8RZP4 A0A0B8RZP4_PIG CMRF35-like molecule 1 CD300LF Sus scrofa domesticus (domestic pig) membrane [GO:0016020] ALRGQER 0.96749 93.886 7.66839 0 8.59104 6.27834 6.02275 0 10.0995 7.93493 0 0 10.2165 7.08375 8.59384 3.0536 10.5685 7.33548 9.97212 8.21354 0 11.5388 7.35438 9.03502 0 0 6.90316 9.30008 7.78365 8.21582 7.06188 7.59208 6.73931 0 0 0 10.9831 10.7192 0 5.78052 0 0 10.2242 0 9.67539 9.03392 9.65544 6.15322 0 8.62498 7.14853 6.04275 6.23569 7.38172 10.1813 8.41113 8.38858 0 8.42068 6.64703 0 0 6.57448 5.82074 4.12284 A0A0B8RZP6 A0A0B8RZP6_PIG Monocyte differentiation antigen CD14 (Myeloid cell-specific leucine-rich glycoprotein) CD14 Sus scrofa domesticus (domestic pig) inflammatory response [GO:0006954]; innate immune response [GO:0045087] Golgi apparatus [GO:0005794]; membrane raft [GO:0045121]; plasma membrane [GO:0005886]; side of membrane [GO:0098552] ECVWPAALSSLNLSFAELEQVPK 0.97267 84.712 14.1271 13.989 13.8183 14.6809 17.6867 14.5474 17.2501 17.2248 17.2779 9.70613 16.2461 16.1845 17.2788 17.1928 17.2953 16.8529 17.1348 16.7251 15.1714 15.4569 15.1068 16.9442 17.2775 17.2451 14.9612 13.9399 14.7037 13.6732 13.3826 13.2335 15.3488 15.0036 14.8641 13.4647 13.1079 12.4588 14.5646 14.4446 14.1721 11.8479 12.1708 11.8887 11.7905 11.7064 11.4597 13.9084 13.8458 14.0241 14.8862 14.6761 14.8933 12.3659 12.3188 12.3536 13.0705 13.1143 13.108 12.5697 12.7608 12.7418 11.6131 11.3494 10.949 A0A0B8RZP8 A0A0B8RZP8_PIG Coiled-coil domain containing 88B CCDC88B Sus scrofa domesticus (domestic pig) cytoskeleton-dependent intracellular transport [GO:0030705] cytoplasm [GO:0005737] AEAAEER 0.3617 323.31 11.3059 13.214 11.541 14.3362 13.5637 11.6558 10.9324 11.8232 13.5968 13.2894 11.8377 15.0395 12.8745 12.2881 12.0489 14.2774 11.9242 13.992 11.5493 11.5494 13.0898 11.6425 13.5821 13.4414 11.5323 10.3326 11.4171 13.4557 13.6064 13.4357 13.481 12.1481 12.6133 14.9197 10.7294 11.2438 11.1109 12.374 11.2385 10.587 11.0285 11.1601 12.2943 12.8955 10.683 11.0388 11.0486 11.5338 11.7124 13.201 12.5874 9.72048 10.9086 12.2465 11.7246 11.4612 11.4008 11.7499 10.6445 10.9109 11.3035 11.1353 11.0542 A0A0B8RZQ0 A0A0B8RZQ0_PIG "Caspase 8, apoptosis-related cysteine peptidase" CASP8 Sus scrofa domesticus (domestic pig) apoptotic process [GO:0006915]; proteolysis [GO:0006508]; regulation of apoptotic process [GO:0042981] cysteine-type endopeptidase activity [GO:0004197] AILGERNLETLKR 0.92308 233.3 10.183 7.09645 8.57509 10.0203 11.0558 7.98031 10.8503 10.2219 12.0232 9.75827 11.0991 10.996 8.29549 11.4453 10.6443 9.80074 11.1567 10.5771 11.2115 10.1147 9.42274 11.6845 10.3403 10.5507 9.23805 8.22352 10.3617 3.58051 8.04751 8.40748 9.65449 10.2804 10.5736 8.12939 10.9098 9.12866 8.27589 11.232 7.47273 7.88807 9.77134 10.4616 9.06213 6.21952 6.43523 8.94248 6.95128 10.6392 10.8132 10.6972 10.0243 9.09479 7.52168 0 9.17976 7.57077 0 8.84577 9.50375 0 9.83036 4.69482 9.21975 A0A0B8RZQ2 A0A0B8RZQ2_PIG F-actin-capping protein subunit alpha CAPZA2 Sus scrofa domesticus (domestic pig) barbed-end actin filament capping [GO:0051016] F-actin capping protein complex [GO:0008290] actin binding [GO:0003779] ADLEEQLSDEEK 0.96579 139.29 8.77538 4.6731 0 10.0604 6.30323 9.53609 11.875 6.86183 0 8.4694 4.62451 11.4167 9.3374 8.96858 6.53737 12.6666 9.3679 9.08622 9.42968 10.2651 0 6.61493 9.5856 0 7.99842 7.34829 7.76937 10.0641 7.68811 7.86956 9.01951 9.54944 9.5832 8.95754 6.39141 5.7914 8.13996 8.89142 0 0 0 7.33718 6.96913 10.353 5.90961 0 8.34132 6.77624 0 7.67101 9.92619 6.63051 4.7981 5.94005 8.91316 7.08651 8.8474 0 6.55118 9.05824 8.56071 9.67474 8.11582 A0A0B8RZQ4 A0A0B8RZQ4_PIG Chromosome 9 open reading frame 78 C9orf78 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] ADSESEEDEQDSEEVR 0.93131 219.78 10.136 12.0359 7.88899 12.5129 12.013 7.48535 12.6034 11.1356 7.33735 8.88737 12.1738 10.0206 10.8941 12.5787 12.1282 8.33436 8.34132 10.9656 10.9076 8.00163 9.04472 11.0637 12.4553 12.155 8.93112 9.58103 9.5193 10.2791 9.83204 10.5277 9.76109 7.08768 8.61905 7.58165 7.40514 0 9.77862 7.2183 11.0203 8.71576 8.8205 0 10.4232 0 3.87765 9.23898 9.7836 9.37593 9.27736 7.78313 9.79033 9.08111 8.60051 10.4926 8.822 7.94028 5.07647 5.96638 0 6.72683 9.6195 8.60177 8.95997 A0A0B8RZQ6 A0A0B8RZQ6_PIG Biotinidase (EC 3.5.1.12) BTD Sus scrofa domesticus (domestic pig) nitrogen compound metabolic process [GO:0006807] "hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides [GO:0016811]" EPCHSSDPGCPDDGR 0.96073 88.429 0 7.88612 0 0 0 9.068 8.36982 9.23905 8.5329 0 9.16952 0 0 9.03903 0 10.8551 8.16942 8.39631 6.75195 7.99752 0 5.9019 12.0502 8.70788 0 7.82534 0 0 0 0 9.47133 9.17954 9.64245 9.83006 9.19323 7.39968 0 7.47946 0 8.36733 9.0318 0 0 4.0213 6.18814 7.87086 0 0 0 7.76062 9.8882 7.83706 6.94251 0 6.78319 7.3773 6.77742 0 0 0 6.50978 0 10.8401 A0A0B8RZQ8 A0A0B8RZQ8_PIG BolA family member 2 BOLA2 Sus scrofa domesticus (domestic pig) protein maturation by iron-sulfur cluster transfer [GO:0097428] "2 iron, 2 sulfur cluster binding [GO:0051537]" DLEAEHVEVEDTTPNR 0.96614 65.069 0 8.17567 7.27854 8.75842 8.89032 8.06032 0 9.18884 8.92169 8.21597 7.99949 5.32546 6.40079 6.49339 10.611 8.62476 9.47596 7.15147 7.16842 8.51116 10.2544 5.24766 0 9.38767 5.12313 7.1644 0 0 9.35784 7.23907 6.30996 10.7625 9.94692 8.44493 8.43041 8.82985 6.74631 0 9.26793 0 8.85125 0 8.69363 0 0 7.37834 7.91713 6.45462 5.68145 0 5.96435 8.56117 0 0 7.8212 0 8.73413 8.20075 0 0 0 0 0 A0A0B8RZR0 A0A0B8RZR0_PIG B-cell CLL/lymphoma 6 BCL6 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] ACNWKKYK 0.96277 258.81 10.2394 0 11.2033 13.3731 12.8507 10.0035 11.5891 11.4936 10.5389 10.9439 9.05409 9.17809 12.0853 11.6182 8.46205 10.7124 10.8662 7.0018 8.80594 7.26969 10.8314 0 8.95131 10.1634 10.3357 9.73127 11.7187 9.06167 6.9216 9.53879 9.32076 11.071 11.5586 10.2851 8.32382 6.60358 11.2718 0 10.2049 8.48591 10.0511 8.19702 8.68342 5.37002 8.56159 7.49378 10.4876 8.43592 3.50195 11.6558 9.0404 9.18656 10.7355 8.03408 11.2384 9.44824 8.01508 8.06641 10.5587 6.26042 10.7612 10.3802 0 A0A0B8RZR2 A0A0B8RZR2_PIG Ataxin 1-like ATXN1L Sus scrofa domesticus (domestic pig) regulation of DNA-templated transcription [GO:0006355] nucleus [GO:0005634] DNA binding [GO:0003677]; RNA binding [GO:0003723] APSATSPPGQLPHHSSTQPLDLAPGR 0.95021 109.65 0 12.0805 0 6.17722 12.2214 10.4509 11.6876 11.6166 12.0225 0 9.06086 7.31325 11.4579 0 0 10.1737 10.3859 10.6271 0 8.61077 0 7.89579 12.208 0 8.13021 8.12913 11.0423 11.2405 0 0 11.5116 0 8.60151 5.77072 10.8044 0 0 7.29526 0 0 7.34296 0 10.2036 7.37321 0 5.74114 9.64695 6.83971 8.03072 0 6.92754 9.49398 0 9.35742 7.99548 0 6.42885 8.78205 6.83782 0 0 9.43971 5.2373 A0A0B8RZR3 A0A0B8RZR3_PIG Calcium-transporting ATPase (EC 7.2.2.10) ATP2C1 Sus scrofa domesticus (domestic pig) Golgi cisterna membrane [GO:0032580] ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; P-type calcium transporter activity [GO:0005388]; P-type manganese transporter activity [GO:0140613] AADIGVAMGQTGTDVCK 0.94412 210.83 11.9777 9.74552 6.43289 11.4096 5.9508 12.0734 14.3222 13.688 8.16254 12.2951 11.4981 10.3063 11.3163 11.5657 11.7448 11.1308 11.2334 10.5392 7.74725 5.39965 12.0066 12.6609 6.87036 10.0447 11.5581 10.1174 10.0112 10.2383 11.5256 8.31741 10.5611 10.3382 12.3194 10.4755 9.26716 10.2643 10.3087 7.50787 9.77467 9.84942 8.95184 10.4324 8.60766 11.5588 7.89506 10.0832 9.44002 9.19283 9.21958 11.5909 10.6411 10.3305 10.428 10.8003 5.94802 7.99044 6.5423 9.90164 8.06571 6.63555 0 7.49641 8.60073 A0A0B8RZR4 A0A0B8RZR4_PIG Autophagy related 2A ATG2A Sus scrofa domesticus (domestic pig) autophagy [GO:0006914] endoplasmic reticulum membrane [GO:0005789]; lipid droplet [GO:0005811]; phagophore assembly site membrane [GO:0034045] AAVEDYLLPSR 0.35915 323.31 12.6214 12.3139 10.1719 12.9091 12.3907 13.547 13.5124 15.3529 13.0353 12.2482 13.5609 12.353 13.2086 13.3245 13.3451 12.7093 12.9317 13.1062 12.5212 11.9576 11.9241 11.689 13.0762 14.1869 10.9856 13.7419 10.3798 11.9308 14.1527 14.1939 12.1105 12.7801 10.9687 11.5051 10.8544 11.4911 11.7237 10.7537 13.7142 11.4524 10.2404 10.7866 11.0118 11.8839 10.7923 10.5324 10.8685 10.9922 13.0535 9.73413 13.4027 11.2269 11.1191 12.4451 11.9292 11.9351 7.14965 12.0699 9.20374 7.78535 7.17023 11.0316 10.9352 A0A0B8RZR6 A0A0B8RZR6_PIG Rho GTPase activating protein 21 ARHGAP21 Sus scrofa domesticus (domestic pig) signal transduction [GO:0007165] anchoring junction [GO:0070161]; cytoplasmic vesicle membrane [GO:0030659]; cytoskeleton [GO:0005856]; Golgi membrane [GO:0000139] GTPase activator activity [GO:0005096] AASQSTAGYNPVVLNR 0.35417 323.31 13.1026 11.9887 13.5036 14.0165 13.343 12.498 13.5699 12.9159 14.7101 13.1001 11.7286 11.1145 13.8276 14.0668 13.448 10.3365 11.6817 12.1479 12.2011 11.848 12.2649 11.9037 12.9465 13.8661 12.2587 12.3781 12.5309 13.1612 11.2926 10.0267 13.416 12.0484 12.8918 10.5618 13.1934 9.96996 13.074 10.9786 12.6445 11.9861 11.7729 12.5407 12.3682 12.8339 12.2094 11.8978 12.2027 12.0959 13.006 12.9515 13.3849 11.5514 12.7881 12.1705 11.6329 12.4074 11.4584 11.0274 10.6644 11.5647 9.3075 10.1361 10.4193 A0A0B8RZR7 A0A0B8RZR7_PIG AP-4 complex subunit mu-1 AP4M1 Sus scrofa domesticus (domestic pig) intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192] clathrin adaptor complex [GO:0030131]; early endosome [GO:0005769]; Golgi apparatus [GO:0005794] AELREGALR 0.97705 184.86 9.50383 8.03436 10.7437 10.3656 10.2559 11.4727 11.6716 3.43922 0 9.85551 0 11.9949 10.2099 10.5829 12.4756 11.6636 0 10.5922 0 6.47255 7.15816 10.0513 9.80487 12.2009 7.88362 9.23621 9.36949 10.4134 8.70193 11.6784 0 10.4809 10.3072 8.99961 7.83422 11.1639 10.8701 11.4757 0 4.73623 0 9.07836 0 9.81046 4.47398 8.81833 0 6.03789 8.49757 6.6512 9.081 0 8.51901 8.42496 8.04658 7.66789 0 0 10.1555 11.7671 0 0 6.72397 A0A0B8RZR8 A0A0B8RZR8_PIG Aminopeptidase (EC 3.4.11.-) ANPEP Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] plasma membrane [GO:0005886] aminopeptidase activity [GO:0004177]; metallopeptidase activity [GO:0008237]; zinc ion binding [GO:0008270] AKGFYISK 0.96454 198.44 7.61611 11.0318 9.8783 11.1535 12.8847 12.2529 10.9569 9.67964 9.63463 10.5073 9.87741 11.319 10.7181 11.0072 9.1756 11.0686 7.99949 11.8353 11.329 8.54951 8.92452 10.3768 8.67465 11.4159 9.65417 10.315 10.2533 11.5041 8.12257 8.85409 12.5227 11.1455 10.8199 0 11.5147 8.8623 8.2785 6.80838 0 5.12433 0 9.32488 8.88292 7.86783 8.60555 6.76075 10.6379 10.6598 9.38282 10.7469 8.69457 9.06926 8.96174 9.42982 10.5371 10.8679 10.5543 0 0 6.30363 7.02392 9.18247 0 A0A0B8RZS0 A0A0B8RZS0_PIG non-specific serine/threonine protein kinase (EC 2.7.11.1) AKT2 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310]; positive regulation of adipose tissue development [GO:1904179] ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674] AKVTMNDFDYLK 0.9662 269.65 13.9021 9.44853 8.30131 11.897 10.0986 14.9813 7.30961 10.8588 15.0109 9.22258 8.13468 13.9942 14.1961 9.61469 8.27808 9.5157 9.10737 9.73818 13.9475 13.7898 8.68951 14.3561 9.50038 5.56697 14.1328 15.1633 10.484 9.92689 6.96382 9.18252 7.6233 10.8206 8.34815 9.62108 9.85916 8.90331 9.64012 11.1783 9.4106 8.19091 9.92813 7.41092 10.8136 0 0 7.6014 9.28852 8.94924 7.64688 12.0916 10.855 9.77291 6.49854 7.62293 9.44768 8.11421 7.78195 6.6978 8.40501 8.5868 6.16438 6.96878 7.93522 A0A0B8RZS1 A0A0B8RZS1_PIG "AF4/FMR2 family, member 4" AFF4 Sus scrofa domesticus (domestic pig) regulation of gene expression [GO:0010468] nucleus [GO:0005634] AATEEPR 0.32903 323.31 12.2252 11.6527 12.1673 13.6632 11.9857 12.144 12.2026 9.91677 12.1251 13.26 11.6728 12.9815 12.9415 13.1605 13.367 12.6125 12.5762 12.5474 13.8352 11.2901 12.5435 12.5075 12.2235 13.2805 13.1567 11.6244 11.6618 10.7324 12.1121 12.4963 13.3432 14.102 12.9697 11.347 11.6788 11.7489 13.1939 11.7146 12.3379 10.4483 9.79349 9.22292 10.5202 11.4859 16.8042 9.95656 11.0804 10.2939 9.94935 12.982 12.0712 8.44977 11.9434 12.4006 11.4822 11.1924 9.98485 11.0454 11.317 9.34465 9.89256 9.00436 8.85944 A0A0B8RZS3 A0A0B8RZS3_PIG ADAM metallopeptidase domain 9 ADAM9 Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] membrane [GO:0016020] metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222] AAPRDCFIDVNSK 0.93393 282.43 12.6422 7.7224 4.64703 9.35052 11.2583 12.473 11.84 11.6092 10.2791 10.3002 9.94358 10.8334 11.293 11.6325 13.0134 7.56163 10.3975 10.1206 10.8832 10.1376 10.7394 5.11657 9.40325 12.3089 9.29914 11.1032 11.2521 10.4448 9.8838 10.7814 9.957 6.35274 9.26017 7.49745 7.23381 4.89181 4.78811 11.0083 6.36627 7.28586 9.07502 8.34487 7.65371 0 6.40465 8.86623 5.08194 8.69453 0 6.07946 11.4413 9.46891 6.12168 0 10.6397 7.87707 8.06269 5.87273 9.7678 3.24925 10.8958 10.4608 8.01452 A0A0B8RZS4 A0A0B8RZS4_PIG Actin-related protein 3 (Actin-like protein 3) ACTR3 Sus scrofa domesticus (domestic pig) cell projection [GO:0042995]; cytoskeleton [GO:0005856]; nucleus [GO:0005634] AEPEDHYFLLTEPPLNTPENR 0.96672 175 12.5211 11.0251 9.81251 10.3766 10.6425 12.275 12.6625 14.0183 10.7147 10.7074 11.5525 12.3832 10.5211 12.2622 12.3945 13.7117 9.89946 11.7381 11.9301 9.67147 13.5837 10.4643 10.9808 12.0432 11.1912 8.93773 11.2075 10.0437 9.79601 9.57631 11.648 6.75221 11.9913 10.1119 6.00708 13.1698 10.5212 12.9968 10.2095 10.7318 0 11.5482 10.1076 0 10.2347 10.949 8.49526 6.65421 10.4568 10.4111 10.5062 5.00473 9.32647 7.85044 6.47218 9.09014 0 8.06942 9.02367 8.8505 10.3969 0 9.20792 A0A0B8RZS5 A0A0B8RZS5_PIG long-chain-fatty-acid--CoA ligase (EC 6.2.1.3) ACSL3 Sus scrofa domesticus (domestic pig) fatty acid metabolic process [GO:0006631] membrane [GO:0016020] nucleotide binding [GO:0000166] ADFFEDENGQR 0.96175 262.51 12.2442 12.441 12.3927 14.147 13.902 14.4658 14.8361 14.8856 14.5933 13.458 13.9506 13.2815 14.3464 13.8206 13.866 13.9398 14.3929 14.0457 9.6647 13.4103 13.5264 14.5032 14.9113 14.5126 12.6038 12.5144 13.9749 12.4962 12.9411 12.7163 13.4305 13.2312 10.0023 11.5759 12.6128 12.9731 11.9477 11.848 12.9067 12.5358 11.725 12.385 12.4145 12.3362 12.3205 12.2646 11.7497 11.7553 13.2706 13.5272 13.5554 11.8889 11.9581 12.0902 12.2317 9.46601 11.5469 11.322 11.6892 0 10.6577 10.4009 10.4363 A0A0B8RZS7 A0A0B8RZS7_PIG acetyl-CoA C-acetyltransferase (EC 2.3.1.9) ACAT2 Sus scrofa domesticus (domestic pig) "acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]" AGHFDKEIVPVFVSSR 0.95687 111.5 10.0228 11.3097 9.19896 13.066 10.3491 0 9.6861 7.74571 11.3611 8.44997 10.9586 7.67983 11.367 11.8333 12.1011 0 11.5009 8.84024 12.6228 11.6239 9.82193 12.3974 12.0806 9.33845 0 11.3512 10.4062 9.88675 10.195 9.77867 8.2784 9.28515 8.79578 8.81861 8.52411 8.99044 4.70371 11.2974 11.2204 9.80869 0 0 11.2754 8.0365 9.70558 9.13437 0 0 10.6483 9.79545 10.0823 8.5297 8.5345 0 0 7.58984 7.82343 3.83643 6.91325 9.73347 0 0 5.28559 A0A0B8RZS8 A0A0B8RZS8_PIG Chemokine (C-X3-C motif) ligand 1 ABCD3 Sus scrofa domesticus (domestic pig) long-chain fatty acid import into peroxisome [GO:0015910] peroxisomal membrane [GO:0005778] ABC-type transporter activity [GO:0140359]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; long-chain fatty acid transporter activity [GO:0005324] ALGLHGKK 0.93114 282.41 11.1447 8.47917 9.30583 10.7534 8.49025 11.4693 7.31985 13.7252 10.0715 11.3101 9.96824 9.62315 10.9473 9.52636 11.4743 10.7093 9.38603 0 10.3918 10.6119 10.588 12.5661 11.3552 10.7827 9.12606 9.55905 9.15899 10.8543 9.1333 10.5166 9.59186 9.9264 7.87756 9.26219 10.6319 9.63499 10.0983 10.212 9.21805 11.2658 10.6246 8.85209 9.80797 6.78424 9.67398 10.9088 8.39699 10.1024 10.94 9.23069 8.47395 9.754 7.25786 8.64436 10.0329 10.5037 9.99138 12.0228 3.92362 9.73429 7.87768 0 10.1369 A0A0B8RZT0 A0A0B8RZT0_PIG "Lactosylceramide 4-alpha-galactosyltransferase (EC 2.4.1.228) (Alpha-1,4-N-acetylglucosaminyltransferase) (Alpha-1,4-galactosyltransferase) (Globotriaosylceramide synthase) (UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase)" A4GALT Sus scrofa domesticus (domestic pig) lipid metabolic process [GO:0006629] Golgi membrane [GO:0000139] hexosyltransferase activity [GO:0016758] DTPLAAWYAAAR 0.95634 129.01 7.75629 10.7087 9.07615 10.4477 5.30272 10.8826 0 8.87863 14.4564 11.5615 9.57886 0 9.76618 11.412 11.561 8.47849 0 8.91301 0 6.06059 10.7527 6.4126 6.76301 14.3634 0 5.81785 10.8939 3.74749 10.6029 10.1706 11.7075 11.6876 11.7666 10.7684 11.2035 10.4567 9.84657 9.50022 5.821 7.86716 8.6595 6.29142 8.69725 4.00495 0 9.15127 10.3734 6.76408 10.4328 0 4.79286 8.73098 0 10.0226 0 3.98176 5.06923 0 5.68246 0 0 0 0 A0A0B8RZY1 A0A0B8RZY1_PIG Zinc finger protein 148 ZNF148 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] AEAQPVHQAYQMSSFEQPFR 0.94767 277.3 11.2823 13.2483 12.5859 15.1751 11.0833 12.1396 11.9492 11.532 14.9386 10.3756 9.49251 6.97418 14.6359 11.9646 14.5326 11.5008 11.6951 10.8176 11.1547 11.4437 10.694 11.7889 12.1167 10.5438 6.02035 8.67909 10.5673 8.51991 9.97011 5.98928 10.4196 14.0252 11.5649 10.6388 10.903 10.528 10.0958 11.0319 10.7038 10.2521 7.38879 11.803 15.2678 11.1574 10.7888 9.80731 8.51333 9.78293 10.2218 5.09145 11.4068 10.427 11.1753 15.6381 9.2094 8.47094 9.90272 6.17191 6.16489 9.1638 5.73091 8.85162 7.65284 A0A0B8RZY2 A0A0B8RZY2_PIG Palmitoyltransferase (EC 2.3.1.225) ZDHHC8 Sus scrofa domesticus (domestic pig) Golgi membrane [GO:0000139]; mitochondrion [GO:0005739] protein-cysteine S-palmitoyltransferase activity [GO:0019706] ADEDEDKEDDFR 0.95176 205.55 11.5424 11.5506 10.5738 8.72093 11.1641 5.28577 10.6795 10.4958 10.2015 10.621 6.49595 9.46966 0 10.125 8.19992 8.82152 10.5681 11.2461 6.67285 8.42987 11.5145 4.91972 10.2147 0 0 5.99268 7.31913 8.17103 9.01215 0 9.76706 9.66615 0 0 10.1111 3.64536 8.59645 7.56377 10.0272 0 8.19697 9.00837 10.9388 6.43896 7.19554 6.92588 8.77564 8.92253 9.68011 10.6231 9.12518 9.85261 0 9.85685 0 8.23735 0 6.63906 5.21828 7.60363 8.07419 8.71641 6.31147 A0A0B8RZY3 A0A0B8RZY3_PIG Zinc finger and BTB domain containing 24 ZBTB24 Sus scrofa domesticus (domestic pig) AYADFQNNHSSPKPATLNTAGAPVVVISNK 0.94427 285.78 8.10879 8.13822 9.20413 11.7825 8.97413 10.5499 10.9833 11.7789 10.4009 10.7885 13.068 8.1219 12.9665 13.1913 9.02392 11.3697 11.7223 7.47241 9.52777 10.3106 10.1928 10.047 10.7328 11.5774 9.71636 10.1998 10.4919 10.4507 9.11468 9.61644 8.62892 10.561 6.0558 8.224 0 10.7591 9.42779 8.8009 5.72003 9.9176 8.29122 10.6581 5.13648 9.40975 10.5953 7.24403 7.92594 8.3869 9.872 9.98925 9.46616 5.28588 7.24593 9.68591 9.6139 8.41498 8.31773 7.25955 6.23178 8.8116 9.36949 0 6.80258 A0A0B8RZY4 A0A0B8RZY4_PIG Protein YIPF3 (YIP1 family member 3) YIPF3 Sus scrofa domesticus (domestic pig) cell differentiation [GO:0030154] Golgi apparatus [GO:0005794]; plasma membrane [GO:0005886] AFSLYANIDILRPYFDVEPAQVR 0.96843 78.065 6.88886 0 0 0 7.88826 8.60159 9.83919 3.90178 0 9.82561 9.61137 3.31471 3.78429 0 0 0 0 10.1497 7.48784 7.39017 9.53654 0 8.17946 7.58969 0 5.54523 9.36378 7.64616 0 0 9.78 11.7323 0 9.51812 0 0 7.60222 0 0 5.9847 6.86765 3.50538 0 7.27789 0 0 0 0 10.2262 6.58924 8.58722 7.31424 7.76693 4.59926 0 4.78429 12.5686 0 0 0 7.23151 0 7.65542 A0A0B8RZY5 A0A0B8RZY5_PIG WDFY family member 4 WDFY4 Sus scrofa domesticus (domestic pig) AEDFVSCIENYR 0.35172 323.31 11.5857 11.8169 10.7326 12.9908 12.454 12.6849 13.2422 13.8634 12.7952 12.3052 11.5549 12.1215 13.4754 13.0548 13.7395 13.6779 12.0042 12.1759 11.6162 10.4675 11.233 13.1838 13.877 12.9445 11.0499 12.8322 10.7277 11.1455 11.847 10.5165 13.7064 13.2806 12.4544 13.2701 11.3082 13.1297 12.3103 11.6443 10.5365 10.8528 11.7086 11.4963 11.3842 11.9198 11.5108 11.9786 10.7979 11.3394 11.8057 12.6814 10.5781 10.3688 11.1847 10.9212 10.4299 10.216 8.92621 10.2458 10.8255 9.04469 9.93781 10.0342 10.2448 A0A0B8RZY6 A0A0B8RZY6_PIG Vacuolar protein sorting-associated protein 18 homolog VPS18 Sus scrofa domesticus (domestic pig) intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192] late endosome membrane [GO:0031902]; lysosomal membrane [GO:0005765] metal ion binding [GO:0046872] ADLDELVAAECVYCGELMIR 0.34932 323.31 13.313 12.7595 12.072 11.5242 14.0378 14.3051 14.5537 11.4775 11.341 12.683 9.87166 13.4324 13.9782 11.4056 12.088 14.7263 11.4819 13.649 11.2338 13.6192 9.59736 11.6917 11.8346 10.6294 13.6052 11.2248 10.659 13.5319 13.9706 13.5256 13.2817 10.5429 14.0035 9.43815 11.8264 9.57996 12.8864 12.339 13.6175 13.1239 11.5947 8.72632 7.41583 10.0984 10.5457 10.6402 12.0846 7.60133 9.51318 6.67962 13.0216 12.3559 12.2932 13.2058 6.81583 7.296 9.32231 10.1538 11.5795 11.8628 3.28508 9.82437 9.58278 A0A0B8RZY7 A0A0B8RZY7_PIG Vesicle-associated membrane protein 7 (Synaptobrevin-like protein 1) VAMP7 Sus scrofa domesticus (domestic pig) exocytosis [GO:0006887] endoplasmic reticulum membrane [GO:0005789]; Golgi apparatus [GO:0005794]; late endosome membrane [GO:0031902]; lysosomal membrane [GO:0005765]; neuron projection [GO:0043005]; phagocytic vesicle membrane [GO:0030670]; synapse [GO:0045202]; transport vesicle membrane [GO:0030658] AFNFLNEIKK 0.95308 110.38 8.72274 5.79382 0 9.37563 9.60285 8.41244 10.7148 0 5.74672 8.2589 9.32362 8.28128 9.13866 9.12492 11.2222 5.13365 8.09318 8.03403 0 9.58808 8.28563 10.5344 0 0 0 8.85353 8.71881 8.98425 9.52716 10.4851 7.46058 0 9.37003 0 8.99543 0 0 6.41827 5.14918 0 8.04029 4.00854 11.9534 8.57406 0 4.92813 0 0 9.10205 0 5.7356 0 5.85965 11.1337 0 8.1103 5.5718 5.92605 0 0 0 0 0 A0A0B8RZY8 A0A0B8RZY8_PIG UHRF1 binding protein 1-like UHRF1BP1L Sus scrofa domesticus (domestic pig) AEDLLPETASLSENLEISK 0.34694 323.31 13.0047 11.241 12.4427 14.0804 12.7366 13.6472 13.9123 13.1496 12.5249 12.1795 11.7 13.0248 16.0032 16.1852 10.1503 14.2033 10.8482 13.7837 9.70843 13.033 13.007 11.1337 12.6074 13.0874 14.9359 11.514 14.8943 11.8518 11.4487 11.284 11.9296 13.5379 12.0246 12.4082 12.8764 12.2663 12.1001 12.0887 11.3722 10.6698 11.1362 5.80062 11.0705 0 10.8961 9.40256 11.6662 7.8947 0 9.05539 11.4943 8.40246 11.2444 11.6624 9.64014 9.37504 9.89886 10.4681 9.89571 11.3491 8.41321 8.5941 9.19335 A0A0B8RZY9 A0A0B8RZY9_PIG E2 ubiquitin-conjugating enzyme (EC 2.3.2.23) UBE2S Sus scrofa domesticus (domestic pig) ubiquitin-dependent protein catabolic process [GO:0006511] ATP binding [GO:0005524]; transferase activity [GO:0016740] ALASGAAASPTEPMAPGGPGGAEGPMAK 0.96873 69.943 2.73983 8.60877 9.9249 10.743 6.86071 0 0 0 10.0799 0 8.12624 0 7.23745 9.87926 8.28924 0 0 0 0 0 0 9.84765 0 0 0 0 0 0 10.4025 0 0 0 0 0 0 7.00899 0 5.80519 0 4.68812 0 0 7.97636 0 0 9.00762 5.83124 0 8.96682 0 0 0 0 0 0 0 7.14853 6.82629 0 7.61949 0 6.48027 7.61154 A0A0B8RZZ1 A0A0B8RZZ1_PIG Tetratricopeptide repeat domain 13 TTC13 Sus scrofa domesticus (domestic pig) AEILSPLGR 0.34459 323.31 10.3022 9.56653 11.4129 9.82552 11.2495 10.4841 10.3286 11.326 9.90742 9.55568 9.89498 10.3942 7.69634 10.604 11.1543 6.21628 10.6446 11.1028 11.185 11.2058 9.66525 11.2869 9.96795 8.90198 10.5603 0 10.5659 10.391 10.7426 8.93452 11.1458 12.3683 11.3811 10.281 9.56114 11.377 11.3306 11.2125 11.7252 10.0879 10.6834 9.11497 10.8682 11.018 8.23807 9.93693 10.8364 11.3529 10.5313 8.94568 9.59085 9.92002 9.31232 8.52517 9.86695 10.2312 10.2505 9.77946 8.13796 8.39921 8.08497 8.31461 7.53037 A0A0B8RZZ2 A0A0B8RZZ2_PIG Tripartite motif-containing protein 44 TRIM44 Sus scrofa domesticus (domestic pig) zinc ion binding [GO:0008270] AAMIELVER 0.96951 78.331 8.44323 0 12.5816 12.2457 12.4058 6.80542 12.9532 8.6143 8.53391 12.5526 12.6388 12.2788 9.32959 12.5096 0 6.33798 7.89166 0 12.4298 9.01898 5.26198 11.8286 8.51278 12.7404 12.3609 12.289 8.14751 13.2216 0 8.37747 13.8905 13.8102 13.6844 10.5582 0 0 5.84644 7.98105 9.70729 8.22313 12.3825 12.367 11.6589 11.5305 11.3592 12.7441 12.7634 8.69558 12.799 12.6591 8.61058 12.2085 12.1526 12.3899 12.6381 7.71246 12.4632 11.3036 9.83618 11.6897 10.6774 0 7.56735 A0A0B8RZZ3 A0A0B8RZZ3_PIG Tumor protein p53 binding protein 1 TP53BP1 Sus scrofa domesticus (domestic pig) DNA damage response [GO:0006974] nucleus [GO:0005634] AADISLDNLVEGK 0.34228 323.31 7.7652 12.7603 12.5788 12.8593 11.8963 8.50708 10.5489 12.3295 11.5022 9.70701 10.9183 10.1404 11.5222 8.8382 12.9039 11.0556 10.9339 11.6126 11.5476 13.8771 11.4473 9.59171 13.426 12.3137 9.48014 12.2004 9.86048 10.3692 9.84748 8.1079 11.5805 10.8842 9.38995 10.5262 10.0074 10.7542 11.0013 10.4447 8.50989 12.3262 9.48059 9.55444 8.90707 10.6632 10.5718 9.69321 10.4077 13.285 9.74725 7.12019 9.01773 9.82311 10.8026 8.83403 6.5713 8.8525 10.4828 9.11234 9.81975 8.08974 9.7838 9.05303 7.34749 A0A0B8RZZ4 A0A0B8RZZ4_PIG Transmembrane and ubiquitin-like domain containing 2 TMUB2 Sus scrofa domesticus (domestic pig) ubiquitin-dependent ERAD pathway [GO:0030433] membrane [GO:0016020] FLNDTEELAVARPEDTVGALK 0.96621 42.953 5.01324 0 0 5.48065 0 0 0 0 0 0 5.24485 8.0974 0 0 9.219 5.27348 0 4.91719 0 0 0 0 8.45775 0 0 8.01262 0 0 0 0 0 10.2573 0 0 0 0 0 4.41373 7.30378 0 8.31179 0 9.55227 0 8.41912 6.35189 6.80271 6.36352 0 0 7.57826 0 8.73457 0 4.71732 0 0 0 0 0 0 0 0 A0A0B8RZZ5 A0A0B8RZZ5_PIG Transmembrane emp24 domain trafficking protein 2 TMED2 Sus scrofa domesticus (domestic pig) protein transport [GO:0015031] cytoplasmic vesicle membrane [GO:0030659]; endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; Golgi apparatus [GO:0005794] AINDNTNSR 0.96936 61.983 9.07698 5.67056 0 10.0334 8.46846 11.7448 0 7.84712 0 7.77808 0 0 9.09819 7.13535 7.56834 0 0 6.2109 12.5271 8.80845 9.84174 8.97373 10.0783 8.51483 0 7.54774 10.6082 0 0 0 0 8.78172 5.00468 0 9.32427 5.49835 0 0 0 0 0 0 0 6.50802 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A0B8RZZ6 A0A0B8RZZ6_PIG Protein-glutamine gamma-glutamyltransferase 2 (EC 2.3.2.13) (EC 3.5.1.44) (Isopeptidase TGM2) (Protein-glutamine deamidase TGM2) (Protein-glutamine dopaminyltransferase TGM2) (Protein-glutamine histaminyltransferase TGM2) (Protein-glutamine noradrenalinyltransferase TGM2) (Protein-glutamine serotonyltransferase TGM2) (Tissue transglutaminase) (Transglutaminase-2) TGM2 Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] chromosome [GO:0005694]; cytosol [GO:0005829]; extracellular region [GO:0005576]; mitochondrion [GO:0005739]; nucleus [GO:0005634]; plasma membrane [GO:0005886] GTP binding [GO:0005525]; metal ion binding [GO:0046872]; peptidase activity [GO:0008233]; protein-glutamine gamma-glutamyltransferase activity [GO:0003810] AEDLILER 0.96875 270.7 11.8714 12.7387 14.1756 16.6186 16.6371 16.4294 16.1321 15.9312 15.0317 15.5751 15.6009 15.6341 16.144 15.8692 14.9831 16.1408 12.277 14.3282 14.5888 14.1699 14.4302 15.1427 14.9418 9.07355 15.2984 13.9507 14.0483 9.96622 9.40593 13.8014 12.0533 14.9381 15.0817 9.4955 12.7734 6.51557 10.6078 13.052 13.1611 10.8559 9.91237 9.41773 10.9885 13.3703 10.0568 12.9438 14.0441 12.9016 13.1833 13.5028 13.5497 10.6289 13.8245 13.9025 13.282 11.1377 13.514 13.8243 10.7773 13.9978 12.0262 10.2413 10.3053 A0A0B8RZZ7 A0A0B8RZZ7_PIG Tafazzin family protein TAZ Sus scrofa domesticus (domestic pig) phospholipid metabolic process [GO:0006644] mitochondrial inner membrane [GO:0005743]; mitochondrial outer membrane [GO:0005741] acyltransferase activity [GO:0016746] AENTSAVEMR 0.96282 118.44 9.32811 12.0605 11.9294 10.6653 10.6828 4.75312 10.7034 7.06361 9.1102 8.78411 10.107 0 12.1165 10.2464 10.4135 9.982 9.05463 5.25939 8.63999 0 11.2943 11.189 10.3804 10.9578 9.59085 8.51814 0 6.97327 12.2555 12.3615 10.5025 9.89001 8.9699 5.33435 8.596 5.26112 0 5.8628 8.54527 5.86624 0 10.1415 8.83794 0 0 9.66019 6.53761 0 6.95652 0 6.24895 0 10.2291 9.33103 0 9.24322 5.34017 9.53693 0 0 0 7.54458 0 A0A0B8RZZ8 A0A0B8RZZ8_PIG TGF-beta activated kinase 1/MAP3K7 binding protein 2 TAB2 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] kinase activity [GO:0016301]; metal ion binding [GO:0046872]; ubiquitin binding [GO:0043130] AIGSNSATSPR 0.97361 170.95 7.44741 7.53512 12.0792 4.17608 9.74973 10.3317 10.2193 5.58042 8.47768 10.501 9.63541 8.44394 9.17445 8.99952 8.11317 11.2621 10.0682 6.46734 9.77068 8.71679 7.28161 10.8843 9.26256 7.8645 6.18493 9.06899 9.67288 9.05409 10.1471 6.31005 8.63691 7.43029 10.5494 10.6326 0 10.5776 10.988 10.7419 10.1928 9.75457 10.1638 0 10.1012 4.88748 9.41011 5.89305 9.60403 6.46426 0 10.4772 9.75669 9.79862 3.53531 9.90396 8.56777 4.32546 9.37123 7.01134 9.17981 8.11447 11.273 10.292 7.72089 A0A0B8RZZ9 A0A0B8RZZ9_PIG SURF1-like protein SURF1 Sus scrofa domesticus (domestic pig) mitochondrial inner membrane [GO:0005743] EARDAGR 0.96889 93.981 6.25675 10.807 0 12.9775 5.9435 10.9702 0 14.3258 13.9846 13.5919 13.5807 13.4819 14.1008 14.3208 14.5726 0 13.6674 8.25866 10.6135 13.9137 13.9383 14.2652 0 8.94108 13.0471 13.2183 13.4885 9.49723 0 0 12.4538 13.0195 9.53629 0 8.52873 11.3987 0 12.6362 0 8.16466 8.97777 9.4072 10.6332 11.5392 9.89807 11.7948 12.1295 11.8588 7.31606 0 12.6806 9.23069 8.88252 9.10345 9.89706 9.44733 9.28545 8.23117 8.53745 0 6.41902 6.03778 7.63583 A0A0B8S001 A0A0B8S001_PIG Stromal interaction molecule 1 STIM1 Sus scrofa domesticus (domestic pig) calcium ion transport [GO:0006816]; regulation of transport [GO:0051049] membrane [GO:0016020] calcium channel regulator activity [GO:0005246]; metal ion binding [GO:0046872] AAPEEDNGSTGEETDSSPGR 0.97222 307.62 11.4619 9.17562 6.04466 10.9816 10.7177 10.178 8.77248 11.7401 10.0703 9.5046 8.3378 7.88362 12.9326 11.0555 11.391 10.6697 10.3355 10.3309 8.95163 11.7154 11.1161 11.4892 9.48045 9.09614 10.6775 9.57707 0 11.2297 11.724 9.75302 10.3839 8.74389 10.695 9.11484 10.8003 9.23554 2.78954 10.6007 9.50922 6.09565 9.09508 9.981 10.1447 10.1378 11.2619 9.87873 9.78465 10.1348 7.89827 9.42246 10.6717 8.0486 10.5853 10.2195 6.33857 10.0419 10.991 10.8485 9.6991 9.9492 10.0062 10.6337 9.04508 A0A0B8S002 A0A0B8S002_PIG Arsenite-resistance protein 2 SRRT Sus scrofa domesticus (domestic pig) mRNA processing [GO:0006397] nucleus [GO:0005634] nucleic acid binding [GO:0003676] ADAIVKMLDAAVIK 0.34 323.31 10.9633 14.2036 12.0425 14.2306 13.1527 13.6313 12.5423 15.0762 13.6821 12.2702 12.8136 11.7707 14.6713 14.2825 12.2766 12.5171 13.0822 14.2031 13.3461 12.2344 10.8553 12.3263 11.5378 14.2769 11.7146 13.3662 12.4245 11.1572 11.8228 10.8795 13.1611 14.1372 11.673 11.5583 10.8771 9.82171 11.6032 12.8017 13.1399 11.0264 10.0161 12.52 12.3241 13.3166 11.0256 11.5302 11.0533 11.3783 12.547 11.2248 10.4433 10.8139 11.2907 12.8383 13.3163 11.1681 7.93587 11.598 10.2233 9.67758 9.47056 10.7183 10.7948 A0A0B8S003 A0A0B8S003_PIG Spastic paraplegia 20 (Troyer syndrome) SPG20 Sus scrofa domesticus (domestic pig) AEGENEFQIPGR 0.96185 262.35 11.7247 12.2172 10.73 12.2109 12.9064 13.4358 11.7047 13.0509 13.329 12.2134 12.6607 11.4997 13.3315 12.3907 11.1911 7.85699 12.1299 10.8551 12.5263 11.0325 8.37143 12.5586 12.7807 13.9116 11.3201 0 10.3919 11.506 10.8939 11.1857 12.3862 12.9448 13.2413 11.9149 11.3129 11.623 12.8474 11.8321 11.8108 9.45633 11.7055 11.893 11.5495 5.21517 9.80639 12.1255 6.24536 11.6568 11.9102 12.1559 11.6492 11.8572 11.7329 11.7458 10.3987 10.406 10.2894 9.42576 11.3341 7.7366 7.87627 9.80835 9.97312 A0A0B8S004 A0A0B8S004_PIG Sp1 transcription factor SP1 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] DSEGRGSGDPGK 0.96934 170.67 9.8614 10.3884 10.0494 10.1794 10.9989 11.1338 9.64149 10.4063 9.13181 10.5896 9.67258 0 8.42013 10.4541 10.6289 12.4399 13.188 10.1992 12.7679 6.78031 9.06194 9.3755 12.0631 9.92825 7.29572 9.70397 8.53776 7.00977 10.1722 9.76412 10.0243 6.36742 11.1815 8.99961 9.23158 8.83153 5.39756 9.27347 0 9.49183 0 0 0 11.3823 11.3624 10.0417 8.58301 9.07596 7.60837 8.39184 7.2426 7.96151 8.77419 7.98908 6.20134 8.11775 10.936 7.74174 7.86913 0 7.04024 5.6399 6.6476 A0A0B8S005 A0A0B8S005_PIG Smad nuclear interacting protein 1 SNIP1 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] ADGTVGR 0.93404 227.94 8.99243 8.90938 8.63016 12.6192 12.4309 11.173 9.33543 6.69516 9.96251 7.82712 11.329 5.60265 11.0987 6.4611 13.1634 12.2419 8.91304 12.8122 11.9172 0 8.02398 12.0311 12.3079 11.9712 11.1642 0 10.9637 10.7926 9.77218 9.83942 10.2454 10.6296 9.6106 13.8489 9.02231 8.57304 4.65088 9.37382 9.40601 8.43246 8.11738 8.61526 9.04308 3.0571 7.21607 5.59 9.94369 3.04916 11.4517 0 0 8.57137 6.75716 8.98692 0 9.61572 4.86032 6.87529 8.88451 6.76699 7.59798 5.90667 8.734 A0A0B8S006 A0A0B8S006_PIG Structural maintenance of chromosomes 6 SMC6 Sus scrofa domesticus (domestic pig) double-strand break repair [GO:0006302] "chromosome, telomeric region [GO:0000781]; nucleus [GO:0005634]" ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887] AAFNDMR 0.33775 323.31 12.6974 12.0683 12.04 11.99 13.0812 13.3652 13.6571 12.5364 13.4622 13.0052 12.0808 11.6068 13.7455 13.0992 12.9756 13.2064 12.4254 11.9613 11.3915 12.3751 12.7104 11.7952 11.3444 11.8989 10.6781 12.4259 11.9152 9.89474 13.2805 10.7356 13.3509 11.3506 9.99676 10.2114 10.5582 9.07623 12.8476 12.0302 12.8513 10.5154 9.37043 10.8351 11.2113 11.3664 9.85915 12.0959 10.0629 11.0258 11.9493 11.3385 12.0736 9.87794 8.27678 10.5099 10.7136 11.6187 11.3725 10.8113 10.0079 8.55984 10.8817 10.076 9.96534 A0A0B8S007 A0A0B8S007_PIG Sodium/hydrogen exchanger SLC9A6 Sus scrofa domesticus (domestic pig) regulation of intracellular pH [GO:0051453] plasma membrane [GO:0005886]; recycling endosome membrane [GO:0055038] sodium:proton antiporter activity [GO:0015385] AANIYPLSLLLNLGRRSK 0.95666 102.33 11.9553 9.69028 9.65685 10.0443 6.91874 5.68358 0 7.41092 10.5881 8.14522 0 0 0 9.87928 6.74792 0 0 9.12254 5.8748 10.1218 9.17355 11.1086 9.35984 7.88405 9.86555 8.85468 5.65804 8.83355 10.4893 8.557 10.1022 8.61438 0 10.8584 11.2718 6.13272 9.38744 0 10.9784 8.91573 7.74953 10.8577 0 0 0 0 9.26747 0 8.76835 0 11.8388 0 8.48567 0 8.19574 7.04767 0 3.18837 7.80129 0 0 5.30531 0 A0A0B8S008 A0A0B8S008_PIG Large neutral amino acids transporter small subunit 4 (L-type amino acid transporter 4) (Solute carrier family 43 member 2) SLC43A2 Sus scrofa domesticus (domestic pig) basolateral plasma membrane [GO:0016323]; lateral plasma membrane [GO:0016328] transmembrane transporter activity [GO:0022857] APTLATAHR 0.96742 122.18 0 5.54479 10.1249 11.3409 9.90812 8.9609 5.10551 10.4099 9.00759 10.4537 9.93301 7.42543 10.4913 10.7327 8.05767 10.386 7.71294 8.40148 10.0833 0 9.42354 0 12.4346 0 10.3449 10.0585 8.28951 8.17996 9.18572 7.27268 7.80277 8.83971 9.6087 0 10.0305 11.3443 0 0 7.10392 10.8854 7.27956 6.93687 11.9102 11.3065 11.0537 5.59294 7.61302 10.0362 9.84853 9.38035 9.26475 9.18269 8.84941 11.791 8.6518 7.224 5.7036 0 0 0 0 9.39356 0 A0A0B8S009 A0A0B8S009_PIG UDP-N-acetylglucosamine transporter (Golgi UDP-GlcNAc transporter) (Solute carrier family 35 member A3) SLC35A3 Sus scrofa domesticus (domestic pig) carbohydrate transport [GO:0008643] Golgi membrane [GO:0000139] pyrimidine nucleotide-sugar transmembrane transporter activity [GO:0015165] ALNRILHDEILNKPMETLK 0.9712 78.854 0 8.92032 8.33454 0 0 6.08676 0 0 0 4.03562 0 7.10706 0 4.61235 4.40803 0 0 0 0 9.04305 10.1523 11.0015 3.09778 0 5.57915 0 9.63693 0 5.98803 0 0 6.54856 13.1476 0 0 0 0 7.09814 6.22986 0 0 0 10.5887 7.0648 0 0 0 0 8.46193 6.90773 7.68377 0 0 0 6.87073 0 6.65406 4.39191 4.38446 6.3027 0 0 0 A0A0B8S010 A0A0B8S010_PIG "Solute carrier family 25 (Mitochondrial iron transporter), member 28" SLC25A28 Sus scrofa domesticus (domestic pig) iron ion transport [GO:0006826]; transmembrane transport [GO:0055085] mitochondrial inner membrane [GO:0005743] AVWQNEGAGAFYR 0.96564 74.059 6.6233 0 8.84442 7.28568 7.34394 9.15277 9.89963 0 8.44406 0 0 0 9.38664 10.0315 0 8.97212 0 4.94776 8.87175 0 0 0 10.2437 6.35009 5.78902 4.27739 0 0 8.51846 8.65828 9.14644 9.09302 8.9635 7.73437 5.08793 3.10165 8.96217 0 0 10.5482 5.84847 0 0 0 0 7.93475 0 0 7.87964 5.31727 0 0 0 0 4.72732 0 0 0 0 0 6.93923 8.61806 0 A0A0B8S011 A0A0B8S011_PIG "Solute carrier family 11 (Proton-coupled divalent metal ion transporter), member 2" SLC11A2 Sus scrofa domesticus (domestic pig) iron ion transport [GO:0006826] late endosome membrane [GO:0031902]; lysosomal membrane [GO:0005765] metal ion transmembrane transporter activity [GO:0046873] ANKEEVR 0.96523 50.661 5.52237 12.0024 0 6.96774 0 6.63288 8.77676 0 0 11.2649 9.2639 0 0 0 0 0 0 0 0 0 4.81101 9.65698 0 0 0 4.97577 2.48491 0 0 0 9.34815 8.10386 0 0 6.2194 8.65471 7.22968 11.6408 8.23898 2.80335 0 0 0 0 2.64628 3.09479 0 5.72825 9.18294 6.59477 7.45475 0 0 0 0 5.04286 0 5.50026 0 0 0 0 0 A0A0B8S012 A0A0B8S012_PIG SIN3 transcription regulator family member B SIN3B Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] transcription corepressor activity [GO:0003714] AARETSYQWK 0.33553 323.31 13.3044 13.4247 11.6239 13.2988 13.6079 12.7546 14.2759 11.6836 13.8669 13.1495 12.9399 13.4603 12.1986 11.5821 15.0467 12.3613 11.8967 12.4077 12.105 13.2332 11.944 12.423 12.4587 11.8553 12.4459 13.0912 13.4312 11.5347 11.9876 13.3373 13.5252 11.6205 13.6171 13.4432 13.0436 12.703 12.1151 13.2749 13.1634 12.0825 11.1787 12.5086 12.5765 12.206 10.748 11.522 12.4843 11.2193 12.919 10.3256 12.5852 11.3737 9.47976 11.0522 7.94778 12.5397 12.0632 10.2667 10.43 9.92938 10.8295 10.6305 10.3464 A0A0B8S013 A0A0B8S013_PIG Sestrin 3 SESN3 Sus scrofa domesticus (domestic pig) negative regulation of TORC1 signaling [GO:1904262]; regulation of response to reactive oxygen species [GO:1901031] cytoplasm [GO:0005737]; nucleus [GO:0005634] AITRHLT 0.92578 214.85 0 9.65777 11.2715 9.47184 9.21582 8.41282 9.03601 11.315 7.10967 8.4187 9.13034 9.62981 7.25493 12.8236 12.8046 11.8714 0 10.0507 8.28804 8.98851 0 9.68294 11.6443 10.4965 6.32948 11.647 8.03908 10.5236 10.0561 5.38436 8.41747 3.56633 7.8716 7.64962 9.11894 9.02486 10.5129 7.14649 8.61585 8.65685 0 8.61257 9.02506 9.7199 9.82501 8.83406 6.47965 9.19584 12.2853 10.4448 12.0181 9.55674 8.19421 9.93499 9.07074 7.66028 0 9.57077 7.39763 0 0 7.5744 7.56346 A0A0B8S014 A0A0B8S014_PIG SEC24 family member C SEC24C Sus scrofa domesticus (domestic pig) endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; intracellular protein transport [GO:0006886] COPII vesicle coat [GO:0030127]; cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789] zinc ion binding [GO:0008270] AAECAGK 0.93215 280.51 9.41971 9.67322 10.4749 11.6537 12.4527 7.68222 9.32125 11.2721 10.6679 12.6197 9.34516 13.1526 11.9611 8.71352 8.8519 13.0281 9.62156 12.7363 9.11114 11.1916 9.72504 18.3002 12.915 12.9635 11.3579 11.4564 10.6508 9.3445 8.49398 9.25798 7.47606 7.75047 8.45656 7.95635 11.0145 6.40346 8.23084 7.43196 8.5397 6.10503 9.23879 0 13.9153 13.8459 6.52727 10.9157 9.65258 9.74725 9.47084 8.32076 8.9741 8.35821 10.799 8.62147 0 9.43844 8.53625 8.10003 9.19044 7.26903 13.3292 10.1804 9.12208 A0A0B8S015 A0A0B8S015_PIG Protein strawberry notch-like 1 SBNO1 Sus scrofa domesticus (domestic pig) regulation of DNA-templated transcription [GO:0006355]; regulation of response to stimulus [GO:0048583] AGFLIGDGAGVGKGR 0.33333 323.31 11.3706 17.3081 10.794 12.4233 11.6165 12.7814 11.9982 12.7973 12.0454 10.9058 11.4772 12.3833 11.7133 11.6343 11.6436 17.9294 17.8824 17.7602 11.5452 10.989 11.3818 11.6476 18.0269 12.1899 10.3831 10.7747 17.7677 9.81179 7.5944 10.0156 11.1391 8.34145 11.7196 11.8652 10.8881 10.4568 18.1205 11.0456 9.739 11.8361 9.69877 11.3796 10.7361 11.9573 12.3688 10.2301 11.1831 8.39759 11.2809 12.01 11.7746 10.9 16.5421 11.8807 11.019 11.0837 10.1534 11.4267 10.4998 16.7197 9.85807 11.3319 6.26776 A0A0B8S016 A0A0B8S016_PIG RNA polymerase-associated protein RTF1-like RTF1 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] DNA binding [GO:0003677] AEALDRQR 0.33117 323.31 12.2011 10.8496 4.47839 12.7432 10.3766 12.2324 12.2237 10.8975 12.2162 10.51 11.2647 9.46706 10.7827 11.1284 12.0434 10.6274 10.2639 10.106 6.90147 9.75839 13.1239 12.0471 12.6775 11.8621 11.1272 8.10444 10.3709 10.3475 8.74571 8.82985 12.0291 11.7545 12.0577 9.3435 10.2791 9.45133 11.0406 7.24764 12.0869 9.43379 9.03922 10.0751 9.79022 9.99633 10.0856 8.57368 10.5073 7.904 10.2791 12.348 8.21252 8.73562 7.23812 10.0158 8.20594 10.3905 9.78914 8.37929 9.05189 9.28815 9.76666 6.76368 8.87043 A0A0B8S017 A0A0B8S017_PIG Large ribosomal subunit protein uL2 (60S ribosomal protein L8) RPL8 Sus scrofa domesticus (domestic pig) translation [GO:0006412] intracellular membrane-bounded organelle [GO:0043231]; large ribosomal subunit [GO:0015934]; organelle membrane [GO:0031090] RNA binding [GO:0003723]; structural constituent of ribosome [GO:0003735] AGRAYHKYK 0.96598 172.42 10.1357 10.0001 10.2125 11.149 8.9479 10.3026 11.4211 11.2406 14.2365 9.16136 6.3119 13.5452 10.8986 11.755 9.8681 10.581 7.29921 11.6254 10.4818 12.7532 9.19795 9.82876 11.2024 11.5099 10.4764 9.96019 9.72853 13.0193 12.9765 12.9329 8.92163 8.77515 8.90162 7.97951 8.06582 9.78862 9.29843 11.1473 10.1746 0 8.94568 9.12859 8.6731 9.39137 9.48567 9.48637 8.92819 11.072 8.9907 3.75232 9.58545 9.3112 9.18918 9.55802 6.45439 0 8.36357 8.914 8.68068 4.21482 7.50391 0 8.22328 A0A0B8S018 A0A0B8S018_PIG Large ribosomal subunit protein uL16 (60S ribosomal protein L10) (Ribosomal protein L10) RPL10 Sus scrofa domesticus (domestic pig) regulation of translation [GO:0006417]; translation [GO:0006412] cytoplasm [GO:0005737]; large ribosomal subunit [GO:0015934] structural constituent of ribosome [GO:0003735] CYRYCKNKPYPK 0.98084 194.35 9.43425 0 0 11.8745 6.82566 0 11.3163 11.7093 9.11769 8.32688 9.09598 8.54659 11.7004 12.1744 0 10.1737 9.63934 8.27356 0 0 9.50682 10.9559 8.34105 8.68134 8.30547 0 10.7722 9.76212 6.25378 7.21101 11.703 11.2667 10.1886 9.58802 10.9675 0 8.63894 7.95251 10.8094 0 6.28941 9.65076 9.49376 9.42997 3.53369 0 8.46761 0 6.46202 9.40039 7.22197 9.2465 8.31899 8.55539 9.60466 8.24997 8.17358 9.57845 5.27906 2.46996 8.56605 5.95266 7.77136 A0A0B8S019 A0A0B8S019_PIG "RPTOR independent companion of MTOR, complex 2" RICTOR Sus scrofa domesticus (domestic pig) TOR signaling [GO:0031929] TORC2 complex [GO:0031932] AAGLRALRYLIQDSSILQK 0.38636 323.31 10.629 12.0249 11.3526 12.2956 11.9065 12.7199 11.5354 12.1043 12.4818 11.235 12.7401 10.1571 12.4486 12.6471 11.7261 12.7187 12.8558 9.27172 10.8618 10.8107 11.1631 12.5622 10.4958 11.2342 13.7015 10.7408 13.2451 10.8663 10.7793 10.5672 13.5326 10.2996 13.2577 8.00865 14.9357 12.6304 10.5989 10.3641 10.5731 10.2943 8.62852 10.8719 8.5254 11.0754 10.9267 9.30581 12.5009 9.74616 10.9329 10.469 11.4637 11.9296 9.58257 12.2876 10.0884 10.7585 8.72629 8.7227 9.33617 9.65405 5.25584 10.9148 7.09223 A0A0B8S020 A0A0B8S020_PIG RING-type E3 ubiquitin transferase (EC 2.3.2.27) RC3H2 Sus scrofa domesticus (domestic pig) P-body [GO:0000932] metal ion binding [GO:0046872]; transferase activity [GO:0016740] ARGCQFLGPAMQEEALK 0.35664 323.31 11.7039 12.1949 10.7935 11.5965 11.9685 9.94426 10.5739 11.7413 12.3723 11.0732 12.3407 11.0268 12.0507 10.7421 10.3542 12.0316 12.0362 11.5602 10.5532 11.9829 12.102 12.2926 12.6869 11.1968 10.6761 9.51104 11.6123 10.8176 10.28 11.222 12.019 12.1058 11.1658 10.1312 10.9744 11.268 10.7001 12.5404 8.54516 11.3426 10.7472 10.1334 4.44175 9.27787 10.1773 11.9819 11.0694 11.185 11.0137 10.438 10.9403 9.36571 0 8.8687 10.0112 10.8256 9.07296 9.40037 9.66528 9.29071 8.72499 9.18274 8.53458 A0A0B8S021 A0A0B8S021_PIG RAS guanyl releasing protein 4 RASGRP4 Sus scrofa domesticus (domestic pig) small GTPase mediated signal transduction [GO:0007264] guanyl-nucleotide exchange factor activity [GO:0005085]; metal ion binding [GO:0046872] ALLELTELLSAHNNYACYR 0.93525 245.73 8.54125 9.2873 11.4181 13.6317 8.58939 13.9994 11.6919 12.8094 13.235 12.8712 8.08231 12.3809 9.53238 12.6965 10.0104 10.782 12.6232 8.44456 7.57183 10.6713 11.5801 12.9165 12.3098 11.3367 10.7506 8.51076 9.59134 8.30916 11.1628 11.3288 12.434 9.20865 10.1128 11.7862 7.9802 12.9553 11.1217 11.7573 10.5243 9.66615 9.19722 8.93112 11.5902 10.8139 10.97 10.4251 9.31714 9.53031 5.85147 8.47423 9.29428 8.77218 9.63243 10.4997 8.09439 5.73289 13.2614 8.27403 4.18832 7.08449 7.92558 8.65582 8.87857 A0A0B8S022 A0A0B8S022_PIG Double-strand-break repair protein rad21-like protein RAD21 Sus scrofa domesticus (domestic pig) chromosome segregation [GO:0007059]; sister chromatid cohesion [GO:0007062] cohesin complex [GO:0008278]; nucleus [GO:0005634] AHVFECNLESSVESIISPK 0.92079 218.33 10.8171 6.24367 0 11.1009 8.19392 8.18844 12.9242 5.31234 10.0249 7.20535 8.78526 10.9695 7.90189 0 10.4336 0 6.97533 8.8926 10.3402 10.5166 8.52912 10.3756 10.3985 10.0308 7.31841 9.7447 8.57584 8.44456 7.47143 9.50882 10.3493 11.7342 8.63405 7.68306 10.0893 8.18696 11.4211 8.60644 13.8974 0 7.96307 8.15927 7.4605 8.55808 8.71459 7.40888 8.55478 3.40722 8.75261 8.24294 9.43652 5.89588 8.35834 9.10952 7.75729 5.87106 8.26983 8.25096 9.00991 7.55903 7.94075 4.59311 0 A0A0B8S023 A0A0B8S023_PIG "RAB31, member RAS oncogene family" RAB31 Sus scrofa domesticus (domestic pig) endosome [GO:0005768]; membrane [GO:0016020] GTP binding [GO:0005525]; GTPase activity [GO:0003924] EHGPENIVMAIAGNK 0.96976 91.183 0 9.16599 9.95175 9.28797 11.1 9.47415 3.80993 7.23707 9.97154 0 0 8.46728 10.218 8.62666 0 8.47569 8.66046 10.876 9.56651 7.58834 0 8.28462 7.07168 8.908 9.66299 8.74062 11.7127 10.1983 8.79048 7.6489 10.0025 9.28533 6.60045 0 9.39838 0 8.83804 10.6342 9.7385 0 8.77683 0 0 8.22405 7.89954 7.00798 11.8069 10.64 10.3615 10.2537 0 8.98251 9.54061 8.24888 7.16882 6.76699 0 0 0 5.67158 10.6884 0 9.09724 A0A0B8S024 A0A0B8S024_PIG "Protein tyrosine phosphatase, non-receptor type 23" PTPN23 Sus scrofa domesticus (domestic pig) dephosphorylation [GO:0016311]; multivesicular body sorting pathway [GO:0071985] endosome [GO:0005768] protein tyrosine phosphatase activity [GO:0004725] AALPTPALTPEDK 0.38931 323.31 10.6691 12.4689 11.0686 12.6635 13.1327 12.1382 11.8795 13.0989 11.6492 11.8551 12.4093 12.0222 12.6852 12.9872 13.1755 11.9041 11.2015 12.7588 11.1548 11.2711 11.5306 12.6804 11.8569 12.2429 11.4276 11.1937 11.6862 11.7317 8.84856 11.8761 10.3117 11.0251 11.8307 11.8826 11.6057 11.4668 12.1304 10.6502 12.1793 8.98968 10.9565 9.94642 12.4279 11.2534 12.2762 11.2941 10.1202 10.929 12.2808 11.5197 11.2252 11.781 10.8814 11.5872 11.8521 11.3227 9.51684 11.1258 10.1802 10.4423 9.19717 11.921 10.0654 A0A0B8S025 A0A0B8S025_PIG 26S proteasome non-ATPase regulatory subunit 5 PSMD5 Sus scrofa domesticus (domestic pig) proteasome assembly [GO:0043248] proteasome complex [GO:0000502] ELTGEDVLVR 0.9703 54.008 0 9.95587 0 6.407 4.72727 9.41447 9.5562 0 0 8.82225 0 0 9.52509 8.916 10.181 0 7.61714 0 0 0 8.43292 0 9.59233 0 0 0 0 0 8.60848 0 6.33085 10.2429 11.8378 0 0 0 0 0 8.05675 0 0 0 10.2879 0 10.2739 0 8.09339 0 0 0 0 0 0 0 0 0 0 0 0 7.36466 0 0 0 A0A0B8S026 A0A0B8S026_PIG Proline-rich coiled-coil 2C PRRC2C Sus scrofa domesticus (domestic pig) AACAEKLKR 0.4359 323.31 14.6484 13.2453 14.402 13.6065 16.0744 15.2153 14.2579 12.6294 14.9063 13.5786 14.6252 14.8878 15.3975 13.9845 13.367 13.8741 13.2075 13.4755 13.3468 12.3291 13.3796 13.4624 15.0652 15.0638 14.0573 12.7547 12.9077 13.4885 11.8166 12.1499 13.9361 12.6101 12.7353 11.0792 12.051 11.9531 12.4057 12.6489 12.5359 10.4206 11.3709 12.1993 13.3788 13.348 13.0612 10.8919 12.378 12.5311 12.0934 12.3247 13.4082 13.8276 10.473 11.5126 13.3336 11.1716 12.3087 15.2788 15.0488 15.3219 11.8428 13.0851 12.1442 A0A0B8S027 A0A0B8S027_PIG cAMP-dependent protein kinase (EC 2.7.11.11) PRKACB Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] AMP-activated protein kinase activity [GO:0004679]; ATP binding [GO:0005524]; cAMP-dependent protein kinase activity [GO:0004691] AAYRELPCNQYTGTTALQK 0.92941 215.46 10.4761 0 11.9511 11.8545 10.5885 9.51408 10.5259 9.73642 9.87655 13.5187 13.3576 9.47456 10.6734 11.5242 9.48037 6.17085 10.4966 13.7984 9.11621 9.32184 5.59386 11.3362 10.4995 11.3576 9.44394 7.60318 7.89996 13.029 8.95896 9.77638 8.39133 0 12.2372 9.52397 7.1126 10.3026 10.2658 0 7.95542 10.2357 10.1285 5.37764 10.9296 9.95755 12.4697 9.02162 0 11.0289 7.24764 10.2588 12.4235 8.96789 9.04448 10.5845 8.59906 8.73965 8.53908 10.7608 10.9861 0 9.89715 9.37565 5.02552 A0A0B8S028 A0A0B8S028_PIG Protein phosphatase 1G PPM1G Sus scrofa domesticus (domestic pig) metal ion binding [GO:0046872]; protein serine/threonine phosphatase activity [GO:0004722] AIGDHFYK 0.95745 144.43 5.51444 7.82273 9.96116 0 11.1548 0 9.30419 9.74478 10.5655 0 0 9.83077 8.57784 9.51339 11.2174 8.99772 10.9883 8.33105 9.96223 0 10.958 9.41282 6.20742 9.97642 0 0 9.70598 9.14162 7.67511 8.78087 8.55884 10.7144 0 6.46659 0 0 7.5806 11.1867 9.22451 9.22518 0 9.33251 0 8.16531 9.58427 8.84046 0 8.14746 10.1255 9.5298 9.11575 7.47679 4.16712 6.14729 8.29223 7.60496 9.43459 0 8.72513 6.60772 8.43192 0 8.70867 A0A0B8S029 A0A0B8S029_PIG Patatin-like phospholipase domain containing 6 PNPLA6 Sus scrofa domesticus (domestic pig) lipid catabolic process [GO:0016042]; phosphatidylcholine metabolic process [GO:0046470] endoplasmic reticulum membrane [GO:0005789] lysophospholipase activity [GO:0004622]; phosphatidyl phospholipase B activity [GO:0102545] ADRHSDFSRLAR 0.47664 323.31 10.1987 12.0442 9.42433 11.7228 12.7648 13.4666 13.3549 10.7788 10.7555 10.2766 11.383 12.3081 12.5593 12.5406 12.615 12.0307 9.15046 13.1271 12.049 13.2421 13.1091 11.5967 12.1729 13.2109 11.4733 12.3252 7.16007 11.1875 9.37643 13.1101 11.723 9.89987 10.9863 9.49456 9.71721 12.6982 7.81622 12.4215 13.096 7.65893 7.4025 10.9091 11.1488 12.6502 12.1864 9.18827 8.355 8.89788 9.89526 9.50176 12.5474 9.08172 5.06204 11.3711 11.3818 8.50672 7.10098 5.50764 8.42995 11.0185 8.31225 10.4895 8.55244 A0A0B8S030 A0A0B8S030_PIG Phosphoinositide phospholipase C (EC 3.1.4.11) PLCL1 Sus scrofa domesticus (domestic pig) intracellular signal transduction [GO:0035556]; lipid catabolic process [GO:0016042] phosphatidylinositol phospholipase C activity [GO:0004435] AEGAAGR 0.47222 323.31 11.5528 8.77512 0 12.1929 11.5188 14.047 13.3613 13.8075 11.0082 11.7079 10.9358 9.97097 12.739 11.6577 12.2024 13.3021 12.1708 12.2489 11.7817 12.2096 13.5485 12.1017 13.0539 13.4893 10.4151 9.66555 9.61489 9.13371 10.9934 10.0347 11.8638 10.151 10.0011 10.6429 10.18 10.2335 11.9845 9.2807 4.52369 9.31254 12.3058 7.03045 10.037 10.6795 12.0007 8.73264 8.49506 7.58195 9.34769 11.3436 5.84182 10.0232 9.59861 8.9555 7.6037 8.0705 9.27314 8.8158 8.93236 9.3802 8.64969 9.97628 8.58274 A0A0B8S031 A0A0B8S031_PIG Pyruvate kinase (EC 2.7.1.40) PKM Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; kinase activity [GO:0016301]; magnesium ion binding [GO:0000287]; potassium ion binding [GO:0030955]; pyruvate kinase activity [GO:0004743] AADVHEVR 0.46789 323.31 9.93245 10.1642 10.2647 13.5858 13.0057 12.7451 11.4048 14.454 9.51436 9.96405 10.9814 10.6077 11.2551 11.7339 11.0676 12.3478 12.389 11.7975 10.3335 7.03771 6.81006 10.1214 11.2305 7.92831 11.295 11.6735 11.1849 9.2923 11.0485 9.19564 14.0388 14.2109 14.027 9.24491 10.7936 9.17353 15.3341 15.2467 15.1959 10.0246 9.6524 11.0742 13.3256 12.6113 12.8971 7.88154 8.14578 9.08186 14.4383 14.7513 14.307 0 7.56682 7.6703 14.3925 12.1606 12.1081 11.1486 11.3659 10.2435 11.456 11.1335 11.3783 A0A0B8S032 A0A0B8S032_PIG Phosphatidylinositol 3-kinase regulatory subunit alpha (Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha) PIK3R1 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310]; protein transport [GO:0015031]; signal transduction [GO:0007165] kinase activity [GO:0016301] ALYDYKK 0.46364 323.31 11.471 8.70262 11.519 9.77109 8.14822 11.8082 11.9121 11.305 11.8398 9.69249 10.2534 12.3178 10.8757 11.6502 11.7907 10.2637 9.84679 11.9651 10.2577 11.0051 8.87317 7.11863 10.5133 13.2262 11.0762 10.2281 8.63296 10.5929 11.3253 10.7732 11.2084 9.34691 10.9444 10.7437 11.3181 8.50148 9.60034 8.32071 11.311 9.26723 11.2312 9.75632 10.9944 10.5275 10.5284 11.156 8.88118 9.43045 9.80629 10.8397 8.8464 10.7174 0 9.66784 7.43638 4.08236 10.0865 10.2367 5.90407 7.95239 6.5829 6.83668 8.27118 A0A0B8S033 A0A0B8S033_PIG Pyroglutamyl-peptidase I (EC 3.4.19.3) PGPEP1 Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] cytosol [GO:0005829] pyroglutamyl-peptidase activity [GO:0016920] AIIEEMLDVLEQSEGK 0.97893 37.739 7.41819 9.53017 7.49953 9.15325 8.81858 8.08412 5.43962 9.34769 9.27949 9.68245 7.57735 9.45685 8.23869 7.66178 6.53118 9.5941 9.78334 6.21041 8.97361 10.0311 0 0 10.2833 5.79231 0 0 0 8.31393 0 0 6.43079 0 0 5.64634 10.0736 0 8.55259 9.00944 0 0 0 0 0 7.37086 9.72816 8.79302 0 8.55401 7.08683 0 0 0 0 0 0 6.07391 0 7.83693 0 0 0 0 0 A0A0B8S034 A0A0B8S034_PIG Peroxisomal biogenesis factor 11 alpha PEX11A Sus scrofa domesticus (domestic pig) peroxisome fission [GO:0016559] peroxisomal membrane [GO:0005778] ADKEKVVMK 0.9689 120.01 0 10.0063 9.21696 11.3118 9.81938 10.5111 11.3563 12.0167 10.2096 9.62671 0 9.43713 11.7913 9.62421 9.29666 7.75128 0 0 10.7781 9.86337 9.76072 10.716 12.0276 10.7936 9.9884 9.00529 9.20141 0 0 0 0 0 2.60919 10.2576 9.63319 0 0 0 10.0725 7.9441 10.6155 0 7.21568 0 0 7.83453 6.53736 0 8.52681 8.31311 8.43187 8.04155 10.341 0 5.95778 7.43829 0 0 0 7.99379 0 8.3786 8.33758 A0A0B8S035 A0A0B8S035_PIG Prenylcysteine oxidase 1 (EC 1.8.3.5) PCYOX1 Sus scrofa domesticus (domestic pig) prenylcysteine catabolic process [GO:0030328] lysosome [GO:0005764] prenylcysteine oxidase activity [GO:0001735] EQILKLFVSYDYAVK 0.95982 98.803 5.20285 9.17005 9.98513 8.69561 10.2103 9.57005 10.2537 13.3547 8.49705 10.1522 5.9858 11.3166 11.7283 10.0884 11.3018 10.2881 0 5.73273 9.7874 7.17053 11.3426 13.2691 9.72896 10.3889 13.3079 7.45664 0 6.39684 8.74214 0 7.46254 14.1003 8.77558 8.1166 0 5.96246 0 0 5.91946 0 0 9.18733 0 0 8.76861 0 9.97928 0 0 10.6738 0 0 0 7.06749 0 8.46838 0 8.27808 0 6.98242 6.52086 7.40472 6.70376 A0A0B8S036 A0A0B8S036_PIG Poly(A) polymerase (EC 2.7.7.19) PAPOLA Sus scrofa domesticus (domestic pig) mRNA processing [GO:0006397]; RNA 3'-end processing [GO:0031123] nucleus [GO:0005634] ATP binding [GO:0005524]; metal ion binding [GO:0046872]; poly(A) RNA polymerase activity [GO:1990817]; RNA binding [GO:0003723] AEWSKLFEAPNFFQKYK 0.96053 257.72 10.5564 10.7637 10.9861 10.5702 12.2502 10.8251 12.2084 12.5793 11.3794 10.3058 10.6486 9.24577 11.4933 11.1267 11.8434 8.71284 11.1787 11.6269 11.202 10.9688 12.4265 12.2476 12.2529 10.6283 7.644 10.5149 10.6231 9.70312 7.95919 10.5421 9.71404 10.4091 12.3106 11.2638 9.87067 9.73889 10.7546 10.4928 10.9501 9.84075 9.11621 8.86675 9.16347 7.97516 10.8849 9.17685 10.6893 10.1272 10.2808 0 6.3095 10.674 10.0629 9.93219 0 0 9.91159 7.17063 8.91513 0 7.38007 9.39521 10.8546 A0A0B8S038 A0A0B8S038_PIG Oxysterol-binding protein OSBPL5 Sus scrofa domesticus (domestic pig) lipid transport [GO:0006869] lipid binding [GO:0008289] AALEEDAYSR 0.45946 323.31 11.1088 12.491 11.9341 12.6184 11.054 12.2715 9.9472 11.0711 11.7332 10.4687 12.459 12.1282 9.26754 10.4223 12.6283 11.6657 12.9152 10.1546 9.3886 11.0283 11.8698 13.2342 12.9799 13.6007 11.4744 12.0203 9.85949 11.6243 10.7907 11.8411 11.4835 11.5813 12.4211 9.25937 9.53821 9.21342 13.1324 9.94344 8.89145 9.72659 9.2911 10.2483 10.4924 10.814 10.4672 8.37591 9.54471 10.1227 11.1273 11.3828 10.9594 9.53827 9.04418 10.3945 8.94005 8.34793 9.90245 8.87857 7.78031 11.239 10.7581 9.41301 9.68471 A0A0B8S039 A0A0B8S039_PIG Olfactomedin 1 OLFM1 Sus scrofa domesticus (domestic pig) extracellular region [GO:0005576]; synapse [GO:0045202] ACMQKLACGK 0.97449 190.43 9.63929 0 7.851 10.3587 9.61149 8.53493 11.448 7.86969 9.65916 7.17363 6.77123 10.5371 12.4207 9.25802 9.14489 0 8.17258 9.33923 0 11.4009 11.3723 10.6564 10.6612 10.487 7.62198 0 12.3205 0 0 9.40886 7.71019 10.1195 9.42719 10.2279 9.53654 6.79403 7.95193 0 12.1005 9.70117 7.36317 0 11.9944 10.0661 10.2315 8.33338 9.09133 9.16521 4.22443 0 9.19417 0 8.78064 10.2322 10.1707 9.19488 8.08651 9.31685 7.52623 8.91871 5.33493 8.69575 0 A0A0B8S040 A0A0B8S040_PIG Nuclear pore complex protein NUP107 Sus scrofa domesticus (domestic pig) mRNA transport [GO:0051028]; protein transport [GO:0015031] nuclear membrane [GO:0031965]; nuclear pore [GO:0005643] structural constituent of nuclear pore [GO:0017056] AATLEGWK 0.45536 323.31 11.5061 9.63892 12.083 12.8224 11.8244 14.0319 12.7956 11.2712 12.4829 10.2656 5.43469 11.9542 12.5924 11.2581 13.3994 13.077 10.7003 11.7459 10.8265 11.9098 12.144 11.7418 13.1266 12.3494 12.1065 9.98185 11.2916 9.44886 9.1063 13.0682 11.4559 12.0026 11.2779 11.9709 8.90641 10.1176 11.3128 11.681 12.4091 10.2608 9.88431 10.7372 9.90492 11.2993 10.9838 9.71692 10.9347 11.2051 11.8231 9.638 12.1331 11.2553 11.7037 9.82633 8.703 9.45356 10.3711 9.82842 9.95845 10.3462 10.5862 9.12861 10.3105 A0A0B8S041 A0A0B8S041_PIG Nuclear respiratory factor 1 NRF1 Sus scrofa domesticus (domestic pig) regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] DNA-binding transcription factor activity [GO:0003700]; protein homodimerization activity [GO:0042803]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978] AFIPEMLKYSTGRGKPGWGK 0.96601 76.621 8.33087 8.38772 0 0 0 0 6.11566 7.02989 10.8855 0 6.83264 8.47172 0 10.1514 0 5.86525 0 8.46013 8.34718 0 0 9.18755 0 0 0 0 0 7.69968 0 9.25302 0 0 10.7805 0 9.51609 7.12381 0 8.70518 0 7.0148 8.30159 0 0 10.389 0 0 6.3902 6.00448 7.72799 9.00854 0 0 0 0 7.32346 0 0 0 0 7.35658 6.57651 6.62325 0 A0A0B8S042 A0A0B8S042_PIG Nitric oxide synthase-interacting protein NOSIP Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737]; nucleus [GO:0005634] ubiquitin protein ligase activity [GO:0061630] AAAQDQVRGFLEK 0.98003 186.65 12.7043 10.6727 8.76129 10.2476 7.31442 11.2321 0 11.1629 10.447 8.27342 8.77353 7.9847 10.6889 9.93266 11.1734 8.3933 10.0128 10.8809 7.74369 9.69646 8.52239 10.5392 10.2457 8.67094 0 0 12.6417 10.1623 10.8461 0 11.3451 10.7049 11.2702 8.78231 10.9054 0 9.75974 9.95587 10.9153 0 7.78129 8.90268 0 4.45082 0 8.13242 0 0 9.181 9.81933 9.5145 8.96483 10.1096 7.3733 0 5.00464 7.42433 6.19904 6.80374 8.75004 6.91874 8.00966 9.35074 A0A0B8S043 A0A0B8S043_PIG Nipped-B protein NIPBL Sus scrofa domesticus (domestic pig) embryo development [GO:0009790]; mitotic cohesin loading [GO:0061780]; regulation of gene expression [GO:0010468] nucleus [GO:0005634] chromatin binding [GO:0003682] AAMYDIISSPSK 0.45133 323.31 12.8423 12.7632 15.1742 15.3856 14.7368 14.5591 14.5902 14.9044 13.6434 14.0861 14.6171 14.9456 14.9719 14.8361 15.5546 14.0481 14.0703 14.1593 14.034 14.6647 13.5424 15.2859 15.2408 14.6937 15.3929 13.7493 14.4298 13.9575 12.0275 13.3433 13.9565 13.9661 13.5845 12.338 13.1275 12.9849 13.5788 13.2504 14.2657 12.4402 12.7643 12.0783 13.5275 16.2471 16.0083 12.7551 13.486 12.1115 13.8127 13.103 13.1708 11.463 11.2516 12.4202 13.2305 13.5191 13.4896 11.6384 10.4443 10.6382 12.3181 10.9088 10.8116 A0A0B8S044 A0A0B8S044_PIG [heparan sulfate]-glucosamine N-sulfotransferase (EC 2.8.2.8) NDST2 Sus scrofa domesticus (domestic pig) heparan sulfate proteoglycan biosynthetic process [GO:0015012]; heparin biosynthetic process [GO:0030210] membrane [GO:0016020] [heparan sulfate]-glucosamine N-sulfotransferase activity [GO:0015016]; deacetylase activity [GO:0019213] AHGDPVALNYTFYQVISASSQAPLALRSLQNR 0.97464 316.05 0 10.4674 11.4161 11.741 10.8989 14.0326 10.6667 9.78583 11.2972 10.375 11.3608 9.94813 12.5518 10.5594 11.4195 10.9686 11.2627 8.40037 11.3747 12.0239 10.6025 11.2087 12.2944 11.3089 10.9391 7.39025 9.28031 10.4716 13.4097 7.53574 9.95884 10.9542 11.1792 0 9.65768 8.44766 7.18031 4.54405 10.8849 9.81468 8.87197 5.69686 9.01778 9.66379 9.72923 9.83868 4.65718 8.38422 6.60009 10.283 8.69704 8.44286 0 10.1481 8.79481 10.3631 8.79568 4.86042 6.15247 7.02691 9.25557 7.32337 8.29297 A0A0B8S045 A0A0B8S045_PIG N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D (EC 3.1.4.54) NAPEPLD Sus scrofa domesticus (domestic pig) phospholipid catabolic process [GO:0009395] early endosome membrane [GO:0031901]; Golgi membrane [GO:0000139]; nuclear envelope [GO:0005635] N-acetylphosphatidylethanolamine-hydrolysing phospholipase activity [GO:0102200]; N-acylphosphatidylethanolamine-specific phospholipase D activity [GO:0070290]; zinc ion binding [GO:0008270] ASPSQHMGPK 0.97314 179.09 10.274 7.94287 9.5775 11.1122 8.88567 11.2892 11.4223 0 11.7459 0 12.8832 12.503 12.5005 11.4296 10.0042 11.0158 10.6001 11.0155 12.8769 12.8265 13.471 8.28864 11.5362 12.4547 11.9037 11.7099 12.4912 10.7271 9.90355 9.69808 9.92793 11.7324 10.2141 0 9.8978 9.81275 6.12073 9.84668 10.9859 9.70864 8.54172 9.67645 0 8.90005 10.7661 0 6.63678 10.8038 9.06706 9.95188 10.9729 8.96183 9.27384 6.50678 10.2529 9.83313 3.99883 6.72765 10.055 7.75355 9.20516 9.11291 8.73813 A0A0B8S046 A0A0B8S046_PIG "Myosin VA (Heavy chain 12, myoxin)" MYO5A Sus scrofa domesticus (domestic pig) myosin complex [GO:0016459] actin binding [GO:0003779]; ATP binding [GO:0005524]; cytoskeletal motor activity [GO:0003774] AACIRIQK 0.44737 323.31 14.0458 14.0092 14.0865 15.5022 13.8176 15.5074 15.1463 13.3012 15.4085 14.7526 12.9954 14.1603 15.0097 15.3179 15.8085 13.7619 14.4289 14.2191 13.1117 13.8849 12.8337 13.7127 14.8268 14.8903 14.3013 11.7357 13.1054 12.7351 13.0062 14.3961 14.6585 14.9359 14.3578 12.3914 14.0174 13.2951 14.1504 14.1942 14.0053 11.8942 13.1821 13.3759 12.7946 15.533 13.1945 11.9283 12.511 13.6607 14.4054 12.7238 14.293 13.1932 13.2994 13.0199 13.2925 12.6241 13.081 13.2992 12.6954 12.7363 12.3593 12.959 12.2773 A0A0B8S047 A0A0B8S047_PIG "Methylmalonyl-CoA mutase, mitochondrial (EC 5.4.99.2) (Methylmalonyl-CoA isomerase)" MUT Sus scrofa domesticus (domestic pig) sulfur compound metabolic process [GO:0006790] cobalamin binding [GO:0031419]; metal ion binding [GO:0046872]; methylmalonyl-CoA mutase activity [GO:0004494] AAVQVLNDIEK 0.94175 296.32 10.5698 8.15816 5.33432 9.47565 11.6547 10.2667 10.7736 8.25526 11.0679 10.1045 10.0059 9.76421 10.2712 13.093 13.3039 8.08725 8.54206 10.8176 8.91373 8.3576 11.1092 10.4821 10.2536 3.69711 9.75667 10.7033 9.16131 9.45201 7.9397 12.7447 9.82784 0 11.9925 9.64196 6.27611 0 9.80806 16.3232 7.65019 7.53356 9.35173 9.20728 8.88823 9.82952 0 8.08055 6.03916 7.30524 9.56035 0 10.7125 9.30236 10.4162 9.20247 8.97436 0 8.59313 0 9.58483 9.95757 5.25422 6.97361 8.97318 A0A0B8S048 A0A0B8S048_PIG MOB-like protein phocein (Mob1 homolog 3) (Mps one binder kinase activator-like 3) (Preimplantation protein 3) MOB4 Sus scrofa domesticus (domestic pig) Golgi cisterna membrane [GO:0032580] ECPAIDYTR 0.96627 77.602 0 8.49129 0 8.5552 10.1344 0 9.01416 8.71249 8.91916 0 0 0 5.71554 11.3472 0 0 3.31291 8.42101 9.4502 0 9.80161 9.76659 0 0 0 9.86039 0 9.68734 0 4.48929 8.6756 9.60581 7.14995 9.9193 9.51321 6.12788 9.5204 5.00122 8.31011 0 0 0 0 0 8.83744 8.03958 0 8.13515 9.76898 8.37226 0 0 0 7.90141 0 0 0 0 0 0 0 0 0 A0A0B8S049 A0A0B8S049_PIG Malectin MLEC Sus scrofa domesticus (domestic pig) carbohydrate metabolic process [GO:0005975] endoplasmic reticulum membrane [GO:0005789] carbohydrate binding [GO:0030246] ASDYGMK 0.96374 118.51 9.34385 0 8.17328 0 8.01519 7.27109 10.0402 8.73247 6.43926 0 8.48989 7.83756 9.17355 8.12407 9.57622 8.86006 8.78683 8.1578 4.63749 0 0 9.87361 5.56004 10.7903 0 0 6.1407 9.01923 5.85102 0 5.4349 8.9426 10.5937 9.26068 0 0 7.67349 0 0 8.58864 8.96947 8.33619 0 8.26195 8.80597 0 0 6.4449 0 0 0 0 0 9.12748 4.48723 0 8.07526 7.33253 0 0 5.25633 0 6.85922 A0A0B8S050 A0A0B8S050_PIG Major facilitator superfamily domain containing 12 MFSD12 Sus scrofa domesticus (domestic pig) carbohydrate transport [GO:0008643] membrane [GO:0016020] symporter activity [GO:0015293] AAGRCAR 0.99065 30.203 0 8.83153 9.57319 0 6.87566 6.69418 9.21004 0 8.27747 0 0 0 0 12.5329 9.81965 0 7.95577 0 0 8.70646 6.52502 9.1384 12.4455 10.1477 13.161 7.24422 7.56468 9.61421 0 7.37287 13.3351 12.7093 6.75862 0 7.47427 8.96826 7.97505 0 0 8.49049 5.55265 0 0 14.1258 8.99862 9.90123 8.56986 0 12.9205 0 8.71466 7.10003 7.0433 0 7.12856 7.23487 0 7.30204 0 0 0 0 0 A0A0B8S051 A0A0B8S051_PIG methylcrotonoyl-CoA carboxylase (EC 6.4.1.4) (3-methylcrotonyl-CoA carboxylase 2) (3-methylcrotonyl-CoA carboxylase non-biotin-containing subunit) (3-methylcrotonyl-CoA:carbon dioxide ligase subunit beta) MCCC2 Sus scrofa domesticus (domestic pig) leucine catabolic process [GO:0006552] ligase activity [GO:0016874] AATGEEVSAEDLGGADLHCR 0.97059 171.49 12.602 12.1551 7.98288 11.6292 11.0323 10.8395 12.0971 10.628 11.4734 6.26414 10.4638 9.60188 12.6418 11.0788 13.4936 10.517 13.2258 7.81397 8.09766 12.8678 12.6284 12.7049 12.9779 0 11.4097 9.1453 12.8354 9.18316 12.302 12.5951 9.41557 12.9085 12.9606 12.2834 9.6744 12.4578 10.1316 13.2322 8.84354 10.6199 9.2494 9.53858 11.9168 12.6294 11.8489 12.2847 12.318 12.3734 7.15714 0 8.56784 11.6824 11.8137 11.694 7.59544 9.90824 9.91136 8.649 11.1577 11.3146 8.30451 6.38828 0 A0A0B8S052 A0A0B8S052_PIG Mitogen-activated protein kinase 6 (EC 2.7.11.24) MAPK6 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; MAP kinase activity [GO:0004707] AIDMWAAGCIFAEMLTGK 0.93951 208.93 10.254 10.5015 10.8664 11.887 10.8182 9.60735 7.29343 9.94115 8.70245 10.0144 9.08884 11.6183 10.5166 10.5215 11.1596 9.68531 10.4378 10.957 5.42143 8.27314 8.30611 10.4247 13.3063 11.1217 10.3844 11.5109 9.32105 0 9.87975 3.51084 8.5218 11.7334 11.121 8.99582 9.95752 9.91465 8.50239 10.945 9.49097 7.90008 9.38291 9.89066 6.98162 6.97166 8.85599 8.74588 6.9507 8.52603 0 9.48125 11.8604 8.32782 8.13386 7.73023 9.99095 8.60485 7.62841 5.65389 8.71239 8.22453 8.15522 7.76335 8.36759 A0A0B8S053 A0A0B8S053_PIG Mitogen-activated protein kinase kinase kinase 3 MAP3K3 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674] ADVWSLGCTVVEMLTEKPPWAEYEAMAAIFK 0.44348 323.31 10.7683 11.3294 12.9342 13.7495 11.6886 13.8903 11.3806 13.2844 10.8658 8.81452 10.6887 11.4188 10.3716 11.2996 10.5535 11.1899 13.714 12.3972 12.5742 9.97484 9.84042 13.0734 12.2739 8.94134 8.4957 12.5988 11.4197 9.20482 7.70577 9.97814 10.7586 10.1589 12.4255 10.0669 8.86524 7.05669 9.7656 10.1768 11.9816 9.31111 9.91022 9.64796 10.9629 10.4001 10.9145 8.80103 8.1335 8.85434 12.3087 9.96368 9.31902 8.31442 8.90911 10.7148 7.55505 10.0914 7.69251 12.2886 8.17822 7.5313 0 9.15061 7.11134 A0A0B8S054 A0A0B8S054_PIG Alpha-mannosidase (EC 3.2.1.-) MAN2A1 Sus scrofa domesticus (domestic pig) mannose metabolic process [GO:0006013] membrane [GO:0016020] alpha-mannosidase activity [GO:0004559]; carbohydrate binding [GO:0030246]; metal ion binding [GO:0046872] AAEVLYYFALK 0.43966 323.31 12.0104 11.8661 11.1627 13.0412 11.1096 13.1766 11.6636 13.17 9.95936 9.79481 9.88361 10.0737 14.2824 11.6268 11.9456 13.0826 14.1189 10.063 10.0682 8.94635 10.0044 12.7144 11.0422 11.7234 12.4017 10.0349 11.3003 4.22674 10.1077 9.42461 9.915 11.0151 10.8711 10.8156 10.2013 9.25427 11.2316 0 11.4336 8.93634 10.8721 10.4361 7.80941 9.93453 10.2954 10.3938 11.3467 11.8475 10.5689 11.5632 11.7209 9.87994 7.49418 9.58359 8.00916 10.0003 9.90043 7.07478 8.43621 6.86592 8.85888 9.84956 0 A0A0B8S055 A0A0B8S055_PIG Lymphocyte-specific protein 1 LSP1 Sus scrofa domesticus (domestic pig) signal transduction [GO:0007165] actin binding [GO:0003779] DIVAGDMSK 0.95768 101.98 9.50811 0 0 5.94876 5.05888 10.2862 0 13.9221 0 10.7819 8.53846 9.09413 11.5564 5.67288 0 0 0 0 0 12.4625 9.49177 10.8957 8.08773 0 0 0 0 0 7.91379 0 7.55788 10.2313 0 0 7.5397 0 0 0 0 3.71853 0 0 10.2416 9.63637 0 6.71163 4.02609 7.66178 0 7.87135 0 10.708 0 0 6.08213 0 0 8.13545 0 0 9.37313 6.4935 0 A0A0B8S056 A0A0B8S056_PIG Leucine rich repeat containing 16A LRRC16A Sus scrofa domesticus (domestic pig) AAEHNGSAER 0.4322 323.31 12.4314 12.8475 13.0152 13.1487 14.1779 13.4929 14.8676 14.0792 14.0291 13.9036 13.4719 13.6491 13.957 13.7787 13.4789 13.7305 13.6019 13.3472 12.2193 12.8123 12.967 12.7174 13.0716 13.3253 13.1432 12.7975 13.1756 13.105 10.0437 13.8311 12.2954 13.1905 13.0421 12.7746 11.6556 11.8234 13.4413 12.5257 12.6625 13.8084 13.0392 13.1811 12.7387 12.9806 11.5303 11.9682 13.8203 13.3795 12.3574 13.4733 13.5146 12.7018 12.6279 12.9508 11.7662 12.8504 13.1411 12.3886 12.228 12.2304 10.1058 10.8169 12.1772 A0A0B8S057 A0A0B8S057_PIG phosphatidate phosphatase (EC 3.1.3.4) LPIN2 Sus scrofa domesticus (domestic pig) phosphatidate phosphatase activity [GO:0008195] AIGMADMTR 0.95941 320.63 9.9678 12.8924 12.6906 10.9098 11.2949 11.6509 13.5049 10.5521 10.8464 9.69884 10.3207 10.6048 11.0852 13.3716 10.1994 10.7796 10.2133 10.7258 10.2247 10.3676 12.1932 11.8916 11.8401 11.5147 5.24812 10.0369 0 12.7287 12.0444 11.7694 11.1709 9.99817 11.9914 11.6131 11.6841 0 12.0774 12.3498 12.028 11.138 11.4997 11.7088 10.9388 0 8.86876 10.7759 11.091 8.73829 11.1011 11.0118 0 8.91004 10.0786 10.411 8.6627 10.0764 8.17448 9.84594 5.80844 0 8.8212 9.44692 7.24963 A0A0B8S058 A0A0B8S058_PIG LIM domain kinase 2 (EC 2.7.11.1) LIMK2 Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] cytoplasm [GO:0005737]; spindle [GO:0005819] ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674] CDEETQK 0.93689 247.31 9.48309 10.7941 10.8176 11.2282 8.38935 12.232 6.74147 6.75302 11.5865 10.674 11.0201 12.1607 11.0121 13.0157 10.9692 12.6505 11.6423 12.2397 9.88252 11.6372 8.1534 11.3676 9.67615 10.1556 9.31436 9.60814 8.57732 8.91877 11.496 10.7699 11.6572 11.1045 10.1072 3.42573 11.4138 0 7.11873 8.91031 10.0558 7.92101 10.1908 7.31741 11.3101 0 6.62047 10.0455 10.3455 8.30975 9.55932 0 9.79936 12.0533 9.29559 7.72083 10.5745 11.2323 9.11366 11.9713 9.7945 9.92401 11.2514 11.3438 10.5014 A0A0B8S059 A0A0B8S059_PIG Lysosomal protein transmembrane 5 LAPTM5 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] ASCKFSKSGYLR 0.97322 85.046 9.36067 8.38987 5.4647 0 10.4625 10.6056 9.9884 10.1601 10.1538 10.0532 9.76848 0 0 0 10.2497 9.51672 10.125 0 8.90854 10.3374 0 10.9162 0 10.9882 4.93673 0 9.20379 10.0344 0 9.13165 5.897 6.71781 7.19436 2.32881 0 0 0 8.68317 0 0 8.34744 8.00411 9.46932 0 6.72846 8.22935 0 3.16708 0 7.83668 4.53661 7.00371 0 7.99367 8.60552 4.91638 0 3.98386 8.8296 8.51503 0 6.1163 7.12825 A0A0B8S060 A0A0B8S060_PIG Kelch-like family member 24 KLHL24 Sus scrofa domesticus (domestic pig) AAIPIAKR 0.92784 222.73 13.3691 10.2147 13.8178 11.994 15.245 9.82807 7.01369 14.9598 15.1343 10.8345 14.4838 14.4666 11.6131 9.65159 10.1977 9.64972 14.8211 10.0101 13.2952 9.05017 13.1236 14.7446 11.2238 14.2563 12.9346 9.0959 9.69881 9.09239 8.67585 10.2032 10.7124 13.4363 10.2773 8.13689 11.4623 10.2384 9.22275 12.8009 10.2854 12.1816 10.3447 9.36685 10.0214 11.2327 8.25866 0 0 5.46653 0 13.7523 13.3706 12.3773 0 9.15537 8.37482 12.6578 0 7.96711 8.92172 7.84241 11.2492 8.93071 0 A0A0B8S061 A0A0B8S061_PIG KIF-binding protein (KIF1-binding protein) KIAA1279 Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737]; cytoskeleton [GO:0005856] AAHYCHSTLK 0.9386 278.29 0 6.94322 6.90677 9.095 12.3922 9.71925 11.3297 11.7247 10.0041 9.9628 10.6003 9.66617 11.1908 10.4009 10.1288 13.0967 10.7505 9.61993 11.1292 9.89036 10.5231 13.2346 12.0472 8.87129 10.2077 9.18056 8.46638 12.7166 9.46428 6.13064 10.8338 10.7253 11.3114 9.86302 8.52388 9.52691 12.3448 9.83376 11.1163 10.8289 7.02768 10.2172 11.0068 9.6386 8.2385 8.37317 9.43577 11.2989 6.97396 7.78359 9.96766 0 8.76643 11.3188 10.3696 9.10818 9.00017 10.2347 7.81865 10.943 8.98982 8.03832 9.40459 A0A0B8S062 A0A0B8S062_PIG Uncharacterized protein KIAA0226-like KIAA0226L Sus scrofa domesticus (domestic pig) ACFHKQCFQSSQCPR 0.93807 238.91 8.71294 5.89903 7.35112 5.96121 9.10654 8.29985 6.7498 10.6136 6.35403 9.3038 8.86366 8.70722 11.2961 0 7.63503 8.62648 11.8353 11.1734 11.276 8.21558 9.09054 7.16078 13.2429 10.5464 6.66619 10.0756 7.98658 8.33503 8.1984 9.82718 7.60681 9.18923 9.91524 7.27975 9.66008 7.39369 8.69028 6.30712 10.0607 6.43679 10.3743 3.98112 5.46136 0 8.78336 7.91277 7.06275 0 6.80877 9.92315 10.1398 7.68881 6.9855 7.94498 10.272 9.39701 4.71166 8.37265 0 6.96832 8.58598 8.51846 7.80407 A0A0B8S063 A0A0B8S063_PIG [histone H3]-trimethyl-L-lysine(9) demethylase (EC 1.14.11.66) KDM4A Sus scrofa domesticus (domestic pig) methylation [GO:0032259] nucleus [GO:0005634] histone H3K9me2/H3K9me3 demethylase activity [GO:0140684]; metal ion binding [GO:0046872]; methyltransferase activity [GO:0008168] AAGCCVQCSHGR 0.39535 323.31 10.9024 11.6195 10.9635 13.288 12.1632 11.4979 12.902 12.1539 12.4806 11.5364 12.705 11.8372 12.1668 12.1544 13.008 11.6304 11.2747 11.8753 13.6091 12.9351 11.1643 12.0416 11.3144 12.0144 10.321 11.1174 12.0232 10.5668 10.6176 9.52028 12.7217 10.7606 10.2789 10.48 9.35828 9.99365 11.9222 13.1199 11.0641 11.1951 9.92918 10.7598 11.5888 10.4699 10.7591 8.95806 10.0436 9.24786 11.4022 13.5343 12.169 10.9171 10.273 10.1402 12.5434 10.2736 7.73789 10.4557 9.6069 9.95582 9.16473 9.38588 8.79789 A0A0B8S064 A0A0B8S064_PIG KAT8 regulatory NSL complex subunit 3 KANSL3 Sus scrofa domesticus (domestic pig) AHRGGER 0.92918 229.32 12.1712 10.4794 12.4291 13.8084 12.3898 11.8998 12.5947 12.5803 12.2193 13.3382 12.7978 9.61587 12.4292 12.0937 12.6393 11.3508 10.2458 10.5762 9.54678 12.3079 12.3806 11.0703 18.1512 12.8852 8.96015 11.6141 10.0633 10.0603 14.93 9.66993 7.24165 7.77801 8.17203 10.4513 9.83493 0 10.9037 11.1685 9.39688 13.9179 10.0955 0 6.83845 9.49849 11.5731 7.14558 10.3471 8.68349 11.9331 9.71896 8.61051 10.1232 11.714 14.1766 6.76288 9.71831 5.41342 5.50726 7.68979 9.80399 8.98826 9.01764 0 A0A0B8S065 A0A0B8S065_PIG "Integrin, alpha V" ITGAV Sus scrofa domesticus (domestic pig) cell adhesion [GO:0007155]; integrin-mediated signaling pathway [GO:0007229] integrin complex [GO:0008305] ADGKGTLPTK 0.42857 323.31 10.3759 12.9666 10.2036 10.8935 10.0097 5.05823 10.7438 13.2064 10.7532 8.12402 10.6274 12.5148 11.069 11.2099 11.404 10.3714 7.58849 0 9.68268 6.31602 8.28499 12.4386 10.0668 9.75171 10.5515 9.74106 10.9784 9.93937 10.4646 10.5931 9.97212 10.9675 10.8387 10.7678 8.95652 9.05989 10.2732 10.1585 8.13889 8.94096 9.52168 8.3709 10.9706 9.66422 10.2911 7.67391 11.0599 10.0048 11.1144 9.88169 10.4831 9.20029 9.01371 9.00708 8.73677 6.41434 10.2723 7.10014 10.0158 7.98857 8.89045 7.5611 8.02076 A0A0B8S066 A0A0B8S066_PIG Interferon regulatory factor 9 IRF9 Sus scrofa domesticus (domestic pig) positive regulation of DNA-templated transcription [GO:0045893]; regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] DNA-binding transcription factor activity [GO:0003700]; transcription cis-regulatory region binding [GO:0000976] ASGRARCTR 0.95677 106.43 9.98883 0 9.44574 11.2294 10.9917 13.75 13.5151 13.5644 13.7224 13.1353 13.2812 13.0674 13.29 13.8885 13.6558 13.8557 13.7626 13.262 13.1161 0 12.9684 14.4602 13.6413 13.1453 12.8167 12.4485 12.1494 11.0283 11.2566 11.1535 12.8436 12.6195 0 10.8935 0 8.12495 11.3789 11.8003 12.8278 9.21245 10.6449 11.0345 11.7291 10.9371 11.257 11.925 11.7439 9.0421 12.398 12.327 7.76354 11.9717 11.8567 12.0798 8.37643 5.68838 10.8176 7.52042 0 10.828 0 0 9.03279 A0A0B8S067 A0A0B8S067_PIG Insulin-induced gene protein INSIG2 Sus scrofa domesticus (domestic pig) cholesterol metabolic process [GO:0008203] endoplasmic reticulum membrane [GO:0005789] AEGETKSPGPK 0.96174 45.614 13.0183 0 0 12.4981 0 0 9.52239 0 6.36538 0 13.2436 12.2393 0 0 0 13.1863 0 0 11.0096 0 0 0 11.7029 11.6786 10.0028 8.39921 12.1755 0 10.7736 2.5675 11.7204 0 7.86524 0 10.789 10.3948 0 0 0 11.9015 0 0 0 0 12.5096 11.4754 0 7.62607 12.0662 12.0813 13.2014 12.8076 13.04 5.97062 11.479 0 12.4646 11.3873 12.468 12.1868 0 0 0 A0A0B8S068 A0A0B8S068_PIG Interleukin-18 (IL-18) IL18 Sus scrofa domesticus (domestic pig) immune response [GO:0006955]; inflammatory response [GO:0006954]; positive regulation of macromolecule biosynthetic process [GO:0010557]; regulation of gene expression [GO:0010468] extracellular space [GO:0005615] cytokine activity [GO:0005125] DECGDKSIMFTVQNK 0.95574 109.05 8.6401 6.509 10.2304 12.4011 9.43156 9.46923 6.70252 0 0 12.256 0 9.48698 0 9.76544 9.04412 10.7885 5.30338 7.57122 6.49467 9.90326 10.1182 8.4412 8.86898 9.39103 7.66192 10.6156 0 10.3852 8.16882 7.99774 11.2137 10.7484 11.7714 5.92941 7.94222 5.67889 5.26559 10.0768 8.83488 5.94902 0 6.02066 10.8349 11.2057 10.9813 0 9.81344 12.2336 0 9.31098 7.50359 10.0767 8.52337 9.66646 6.50863 11.9131 9.46679 5.87779 8.41578 0 0 0 10.7945 A0A0B8S069 A0A0B8S069_PIG Interferon alpha/beta receptor 1 (IFN-R-1) (IFN-alpha/beta receptor 1) (Type I interferon receptor 1) IFNAR1 Sus scrofa domesticus (domestic pig) cellular response to interferon-alpha [GO:0035457]; response to lipopolysaccharide [GO:0032496] late endosome [GO:0005770]; lysosome [GO:0005764]; plasma membrane [GO:0005886] type I interferon binding [GO:0019962]; type I interferon receptor activity [GO:0004905] AIIINLSPPGTK 0.95886 200.23 10.5653 10.7916 8.43292 12.2942 12.6799 11.8832 10.8342 9.00591 6.90617 10.8748 10.092 10.9951 5.41441 9.93781 9.5244 11.4622 10.5189 9.61484 10.5994 12.5603 8.94869 10.427 9.90515 12.4177 10.4538 10.1374 9.81362 10.6365 9.60544 9.15132 10.4115 10.3403 8.70473 10.3072 9.19876 11.4178 9.8888 9.67657 8.59193 7.63241 5.74025 5.07133 8.14537 8.7412 4.63767 8.90566 8.54442 10.2135 9.95321 8.54206 9.50686 8.33033 8.47318 9.32312 8.93723 7.5562 10.0443 8.50926 9.0978 9.25878 9.30752 8.79074 8.21257 A0A0B8S070 A0A0B8S070_PIG Heat shock 70kDa protein 6 (HSP70B') HSPA6 Sus scrofa domesticus (domestic pig) ATP binding [GO:0005524]; ATP-dependent protein folding chaperone [GO:0140662] AFYPEEISSMVLSK 0.425 323.31 13.8331 14.0194 13.9837 14.7193 14.7907 14.9952 15.0274 15.1581 14.8241 13.8573 14.6128 14.6417 15.3025 15.0663 14.8955 15.0148 14.4449 14.1538 14.8301 14.386 14.4457 14.8275 14.6703 14.2589 14.3159 14.1788 14.372 14.3909 14.8663 14.4834 14.5732 14.5101 15.1567 14.7879 14.8582 14.7338 14.5305 15.0707 15.0694 13.5956 13.6153 13.2945 13.1125 13.2025 13.2453 13.4665 14.351 14.0787 13.9496 14.1112 13.9628 13.26 12.8817 13.3788 12.4393 12.5848 12.5062 12.872 12.8597 12.8577 11.559 11.4925 11.617 A0A0B8S071 A0A0B8S071_PIG Transcription factor HIVEP2 HIVEP2 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] metal ion binding [GO:0046872] AGLVPFTESAVSK 0.42149 323.31 12.2356 12.6612 13.0616 14.4471 14.7398 13.614 13.6601 13.1132 12.2886 12.7448 12.5409 12.453 14.5636 14.0741 13.1081 13.372 11.6255 12.9015 12.1411 11.668 11.9512 13.9403 12.9824 13.5716 13.8604 11.5969 13.721 10.6545 9.56255 10.6977 12.9674 12.3234 11.2576 11.0937 11.6606 12.1539 12.55 10.0338 11.8822 10.7178 10.3875 9.57096 14.3801 11.9713 10.2921 11.2166 11.5317 9.84602 11.8694 12.1844 9.89207 9.99379 11.9708 11.5954 12.3981 10.2899 10.3391 11.8909 11.28 11.1609 8.81877 10.6203 10.9648 A0A0B8S072 A0A0B8S072_PIG "3-hydroxyisobutyrate dehydrogenase, mitochondrial (EC 1.1.1.31)" HIBADH Sus scrofa domesticus (domestic pig) valine catabolic process [GO:0006574] 3-hydroxyisobutyrate dehydrogenase activity [GO:0008442]; NAD binding [GO:0051287]; NADP binding [GO:0050661] DFSSVFQFLR 0.96948 86.582 8.5678 7.46964 0 12.8656 5.00733 0 8.99489 0 12.3251 2.94565 0 8.85801 8.46234 8.64555 9.15436 10.2729 6.46118 6.23642 7.09793 9.98428 8.75989 11.904 0 5.34152 10.26 9.65093 0 9.18088 0 0 11.1842 0 5.34295 0 0 5.12176 0 7.71335 7.17313 10.2066 8.12892 5.80769 5.37782 0 5.44593 0 0 0 0 7.85062 10.508 6.71273 8.56613 0 0 7.40088 0 8.91907 6.87983 7.97137 11.297 6.88105 0 A0A0B8S073 A0A0B8S073_PIG High density lipoprotein binding protein HDLBP Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737] RNA binding [GO:0003723] AACLENPQEPAGAWSNKIRPIKASVITQVFHVPLEER 0.41803 323.31 11.3898 13.6136 13.4118 14.9186 12.3546 13.9006 14.691 13.6542 13.6275 15.0577 13.8662 13.7954 12.7944 11.6538 12.5994 10.495 12.8939 8.98342 11.9143 11.4612 12.4392 10.5397 11.3659 13.5806 11.0213 11.0081 13.3844 15.3721 11.4184 14.2824 15.5312 11.4769 15.5701 11.2248 12.3097 11.1675 13.8267 10.8836 13.8234 11.7887 10.6094 10.2174 10.4698 11.9105 11.2685 12.453 13.4264 10.3884 13.8234 14.3057 12.122 9.64767 10.7957 13.112 13.6541 13.3049 13.2325 12.9729 11.7049 9.65358 10.1918 12.5366 12.5862 A0A0B8S074 A0A0B8S074_PIG HMG box-containing protein 1 (HMG box transcription factor 1) (High mobility group box transcription factor 1) HBP1 Sus scrofa domesticus (domestic pig) regulation of DNA-templated transcription [GO:0006355] nucleus [GO:0005634] DNA binding [GO:0003677]; RNA binding [GO:0003723] AISVILGDR 0.95893 200.11 10.432 0 0 10.3993 13.2029 11.3804 11.0922 10.4684 11.2505 12.6065 9.1768 10.3938 12.3022 12.9729 12.4351 11.3631 10.102 6.95722 11.1778 10.3657 9.73605 11.2168 11.23 13.2061 10.2677 0 10.2741 0 10.721 8.70753 9.97542 11.7563 11.8828 10.5606 9.93171 10.7196 11.3061 10.946 12.03 11.4157 0 10.322 10.417 11.1211 10.8162 5.92657 10.5942 7.97991 7.66007 9.34727 10.2232 0 8.77985 12.0941 9.44014 8.3203 0 0 10.2388 0 6.99752 8.01469 8.91973 A0A0B8S075 A0A0B8S075_PIG General transcription factor 3C polypeptide 2 GTF3C2 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] ADLLLLK 0.92678 224.82 12.0414 10.6321 9.71361 13.7285 8.00225 9.90409 10.2761 6.40458 10.6173 11.2367 10.4595 9.59488 10.9405 9.62525 8.78336 10.1127 10.7238 11.4443 7.75876 11.2958 13.9065 9.99152 10.0783 11.3185 0 0 9.50817 0 9.1374 0 9.47585 0 7.34172 9.59019 0 9.0082 9.86573 6.97189 10.0467 7.82591 7.06996 8.60929 10.0768 9.29719 9.94882 8.15102 8.55597 0 0 8.08826 9.71505 10.9669 0 6.96993 0 8.33101 8.01814 5.16217 11.1664 7.5089 9.50504 6.06065 6.46468 A0A0B8S076 A0A0B8S076_PIG Glycogen synthase kinase-3 beta (EC 2.7.11.26) GSK3B Sus scrofa domesticus (domestic pig) glycogen metabolic process [GO:0005977]; negative regulation of developmental process [GO:0051093]; negative regulation of signal transduction [GO:0009968]; phosphorylation [GO:0016310]; regulation of cellular component organization [GO:0051128] cytoplasm [GO:0005737]; nucleus [GO:0005634]; plasma membrane [GO:0005886] ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]; tau-protein kinase activity [GO:0050321] DEVYLNLVLDYVPETVYR 0.96441 140.14 11.768 11.5528 11.7864 10.5516 10.846 10.9314 11.0583 10.5641 15.228 8.50728 10.8279 10.8224 13.9885 11.0644 14.7712 9.82739 10.5527 15.2325 10.1156 14.1496 8.89936 10.665 15.189 12.2599 9.92738 8.30003 10.0475 0 11.5578 7.36667 8.41494 0 14.1793 9.35169 0 9.53792 9.12469 5.6673 9.79513 0 10.069 9.22323 9.78079 10.4073 10.4531 9.05853 8.54655 0 10.4266 9.32504 8.61162 10.4401 8.71466 9.14665 3.30886 10.6212 0 0 0 0 0 0 9.33952 A0A0B8S077 A0A0B8S077_PIG Glycoprotein (Transmembrane) nmb GPNMB Sus scrofa domesticus (domestic pig) membrane [GO:0016020] AIESNTGIVVK 0.95906 106.85 0 0 9.80819 11.0879 0 8.51436 8.87384 0 0 0 0 0 9.17852 10.9824 8.77264 9.981 10.231 10.4755 0 0 0 0 0 7.30478 11.0848 7.34935 0 8.75912 0 0 0 10.5145 0 0 9.66876 7.37947 9.41983 5.17013 10.2178 0 0 0 10.7539 10.123 11.4322 7.28799 0 0 10.9121 0 6.6327 0 5.04557 0 4.57046 0 6.68089 9.6566 9.50591 5.75224 0 4.54325 8.81944 A0A0B8S078 A0A0B8S078_PIG Golgin A2 GOLGA2 Sus scrofa domesticus (domestic pig) cis-Golgi network [GO:0005801] AAECWGEQAEER 0.41463 323.31 14.0202 13.9738 10.9861 14.2067 14.1966 13.7412 15.116 15.0253 15.1809 14.2547 14.04 14.5198 14.876 14.3648 15.0876 14.7013 14.2245 14.2177 14.5336 14.5302 14.5038 14.2533 14.6477 14.7234 13.9999 13.5599 13.9399 15.6178 15.0415 15.0748 15.2866 14.9758 14.9428 14.9885 14.783 14.7738 14.6498 14.2208 15.2969 11.4038 13.6928 10.4372 9.47446 12.6732 12.7124 14.5245 14.1795 14.4942 13.5349 14.0658 13.2655 13.5498 13.7471 13.5671 11.6976 11.6314 11.6226 10.0625 11.3012 8.94163 9.61198 10.3955 10.3552 A0A0B8S079 A0A0B8S079_PIG Guanine nucleotide-binding protein G(q) subunit alpha (Guanine nucleotide-binding protein alpha-q) GNAQ Sus scrofa domesticus (domestic pig) "entrainment of circadian clock [GO:0009649]; G protein-coupled acetylcholine receptor signaling pathway [GO:0007213]; phototransduction, visible light [GO:0007603]" Golgi apparatus [GO:0005794]; membrane [GO:0016020]; nuclear membrane [GO:0031965]; photoreceptor outer segment [GO:0001750]; plasma membrane [GO:0005886]; synapse [GO:0045202] G protein-coupled receptor binding [GO:0001664]; G-protein beta/gamma-subunit complex binding [GO:0031683]; GTP binding [GO:0005525]; GTPase activity [GO:0003924] AMDTLKIPYK 0.94129 208.94 9.93341 10.4001 9.20156 7.9798 11.7374 11.6151 11.1605 10.0367 10.3627 11.0974 12.0673 0 11.0755 11.3512 9.76931 9.83384 11.5476 8.96636 8.92748 11.0451 9.00574 10.7903 10.8779 11.472 7.6962 11.2075 9.31415 9.75367 8.89524 10.0767 10.2544 10.8792 12.1287 11.4083 10.5727 11.5138 9.60829 9.42282 10.7842 8.05512 10.0782 8.52916 10.8258 9.23824 11.0216 10.6042 9.40284 10.6388 0 10.4317 9.63943 9.95163 10.9243 9.0797 5.01743 0 10.0278 9.29027 8.77416 9.74276 8.70428 0 9.60607 A0A0B8S080 A0A0B8S080_PIG Beta-galactosidase (EC 3.2.1.23) GLB1 Sus scrofa domesticus (domestic pig) carbohydrate metabolic process [GO:0005975] beta-galactosidase activity [GO:0004565] DGQPFRYISGSIHYFR 0.97099 163.83 0 9.36704 9.73885 11.4982 9.70981 10.0301 8.73877 8.64742 3.1694 0 8.19397 5.19054 8.41278 0 8.38392 8.19244 7.63321 12.346 6.85873 0 9.52005 0 8.74369 8.92929 8.93334 0 10.0657 0 3.98057 8.9824 9.1363 7.63844 6.32315 8.49653 8.28753 0 12.345 10.0182 0 8.06517 10.7957 7.91558 5.9348 0 0 8.91133 0 5.37993 0 13.2805 8.18239 10.3005 9.94109 0 10.0268 9.40037 4.38274 0 9.44361 8.44323 0 0 8.97765 A0A0B8S081 A0A0B8S081_PIG Guanylate binding protein 7 GBP7 Sus scrofa domesticus (domestic pig) innate immune response [GO:0045087] GTP binding [GO:0005525]; GTPase activity [GO:0003924] AADLYSDRMAR 0.94534 294.37 11.5227 7.04625 12.682 12.1851 14.2647 10.8236 11.7159 9.85003 11.134 8.02153 10.2409 10.833 11.41 11.4825 13.9987 12.1733 14.1528 7.08799 13.2845 9.04661 8.07553 11.0686 12.1907 11.6795 11.2361 13.2766 9.68011 8.74255 9.32562 9.07162 13.039 12.2976 12.2787 11.4632 11.0293 8.61548 12.1598 13.5252 12.4796 11.3071 11.8457 10.2245 10.1929 0 9.25179 10.874 9.90331 12.4753 10.9623 10.4307 12.6375 8.32175 10.3005 8.64764 0 7.66669 8.65585 8.62611 7.16118 0 10.0692 10.9048 10.6432 A0A0B8S082 A0A0B8S082_PIG Fucosyltransferase (EC 2.4.1.-) FUT11 Sus scrofa domesticus (domestic pig) protein glycosylation [GO:0006486] Golgi cisterna membrane [GO:0032580] fucosyltransferase activity [GO:0008417] CLQNRELPIPR 0.9697 77.785 10.9284 9.33412 10.065 13.7555 11.4245 11.3712 11.2073 10.0611 13.4215 10.2688 11.0044 10.6213 0 10.9304 13.7184 10.4291 10.319 10.2732 0 10.2557 10.1567 11.3195 11.0631 10.896 9.733 9.49965 8.83086 8.98647 0 0 10.9915 10.1959 10.896 5.33582 9.7613 8.99339 0 9.35354 11.5259 8.41815 9.06377 8.63731 8.71394 10.6359 8.72359 9.39723 9.15507 8.04226 12.0552 10.4619 10.5519 10.7139 9.04382 9.77255 7.70515 0 0 0 0 0 9.47263 6.88826 8.43538 A0A0B8S083 A0A0B8S083_PIG Formin-like 3 FMNL3 Sus scrofa domesticus (domestic pig) actin cytoskeleton organization [GO:0030036]; regulation of cell morphogenesis [GO:0022604] actin binding [GO:0003779]; small GTPase binding [GO:0031267] AAAVSLENVLLDVK 0.41129 323.31 10.0153 10.9678 9.86011 13.2008 13.5259 12.227 14.9266 11.1991 13.0492 11.0741 10.448 9.53572 12.2349 11.9545 12.7172 11.3267 10.6008 13.1117 10.7196 12.3648 12.4128 11.6305 12.7643 12.8945 11.8289 10.7 12.3611 8.5783 11.4635 10.0399 9.80492 11.9579 9.8925 10.9714 11.7777 11.0287 11.1462 11.4453 8.85823 10.7112 10.6775 9.97183 9.75154 11.3975 11.3629 9.9447 10.3758 9.56809 11.8836 11.4952 10.5869 9.52288 11.2095 9.95939 11.4158 10.4718 10.4919 10.0814 10.5964 9.97985 10.6177 9.45117 9.7872 A0A0B8S085 A0A0B8S085_PIG Fatty acyl-CoA reductase (EC 1.2.1.84) FAR1 Sus scrofa domesticus (domestic pig) fatty acid derivative metabolic process [GO:1901568] peroxisomal membrane [GO:0005778] alcohol-forming long-chain fatty acyl-CoA reductase activity [GO:0102965]; alcohol-forming very long-chain fatty acyl-CoA reductase activity [GO:0080019] AGQTPKER 0.92647 225.94 13.8333 14.3584 13.8171 14.5392 14.9426 14.9242 15.2477 14.4655 15.3882 14.435 14.3113 14.5757 14.5092 14.3686 12.6335 14.2095 14.0449 14.279 13.3526 14.0961 13.3959 14.5327 14.6629 14.7845 12.7366 13.2467 12.8852 13.8402 14.2102 14.0135 15.1587 15.0746 15.1646 13.9951 13.9006 14.1128 14.2239 14.4127 14.0963 13.5744 13.6691 13.5919 13.0573 12.9042 12.9781 13.4498 13.8414 13.947 14.165 13.9685 13.9605 13.5307 13.6549 13.6895 12.6919 10.4335 12.5255 13.1035 12.7048 12.7788 11.8244 11.7493 11.4291 A0A0B8S086 A0A0B8S086_PIG Protein FAM179B FAM179B Sus scrofa domesticus (domestic pig) cytoskeleton [GO:0005856] ADLITVGPK 0.408 323.31 15.1997 15.3714 15.4082 16.0004 12.1442 12.9306 15.9233 16.151 14.7709 15.5316 15.5343 13.5844 15.7851 15.772 12.1697 15.8395 15.5142 15.8473 11.6484 12.2263 11.2641 14.7736 15.1274 15.0934 12.4202 10.8509 14.5532 12.1343 12.6361 11.6616 12.727 12.0882 12.7047 11.2812 12.0316 12.4389 12.3092 12.1298 13.6647 11.1156 10.4092 15.0658 14.679 11.9624 11.7463 14.6486 12.0288 14.7683 15.347 11.2229 15.3681 15.2231 11.2248 15.2854 10.2831 14.5307 14.5722 14.4481 14.324 11.3416 14.3284 14.1716 14.2373 A0A0B8S087 A0A0B8S087_PIG Exocyst complex component EXOC6B Sus scrofa domesticus (domestic pig) intracellular protein transport [GO:0006886]; vesicle tethering involved in exocytosis [GO:0090522] exocyst [GO:0000145] ASDYLVDLIAFLR 0.40476 323.31 10.1384 11.9111 8.73826 10.726 10.7557 12.1166 8.36006 12.2006 12.4688 12.0628 9.13093 8.96538 11.1983 11.3326 11.585 11.0373 10.6331 0 10.9307 8.62735 11.2946 11.5184 11.39 8.89461 7.81845 8.1979 12.7601 8.54998 9.54044 11.2484 10.1076 11.0692 9.5272 9.62841 10.9496 6.15076 5.73936 10.2426 9.06348 10.6779 8.9389 9.82939 10.6386 9.93137 10.4471 11.4502 9.29902 8.79032 11.1863 9.84182 8.27268 11.311 9.54425 10.1967 9.65094 10.5481 8.64411 7.60326 9.64124 9.33472 9.1343 6.82324 10.5683 A0A0B8S088 A0A0B8S088_PIG Ectonucleotide pyrophosphatase/phosphodiesterase 1 ENPP1 Sus scrofa domesticus (domestic pig) immune response [GO:0006955] extracellular region [GO:0005576]; membrane [GO:0016020] "hydrolase activity, acting on ester bonds [GO:0016788]; metal ion binding [GO:0046872]; nucleic acid binding [GO:0003676]; polysaccharide binding [GO:0030247]; scavenger receptor activity [GO:0005044]" AEYLHTWGGLLPVISKLK 0.94268 292.53 11.8373 10.2378 11.3562 12.8483 11.7951 11.0369 12.4733 13.3106 13.6559 13.0351 11.4991 10.8579 12.0653 12.5954 11.3353 11.8342 10.9509 11.7093 11.3013 10.8007 8.97842 12.4005 12.2194 12.7276 10.8925 10.1639 10.3066 7.62863 10.602 8.4368 9.70982 10.3591 10.8819 10.8573 9.75464 8.56879 8.48671 10.6464 11.7718 10.3919 10.6085 11.0947 6.31368 10.5367 9.57351 10.6175 10.8785 10.7983 9.19333 10.6906 10.9179 9.26461 10.9343 9.01748 9.48565 9.78992 10.9428 9.177 5.66502 7.715 9.59442 9.37069 10.6232 A0A0B8S089 A0A0B8S089_PIG Eukaryotic translation initiation factor 3 subunit A (eIF3a) (Eukaryotic translation initiation factor 3 subunit 10) (eIF-3-theta) EIF3A EIF3S10 Sus scrofa domesticus (domestic pig) formation of cytoplasmic translation initiation complex [GO:0001732] eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852] RNA binding [GO:0003723]; translation initiation factor activity [GO:0003743] AARQSVYEEKLK 0.40157 323.31 13.4329 13.5171 12.7579 13.7172 14.8246 14.9417 14.9508 14.7558 13.696 14.3098 12.7142 13.1831 13.4322 13.4165 14.3017 12.6013 14.8043 13.2845 11.6759 12.7345 13.1108 14.4878 15.0768 14.6153 13.2849 12.4334 11.9503 12.9345 13.9254 12.897 14.6634 13.73 14.5816 11.3233 12.8704 13.6007 12.5203 12.4819 12.0559 11.2917 12.0474 12.348 10.8762 11.668 12.7223 11.187 12.3785 10.8705 13.5736 13.2641 13.3596 11.9839 12.5437 11.4531 11.6984 9.74734 11.9536 12.3722 12.363 11.5358 10.553 11.007 11.5448 A0A0B8S090 A0A0B8S090_PIG "alpha-1,2-Mannosidase (EC 3.2.1.-)" EDEM1 Sus scrofa domesticus (domestic pig) carbohydrate metabolic process [GO:0005975] endoplasmic reticulum [GO:0005783]; membrane [GO:0016020] "calcium ion binding [GO:0005509]; mannosyl-oligosaccharide 1,2-alpha-mannosidase activity [GO:0004571]" AKCGYATLHHVIDK 0.94508 155.43 12.796 11.3517 0 12.0562 10.9785 9.35661 12.0395 11.8203 11.7169 11.4593 11.0534 11.9129 8.9477 9.74559 12.6398 11.3159 10.3996 8.79886 11.3777 11.3788 11.4492 0 11.824 11.2003 11.5039 11.5424 11.1256 13.6114 13.9103 13.9281 11.2894 11.9234 8.42004 9.09814 5.60866 6.0648 0 11.8838 12.2284 8.92621 7.37016 8.56932 10.1975 10.2892 9.92287 11.9701 11.0116 10.7688 11.6466 11.8744 11.4729 9.06921 9.52095 11.0476 7.13196 0 10.5573 10.467 10.3157 10.2854 9.52468 9.23249 10.4604 A0A0B8S091 A0A0B8S091_PIG tRNA-dihydrouridine(47) synthase [NAD(P)(+)] (EC 1.3.1.-) (tRNA-dihydrouridine synthase 3) DUS3L Sus scrofa domesticus (domestic pig) flavin adenine dinucleotide binding [GO:0050660]; metal ion binding [GO:0046872]; tRNA dihydrouridine synthase activity [GO:0017150] AADWIRISEMLLGPVPPTFVFLPK 0.97238 264.36 10.3937 6.94462 7.60429 11.6001 9.78472 10.1941 10.4642 11.356 11.1644 10.1105 7.08895 10.1954 11.1927 11.6555 9.12802 8.46801 8.56449 5.34639 11.7696 8.51759 0 9.63319 9.27891 8.91043 9.37058 6.37393 5.7422 11.8783 11.3462 9.50869 9.43563 8.11192 8.33709 9.80678 10.2953 8.40574 9.85292 7.19012 9.68485 6.49768 6.81583 7.84455 10.3252 6.3394 9.3828 9.43621 0 8.21902 10.236 5.91717 11.9382 8.3245 0 10.5053 3.62936 5.93426 7.92285 5.614 0 6.56314 10.3484 9.19741 10.3441 A0A0B8S092 A0A0B8S092_PIG Disks large-associated protein 4 DLGAP4 Sus scrofa domesticus (domestic pig) signaling [GO:0023052] ALCLELLK 0.98443 192.75 13.4335 7.04078 11.2206 12.0782 12.1789 10.8085 12.222 7.28799 13.1368 11.9431 11.6228 10.9761 14.9236 12.2104 10.8519 7.71246 9.73921 9.58305 7.61088 10.79 5.81293 9.706 6.37863 12.3347 11.9371 8.70791 11.4223 7.71534 12.0432 0 9.93587 0 10.9383 9.29013 0.714311 9.21463 9.28286 9.31027 7.50136 8.0022 11.9917 11.9014 9.706 8.62947 9.52769 10.6522 9.04048 7.76653 10.8169 10.9659 11.259 4.70498 8.55405 12.2907 0 12.7463 12.6798 8.55685 12.5288 6.54393 5.25792 7.55328 6.59147 A0A0B8S093 A0A0B8S093_PIG ATP-dependent RNA helicase DHX29 (EC 3.6.4.13) (DEAH box protein 29) DHX29 Sus scrofa domesticus (domestic pig) positive regulation of translational initiation [GO:0045948] cytoplasm [GO:0005737] ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; RNA helicase activity [GO:0003724]; translation initiation factor activity [GO:0003743] AAGFSSPTSFNGSEGNR 0.39844 323.31 13.9048 13.6413 13.5559 15.3775 15.0892 15.4139 15.0055 14.7003 14.6434 14.8792 14.7068 14.6776 15.0694 14.7654 15.1616 15.4799 14.9132 15.5954 14.4975 14.5433 14.5674 15.2197 15.1234 15.5069 14.444 14.758 14.2189 15.8485 13.366 11.9339 13.9556 14.9664 12.7863 12.2786 13.0075 11.4522 14.3639 13.3238 14.6291 13.345 12.7032 13.3184 12.3926 13.0117 12.3307 13.7117 13.4082 13.39 14.04 13.9026 13.4508 12.127 13.1257 12.723 12.3043 12.2646 12.3686 12.6484 12.244 12.6059 10.432 11.2917 10.2809 A0A0B8S094 A0A0B8S094_PIG DENN/MADD domain containing 2D DENND2D Sus scrofa domesticus (domestic pig) guanyl-nucleotide exchange factor activity [GO:0005085] AFYKALPSKANR 0.91991 231.23 10.4609 9.16636 9.05028 11.3501 9.56495 11.2476 10.7306 10.2503 8.81967 8.96492 10.355 10.6979 12.9429 12.6695 13.3188 11.3822 10.8076 9.53243 0 10.3599 12.425 9.01025 10.9466 6.84987 11.1774 10.5842 10.3189 9.73296 10.0411 10.1316 7.77353 9.91184 0 10.3529 7.16088 10.2415 10.2378 9.85972 11.1049 8.72079 9.98242 8.45257 9.98925 11.9066 12.4921 0 9.62278 9.90799 6.72533 10.5267 7.91145 6.14745 8.78983 7.72588 7.46205 8.27482 8.52242 0 7.40276 9.31796 9.97068 8.62877 9.93518 A0A0B8S095 A0A0B8S095_PIG ATP-dependent RNA helicase (EC 3.6.4.13) DDX18 Sus scrofa domesticus (domestic pig) ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; RNA binding [GO:0003723]; RNA helicase activity [GO:0003724] AIKEMGFTNMTEIQHK 0.94444 323.31 11.951 11.3681 11.475 12.6424 12.5607 12.2837 12.062 11.7006 11.5112 10.8328 7.32984 10.9317 11.4142 12.3385 13.0214 9.61259 11.6223 11.518 9.04917 10.2135 11.1178 9.30684 11.7996 12.9915 11.1216 5.86099 7.24355 12.15 11.1409 9.36508 12.7102 10.3252 10.8764 11.371 8.37808 11.0833 10.3164 12.6118 8.68933 9.4245 11.0651 10.3863 10.9293 9.20545 10.9391 9.60765 8.70054 11.2561 6.65148 9.7311 12.0529 9.87527 9.46146 9.97212 9.83712 11.2635 8.61688 8.79181 10.596 5.69666 8.49382 9.40067 4.38453 A0A0B8S096 A0A0B8S096_PIG Dystroglycan 1 (Dystroglycan) (Dystrophin-associated glycoprotein 1) DAG1 Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; dystrophin-associated glycoprotein complex [GO:0016010]; extracellular region [GO:0005576]; nucleoplasm [GO:0005654]; postsynaptic membrane [GO:0045211]; sarcolemma [GO:0042383] calcium ion binding [GO:0005509] AAFSNALEPDFK 0.93096 235.38 6.85997 9.24486 7.47565 11.1043 11.1539 10.933 7.87203 11.7049 6.56455 8.89032 10.2088 6.15306 13.9333 12.3911 11.1313 10.6768 10.4723 10.5444 10.4498 9.97943 9.20433 9.62383 12.6402 10.6812 12.4006 6.94087 8.83216 8.95149 9.90439 7.43912 10.9483 6.98766 7.04843 9.54355 8.46765 5.5169 0 8.55152 10.2567 8.4045 11.0906 8.78395 12.5214 9.97355 10.5682 10.5549 10.3636 6.06788 7.52262 9.82501 0 0 9.75849 7.47873 10.9135 10.4138 6.59175 10.8973 7.36964 9.7287 11.3254 10.986 8.10402 A0A0B8S097 A0A0B8S097_PIG C-X-C motif chemokine CXCL6 Sus scrofa domesticus (domestic pig) defense response [GO:0006952]; immune response [GO:0006955] extracellular space [GO:0005615] chemokine activity [GO:0008009] APLIKKIVQK 0.96984 62.058 0 0 6.65564 8.61923 0 0 8.80591 10.7864 0 0 0 0 9.07497 5.75475 9.39966 6.80607 0 0 6.69752 0 0 8.01564 0 7.59768 4.99761 0 9.0655 8.31166 7.43779 7.68713 7.19387 5.96382 0 7.69174 7.40242 7.62161 9.81086 0 9.99803 8.65939 6.26121 4.9865 7.84812 0 8.35187 5.14315 0 0 0 0 6.70266 6.8759 0 0 0 0 0 0 7.40939 0 0 0 7.27631 A0A0B8S098 A0A0B8S098_PIG Cathepsin S (EC 3.4.22.27) CTSS Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] lysosome [GO:0005764]; phagocytic vesicle [GO:0045335] cysteine-type peptidase activity [GO:0008234] AVDGKCK 0.95642 147.96 12.1916 12.6751 11.6659 14.1959 8.33342 13.8312 14.3318 14.1244 9.11463 7.27491 0 0 7.85922 9.76399 13.6065 14.5053 14.488 9.01369 13.6136 13.0705 9.13802 14.2579 0 7.9276 13.5908 13.0149 13.1638 8.70273 7.69891 6.2812 8.93127 0 13.2404 0 8.81909 8.62015 9.88882 7.27044 10.142 8.69216 9.75955 9.28917 10.0751 0 0 7.99673 7.21004 0 8.33217 9.48446 9.06846 7.91277 9.83966 9.70143 10.6131 0 8.19668 9.03191 7.72048 9.46101 6.68356 0 7.12743 A0A0B8S099 A0A0B8S099_PIG Citrate synthase CS Sus scrofa domesticus (domestic pig) citrate metabolic process [GO:0006101]; tricarboxylic acid cycle [GO:0006099] mitochondrial matrix [GO:0005759] citrate (Si)-synthase activity [GO:0004108] ALGFPLERPK 0.95238 149.52 7.35209 7.71452 11.0168 12.1875 12.2182 11.8119 11.2602 11.4824 11.5057 11.1543 11.3209 9.27083 9.43438 12.0549 11.4125 13.2537 12.2691 11.5963 10.185 9.93106 0 11.3904 10.9339 13.0872 12.1833 11.6881 12.1438 9.45483 0 9.68414 10.5242 11.2444 12.2098 10.7099 9.60279 10.8656 8.62172 11.5981 12.8014 10.4354 8.55079 8.02708 10.2644 11.6462 9.66 11.0287 10.2397 9.45401 8.19756 10.3724 10.9451 10.4116 10.2725 9.42744 9.43515 10.3712 10.3501 9.41504 10.1092 2.90908 0 6.96371 8.9845 A0A0B8S0A0 A0A0B8S0A0_PIG COMM domain-containing protein 6 COMMD6 Sus scrofa domesticus (domestic pig) AKVTNQLIDFQWK 0.97246 85.457 7.32283 4.87381 8.2054 11.708 10.1869 9.5127 0 0 11.5589 0 9.15982 10.6338 11.5548 12.2133 11.3477 10.9927 11.1021 12.3667 0 10.8457 9.98299 9.51999 11.3086 0 10.2916 0 0 8.36054 9.01539 0 10.2389 0 8.94386 0 9.35705 6.34135 0 0 0 0 9.5857 7.75656 8.886 8.23065 6.92053 0 6.51728 7.95675 0 10.4551 0 0 0 0 10.231 0 0 0 0 7.55865 0 8.5047 0 A0A0B8S0A1 A0A0B8S0A1_PIG Caseinolytic mitochondrial matrix peptidase chaperone subunit CLPX Sus scrofa domesticus (domestic pig) ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent protein folding chaperone [GO:0140662]; protein dimerization activity [GO:0046983]; unfolded protein binding [GO:0051082]; zinc ion binding [GO:0008270] AAAAADLANR 0.94006 290.8 11.4018 8.51739 9.43423 0 9.96694 11.7955 10.9182 12.8226 8.81791 10.5604 10.9003 8.18339 10.0843 9.36245 9.0695 11.2286 10.439 10.5845 10.4868 11.145 9.85977 7.84862 9.68743 11.1206 10.7489 10.622 12.7211 6.9148 8.2716 5.94998 10.0634 8.66701 9.28355 9.15234 8.54531 4.69583 9.58156 11.4083 9.88332 10.6896 10.1789 9.21415 8.28137 11.1315 6.672 6.09902 4.13849 5.42438 9.80027 0 11.4279 9.43542 6.38452 9.91123 0 9.4945 9.108 0 9.46848 8.87977 8.48816 4.24047 9.5265 A0A0B8S0A2 A0A0B8S0A2_PIG Chloride intracellular channel protein CLIC1 Sus scrofa domesticus (domestic pig) chloride channel complex [GO:0034707]; endoplasmic reticulum [GO:0005783]; nuclear membrane [GO:0031965]; plasma membrane [GO:0005886] chloride channel activity [GO:0005254] AEEQPQVELFVK 0.49038 323.31 13.0795 13.0149 12.8545 14.6575 12.4275 14.4581 14.4975 14.3398 14.5362 13.711 13.7361 13.5777 12.0291 14.8469 14.3681 12.036 14.4634 14.27 13.2437 13.0638 11.9888 14.4832 11.7649 14.5815 12.4258 12.3234 12.2539 11.2759 11.6546 11.7975 13.8086 13.7163 13.7557 11.494 10.9265 11.6697 11.5167 11.6877 11.4466 11.7143 12.5251 12.2709 11.999 11.9492 11.5297 12.6507 12.957 11.0469 11.5094 12.8172 11.5437 12.8746 12.5016 12.8372 11.3087 11.3414 5.37952 11.0486 8.02724 9.39399 11.1315 9.37565 9.90326 A0A0B8S0A3 A0A0B8S0A3_PIG Cysteine and histidine-rich domain-containing protein 1 (CHORD domain-containing protein 1) CHORDC1 Sus scrofa domesticus (domestic pig) metal ion binding [GO:0046872] AEPMQWASLELPAAK 0.97448 180.82 10.8161 11.022 10.7323 11.1898 12.2269 12.0838 11.1635 11.7219 11.1288 11.4936 11.1128 11.5518 11.7923 12.0303 11.1668 11.0749 10.8403 12.281 11.8029 12.7486 11.7763 12.2578 12.3012 13.0823 10.2124 11.5875 11.7617 9.76253 0 9.10512 10.9787 11.86 11.1286 10.0855 10.1471 9.79928 0 8.19948 0 9.02184 7.86034 0 9.15158 6.76726 5.96419 6.23957 8.83697 0 8.9633 9.10261 11.7527 8.05945 12.8321 10.5861 0 0 0 8.8327 8.07012 8.82155 0 0 8.5588 A0A0B8S0A4 A0A0B8S0A4_PIG CASP8 and FADD-like apoptosis regulator CFLAR Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508]; regulation of apoptotic process [GO:0042981] cysteine-type endopeptidase activity [GO:0004197] ARQPGTCTVHR 0.92441 230.64 3.12473 10.3706 10.2935 11.2044 12.1363 10.311 11.2755 11.8603 10.8307 10.1124 10.507 9.28054 11.0554 10.8721 7.34713 11.0901 7.97734 13.1879 9.1353 10.2188 11.1981 11.1043 8.69964 9.00051 10.2349 8.29283 7.23093 9.68177 8.94565 10.9023 12.2485 9.47131 10.735 5.10719 9.95651 10.0188 10.2746 9.58798 10.1529 0 0 10.2086 9.65696 10.9209 6.93711 0 12.0444 9.35793 5.96042 7.68039 0 10.2541 6.30124 9.47533 7.31596 6.96993 0 8.66779 6.78123 7.96526 6.51379 9.15977 6.25508 A0A0B8S0A5 A0A0B8S0A5_PIG Cyclin-dependent kinase 12 (EC 2.7.11.22) (EC 2.7.11.23) (Cell division protein kinase 12) CDK12 Sus scrofa domesticus (domestic pig) mRNA processing [GO:0006397]; phosphorylation [GO:0016310]; RNA splicing [GO:0008380] nuclear speck [GO:0016607] ATP binding [GO:0005524]; protein kinase activity [GO:0004672] AAAAAAAK 0.96226 323.31 12.4428 11.9682 12.8818 13.1626 13.4422 14.1113 13.0877 12.5716 13.3624 14.0078 13.8351 13.1355 12.9712 14.9642 13.7851 13.5796 13.3031 13.7609 12.5751 12.6914 12.688 12.6208 13.4481 14.1384 12.6547 12.0418 12.4841 10.0397 11.2504 11.5718 11.3671 12.0704 10.1836 12.8672 12.787 12.4458 12.7962 11.2461 12.1111 9.91355 11.4099 10.4269 14.8941 11.1776 11.1468 10.2907 11.9442 11.5996 13.2975 11.6489 11.1816 10.3524 10.4691 10.9871 9.60257 8.82877 11.0955 10.8734 10.6549 10.2213 9.61281 10.8316 9.73784 A0A0B8S0A6 A0A0B8S0A6_PIG CD48 molecule CD48 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] ARLDLQSGALHIQKVK 0.96492 73.238 8.20359 0 0 9.5529 0 10.4249 8.68148 5.62185 10.7091 0 0 0 0 4.34958 9.78565 6.76474 6.93062 6.50258 0 0 4.27955 8.95902 0 0 8.33485 5.63912 8.98365 6.09411 0 5.26566 0 7.08534 7.22593 0 0 0 7.53465 0 9.45871 5.17943 6.45531 3.8953 5.26754 0 0 0 0 0 0 10.1372 8.4271 0 9.39232 4.34248 0 0 0 0 6.7447 0 0 0 0 A0A0B8S0A7 A0A0B8S0A7_PIG CMRF35-like molecule 7 CD300LB Sus scrofa domesticus (domestic pig) membrane [GO:0016020] DPEEPRGQPISANLSSDPLTK 0.96329 68.588 3.75542 0 3.57434 8.35988 7.17093 0 0 0 6.06299 0 5.16844 0 9.15677 3.8535 0 4.37351 0 5.13619 0 6.72479 0 8.24665 7.10339 0 5.05272 0 0 5.26074 8.44729 0 9.78033 7.97957 9.23324 0 7.57289 0 0 0 0 0 0 8.39806 0 6.31383 0 4.09221 8.07195 0 7.72007 3.87036 7.48744 5.95977 0 0 4.02919 0 0 0 3.39931 0 8.02475 5.09238 8.1468 A0A0B8S0A8 A0A0B8S0A8_PIG Chemokine (C-C motif) receptor-like 2 CCRL2 Sus scrofa domesticus (domestic pig) chemotaxis [GO:0006935] plasma membrane [GO:0005886] chemokine receptor activity [GO:0004950] ANYTSAPEDDYDVFIEDDLSNDER 0.96631 42.536 9.53146 7.30323 0 12.0745 0 11.7043 0 0 7.91642 8.96561 0 10.5767 0 9.63403 0 8.54323 11.9399 10.8404 10.7651 8.92932 10.2024 9.13214 10.0116 11.8462 9.18522 9.27505 10.6742 8.73775 8.0838 0 9.45892 7.96965 9.14797 8.55677 0 0 8.62454 8.52736 4.48839 7.39275 0 8.58571 9.47843 8.22236 7.77459 7.48583 0 9.86564 0 0 8.84897 7.59477 6.77452 8.74584 4.83228 0 8.50406 0 0 7.65413 6.70915 0 7.11343 A0A0B8S0A9 A0A0B8S0A9_PIG Coiled-coil domain-containing protein 86 CCDC86 Sus scrofa domesticus (domestic pig) nucleus [GO:0005634] ALVELESHPEEAREPGSPR 0.9575 144.14 10.4374 10.3157 8.83491 9.66422 10.9796 11.4656 9.01455 0 8.43517 9.98698 6.60256 8.75632 8.09735 9.89798 11.1325 6.95361 0 8.93029 9.52215 13.2862 0 8.73291 10.9882 9.6933 9.93809 9.15588 8.88865 0 9.58412 0 8.13899 0 8.2563 11.5765 10.6637 6.04168 0 0 10.0873 9.65367 0 10.4543 7.17642 9.55027 10.4883 7.85985 4.80998 8.49105 9.27708 8.88249 9.42675 9.495 10.5233 8.20823 11.0232 4.75846 9.40465 5.90024 0 4.95596 0 7.28272 8.45955 A0A0B8S0B0 A0A0B8S0B0_PIG Caspase-6 (EC 3.4.22.59) CASP6 Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] nucleus [GO:0005634] cysteine-type endopeptidase activity [GO:0004197] AEELLLK 0.96 123.85 0 7.58248 11.2549 12.2452 11.4832 7.64472 0 4.98044 5.86916 7.06813 9.52001 9.41695 12.9121 11.9347 11.2788 0 9.6436 11.8707 7.79474 9.23747 8.79565 11.0706 11.1752 12.0007 9.15429 8.97691 9.07066 9.14532 5.82795 8.27538 7.81436 8.62077 8.45557 0 13.1616 13.5695 11.6138 10.1833 8.88496 9.69714 11.1232 9.3152 11.3404 11.5426 10.1895 0 7.6271 6.51786 7.2636 9.06175 0 9.6596 9.47766 0 4.32438 9.83868 9.5961 7.05126 0 0 9.1682 7.00518 0 A0A0B8S0B1 A0A0B8S0B1_PIG Adenylyl cyclase-associated protein CAP1 Sus scrofa domesticus (domestic pig) cytoskeleton organization [GO:0007010] plasma membrane [GO:0005886] actin binding [GO:0003779] ADMQNLVER 0.96372 170.46 8.472 12.8632 0 13.4691 6.00315 9.75774 9.25172 10.0312 10.1994 11.2358 10.1643 9.92001 13.1625 0 13.0729 8.54032 8.14323 8.02757 10.1208 10.9815 5.98773 14.2407 8.10696 7.05474 0 13.9923 10.1003 0 10.6371 10.8248 9.64839 11.517 9.90519 0 10.3784 0 10.5652 9.30499 9.25025 13.0831 9.75404 0 11.1948 11.1208 9.00414 0 10.0583 9.38638 11.1406 10.6125 11.4646 7.57243 9.0396 11.5749 12.6411 5.63567 8.47699 7.45055 7.5263 8.55098 7.90117 8.98701 6.34389 A0A0B8S0B2 A0A0B8S0B2_PIG Chromosome 7 open reading frame 26 C7orf26 Sus scrofa domesticus (domestic pig) ADDNRMSLLGK 0.96175 116.27 11.5998 7.33092 11.3314 12.325 10.09 12.1312 8.29751 11.9977 10.2912 11.3678 10.7311 0 8.68496 10.3683 10.9609 11.9598 8.75642 9.49165 10.3991 11.3802 11.43 12.1206 12.0635 12.3955 0 0 9.33954 11.422 11.721 11.3169 12.2256 11.0862 11.0674 10.6336 0 5.89159 11.2382 10.3919 9.19052 11.0226 10.9421 10.7568 8.36177 9.51682 0 11.1235 3.16458 10.7759 10.7577 10.8817 10.8787 8.37539 9.55117 9.13886 8.15805 10.1448 7.69732 10.7117 10.5723 10.6174 9.94926 9.82308 7.71891 A0A0B8S0B3 A0A0B8S0B3_PIG Bone marrow stromal cell antigen 2 BST2 Sus scrofa domesticus (domestic pig) defense response to virus [GO:0051607] membrane [GO:0016020] ANSKGCKDGLR 0.96258 68.935 0 9.00155 5.45101 0 0 0 3.88606 0 0 0 9.27412 0 0 0 0 0 0 0 4.6879 9.21655 0 9.52415 7.84178 0 0 0 0 7.03397 8.85633 0 5.04221 7.53916 0 0 0 5.7785 0 5.66749 0 0 0 0 5.74416 0 0 8.80297 0 0 0 0 5.48336 0 0 0 0 5.32369 0 0 8.80532 7.52034 4.02698 3.93083 3.52055 A0A0B8S0B4 A0A0B8S0B4_PIG B-cell linker BLNK Sus scrofa domesticus (domestic pig) AGKKPAMQLK 0.96918 177.06 11.8179 8.95707 13.5195 12.2137 14.9862 9.50052 14.5533 12.5509 14.3198 14.1542 14.0027 11.7246 11.9656 8.64861 13.9207 10.9165 14.4182 8.69766 12.6905 13.1319 12.8083 14.4238 13.6052 11.5478 12.6618 10.0246 12.3948 11.1425 9.64254 9.82639 13.2416 10.1887 11.6727 8.83131 11.0413 9.28478 9.77393 9.53848 9.38989 12.5443 10.2101 9.89095 7.24802 10.4687 8.62114 10.8428 10.1232 7.40854 12.9296 13.0063 12.9272 12.877 11.9948 9.49979 11.9283 10.2849 10.3749 10.4783 11.1592 10.5626 9.87735 10.1995 11.5559 A0A0B8S0B5 A0A0B8S0B5_PIG Bcl-2-like protein 1 (Apoptosis regulator Bcl-X) BCL2L1 Sus scrofa domesticus (domestic pig) apoptotic process [GO:0006915]; regulation of apoptotic process [GO:0042981] centrosome [GO:0005813]; cytosol [GO:0005829]; mitochondrial matrix [GO:0005759]; nuclear membrane [GO:0031965]; synaptic vesicle membrane [GO:0030672] EAGDEFELR 0.98749 30.932 0 0 0 9.72482 0 0 0 0 0 6.59039 0 0 7.12029 0 0 7.54133 0 8.91442 0 0 0 6.17541 0 0 9.26812 0 9.30122 0 0 0 0 0 0 0 0 7.91037 0 0 0 0 0 8.923 0 5.60259 0 0 0 5.50618 0 0 8.31238 8.28267 7.32499 0 0 2.93951 7.78162 0 0 5.91109 0 0 0 A0A0B8S0B6 A0A0B8S0B6_PIG H(+)-transporting two-sector ATPase (EC 7.1.2.2) ATP6V1A Sus scrofa domesticus (domestic pig) "clathrin-coated vesicle membrane [GO:0030665]; proton-transporting V-type ATPase, V1 domain [GO:0033180]" "ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]; proton-transporting ATPase activity, rotational mechanism [GO:0046961]" ADYAQLLEDMQNAFR 0.96893 269.85 11.5206 12.9855 11.2812 13.1681 11.8715 14.0722 12.8256 12.5628 12.3782 10.301 10.2767 12.1117 12.7499 14.8053 10.6889 10.9987 9.70183 9.84704 11.5344 11.3775 10.5186 13.8593 10.2694 10.4207 10.8218 9.82544 8.50104 10.6976 10.8364 10.058 13.5936 12.087 11.0769 8.50279 10.7378 8.19126 10.7249 8.86196 6.92742 12.5841 10.3797 10.0942 9.91198 10.4003 10.2896 11.1018 11.1155 12.5092 6.39324 11.0269 11.4656 0 10.7985 10.2656 9.82451 10.498 10.8761 10.2305 0 10.0979 8.96345 8.96651 10.1765 A0A0B8S0B7 A0A0B8S0B7_PIG Calcium-transporting ATPase (EC 7.2.2.10) ATP2B1 Sus scrofa domesticus (domestic pig) basolateral plasma membrane [GO:0016323]; lateral plasma membrane [GO:0016328]; presynaptic membrane [GO:0042734] ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; P-type calcium transporter activity [GO:0005388] ADVGFAMGIAGTDVAK 0 323.31 12.1868 16.4495 11.2196 17.7424 17.7003 18.0316 17.4908 18.6515 17.6993 17.027 16.8385 17.0246 14.0173 17.6535 10.6675 17.471 10.9696 11.2966 15.5454 13.1788 16.0792 17.5509 13.1258 11.7082 9.85677 12.0739 10.741 11.3064 8.98068 9.75082 11.3963 10.8996 16.4789 12.8519 5.14812 12.1616 10.7843 15.4619 12.1298 13.2576 8.94819 9.24348 10.0143 12.2887 8.33517 0 15.1748 15.4008 16.2489 12.3608 16.2045 9.29457 9.58389 12.8249 15.6189 15.8665 8.9687 10.2014 8.0743 14.4115 14.6126 6.73701 7.88026 A0A0B8S0B8 A0A0B8S0B8_PIG Activating transcription factor 7 interacting protein ATF7IP Sus scrofa domesticus (domestic pig) AADSTSQSGK 0 323.31 10.2333 8.2817 11.9334 11.4425 12.7859 11.9868 12.1842 12.3044 9.57427 11.4097 12.1442 10.8528 12.9608 11.3669 11.8976 11.7888 12.2427 12.3272 10.5069 11.6231 12.1044 12.2773 12.1086 12.9008 9.8777 10.2786 11.3115 11.0422 11.6628 10.9977 12.1988 12.3736 12.8246 11.0562 9.88226 11.2519 12.0924 7.86251 11.3552 11.8036 8.30848 9.07345 11.396 11.0281 11.1975 11.2091 9.92665 5.31488 9.83479 10.2767 10.0634 11.7875 7.07221 0 10.0098 9.93854 9.04865 9.74105 10.0358 10.3851 9.82478 9.9135 10.6376 A0A0B8S0B9 A0A0B8S0B9_PIG Rho GTPase activating protein 18 ARHGAP18 Sus scrofa domesticus (domestic pig) signal transduction [GO:0007165] ALLEFLQR 0.93811 299.53 10.2257 10.4463 9.56081 11.4885 11.6145 10.4216 11.0737 11.6469 12.594 10.194 12.8996 8.03331 18.4686 18.5827 18.6096 10.5895 18.3517 10.711 9.73246 11.0947 18.3627 10.9174 18.823 9.97413 9.64652 10.4426 8.44878 8.44369 18.1711 18.2415 18.44 18.6015 9.28462 11.5541 7.24954 10.1717 12.1506 9.9141 12.5855 10.1157 11.8994 11.228 8.24522 11.6016 11.1255 18.1076 7.14944 11.0247 9.17857 8.5667 9.62441 9.78088 11.5583 11.6985 10.8857 11.193 11.2597 17.255 10.8553 10.5331 8.76414 10.3596 9.7763 A0A0B8S0C0 A0A0B8S0C0_PIG "Adaptor-related protein complex 3, sigma 1 subunit" AP3S1 Sus scrofa domesticus (domestic pig) Golgi to vacuole transport [GO:0006896]; intracellular protein transport [GO:0006886] AP-3 adaptor complex [GO:0030123]; cytoplasmic vesicle membrane [GO:0030659] AILIFNNHGKPRLSK 0.9677 51.557 2.2841 9.39876 0 0 0 7.69857 0 0 0 0 0 0 0 0 0 5.97301 0 0 10.7239 0 0 0 7.57539 0 0 8.01575 0 7.97206 0 0 9.7621 0 8.85618 8.46491 7.34225 0 0 7.46082 0 7.19426 0 0 0 0 8.2948 0 0 5.19069 0 7.18884 8.18403 0 7.98328 0 0 7.6351 0 0 7.92017 0 0 0 4.26731 A0A0B8S0C1 A0A0B8S0C1_PIG Ankyrin repeat domain 12 ANKRD12 Sus scrofa domesticus (domestic pig) AERKNSEK 0 323.31 15.3559 15.2932 15.4927 16.2447 16.0445 17.1225 17.2539 15.9887 14.9225 13.8316 13.1503 15.7769 16.42 16.6454 16.2451 12.5631 12.705 13.9261 13.964 15.2023 14.6739 15.8777 15.835 15.3769 15.7976 13.2923 15.4381 11.8012 13.3838 14.0697 14.372 13.584 15.1507 14.7339 13.7361 13.2317 14.3558 13.6526 14.0901 12.0719 14.985 14.9224 14.391 14.2666 13.02 12.8871 15.5142 14.3104 12.9257 12.7494 12.8993 11.6436 13.7556 12.8886 15.1411 13.3491 12.8312 10.252 11.4457 12.3668 11.9954 12.5056 14.6565 A0A0B8S0C2 A0A0B8S0C2_PIG Aldo-keto reductase family 1 member B1 (EC 1.1.1.21) (EC 1.1.1.300) (Aldose reductase) AKR1B1 Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737] oxidoreductase activity [GO:0016491] AIAAKYNK 0.9516 110.04 8.64382 5.99043 9.01064 4.7551 11.5069 10.8817 12.6875 10.4062 12.9987 11.8391 11.1729 10.4474 12.8526 12.2458 10.8708 11.4185 11.1549 8.5656 10.7798 8.93455 10.7092 12.2755 10.136 10.4957 8.62392 10.9667 0 10.2349 7.30003 6.15642 11.6283 10.7206 9.30618 7.97665 9.296 6.87086 8.47119 9.12616 8.94562 9.00843 0 9.35215 0 5.42149 7.44253 8.65689 8.63209 8.51771 9.31861 7.8846 6.67793 8.11551 0 8.08831 10.2983 9.66669 9.52362 10.1579 9.95887 8.44352 7.4698 5.25001 8.70874 A0A0B8S0C3 A0A0B8S0C3_PIG Adhesion regulating molecule 1 ADRM1 Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737]; nucleus [GO:0005634]; proteasome complex [GO:0000502] AGKMSLK 0.961 132.97 11.3091 11.3099 10.9766 8.88026 9.56611 6.40444 13.7566 13.3833 13.6789 10.2724 12.6428 10.6938 13.0756 12.8329 9.41253 13.0249 13.0837 7.9633 13.0425 10.4795 8.15158 0 10.6968 10.5076 7.68405 12.0446 9.27053 0 5.39122 10.2298 9.29886 7.16832 0 7.60125 7.49681 11.0972 0 11.5724 11.7283 8.62132 8.72288 8.69401 10.2533 6.75462 9.23783 11.0421 11.0966 9.0153 6.9046 7.97505 9.15259 0 9.71553 8.39008 0 10.3402 9.48406 9.60192 9.60246 8.33472 5.74028 0 4.69772 A0A0B8S0C4 A0A0B8S0C4_PIG ADAM metallopeptidase domain 28 ADAM28 Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] membrane [GO:0016020] metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222] AFEPEVIGEEVGMVANGTKCGNK 0 323.31 10.2541 9.08802 9.96294 12.8471 11.1406 9.80684 9.95494 6.99209 9.80025 10.007 12.5927 9.72202 11.7519 10.8935 11.5877 10.7415 10.9286 9.91106 9.73062 9.60106 9.96751 11.0387 11.1708 12.4826 8.95733 10.0107 7.80864 9.71438 11.3548 7.8261 9.84276 10.1113 9.05615 9.42042 6.39601 6.84097 11.0917 11.0524 9.44512 8.17682 9.70456 10.3806 9.0451 6.65607 10.1096 9.56003 7.34802 9.41587 8.1633 8.66213 10.4152 6.89639 9.20897 7.63147 9.28651 9.64479 8.50251 9.8304 9.29124 9.87497 8.63412 9.64265 8.48563 A0A0B8S0C5 A0A0B8S0C5_PIG Alpha-actinin-4 (Non-muscle alpha-actinin 4) ACTN4 Sus scrofa domesticus (domestic pig) anchoring junction [GO:0070161]; perinuclear region of cytoplasm [GO:0048471]; stress fiber [GO:0001725] actin binding [GO:0003779]; calcium ion binding [GO:0005509] ACLISLGYDVENDR 0 323.31 13.0532 13.0277 12.0466 14.5806 16.112 13.7496 13.9557 14.5496 13.8541 13.6486 13.5057 13.1082 16.1362 14.2802 14.3523 13.614 13.613 13.5341 11.7345 14.7207 12.6503 14.6025 11.8702 14.0476 11.9663 10.9308 10.9204 13.0392 12.6758 13.5353 14.0725 13.7921 14.1159 12.1963 11.8824 12.8279 13.4858 12.9305 12.3919 11.8998 13.249 12.1096 12.8718 12.0186 12.5349 13.9428 12.1883 11.5457 13.2042 14.1145 12.6022 12.5141 11.6064 11.4497 13.5023 13.3845 10.5265 8.8314 11.1828 9.69082 9.56621 9.77711 10.5188 A0A0B8S0C6 A0A0B8S0C6_PIG Long-chain-fatty-acid--CoA ligase (EC 6.2.1.15) (EC 6.2.1.3) (Acyl-CoA synthetase) (Long-chain acyl-CoA synthetase) ACSL1 Sus scrofa domesticus (domestic pig) endoplasmic reticulum membrane [GO:0005789]; mitochondrial outer membrane [GO:0005741] ATP binding [GO:0005524]; long-chain fatty acid-CoA ligase activity [GO:0004467] AILEDMLRLGR 0.9454 275.16 10.167 12.0628 10.3831 11.2171 11.7039 11.7149 11.342 7.66441 8.86552 10.8431 10.893 8.00456 14.3654 8.21291 12.8246 10.1375 9.7922 0 10.9043 0 11.1678 11.0547 9.75832 4.16816 8.75769 11.9446 11.189 11.2373 8.68612 8.48804 8.60559 11.068 11.0985 10.0249 8.90746 11.6834 9.57387 9.97413 9.95601 10.7615 10.9268 10.8331 9.46544 10.118 9.98228 11.0709 7.13843 9.51761 8.99853 10.0626 10.0364 5.90699 8.73742 6.6134 5.56557 9.06525 0 8.64843 10.4685 10.3948 8.9474 8.10019 8.77013 A0A0B8S0C7 A0A0B8S0C7_PIG "Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein (Cnt-b) (Centaurin-beta)" ACAP2 Sus scrofa domesticus (domestic pig) endosome membrane [GO:0010008] GTPase activator activity [GO:0005096]; metal ion binding [GO:0046872] AFCVANK 0 323.31 11.5585 12.3115 7.68475 13.0877 12.6018 13.4202 14.9656 12.6122 13.5926 11.2647 11.9775 11.5395 12.3851 13.9893 13.8964 11.4934 10.5921 13.2815 12.9632 11.0205 10.748 13.5686 13.0181 12.9147 11.7564 11.4795 12.5814 13.3387 13.3011 12.9118 10.1731 11.9314 13.1654 11.5573 11.752 13.6434 10.9064 9.97871 11.8812 11.3961 12.6329 11.3309 13.8732 10.4972 11.2341 9.52103 9.31836 9.32652 12.4667 10.3336 12.0621 13.9833 12.1942 12.3947 7.43112 9.09722 12.2189 8.79529 11.688 11.031 10.7967 8.74315 10.1594 A0A0B8S0C8 A0A0B8S0C8_PIG "ATP-binding cassette, sub-family D (ALD), member 1" ABCD1 Sus scrofa domesticus (domestic pig) long-chain fatty acid import into peroxisome [GO:0015910] peroxisomal membrane [GO:0005778] ABC-type transporter activity [GO:0140359]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; long-chain fatty acid transporter activity [GO:0005324] AARSRGAGTAWPSAIAGLVVFLTANVLR 0.93769 287.97 13.7501 13.5981 13.6125 14.6362 12.909 14.9678 15.1445 14.8333 14.8813 13.9724 14.3118 14.2827 14.5675 14.6627 14.7229 12.9473 13.3555 13.0609 13.3086 13.4108 12.7851 14.6217 14.3595 15.0764 12.2685 11.8329 12.4986 12.2883 11.8844 9.60422 13.3737 14.1986 13.4217 12.3651 10.7422 10.6295 9.74623 13.3923 12.0212 12.6629 12.464 12.2266 11.6712 12.2787 11.1416 12.9269 12.6045 12.8088 13.2271 12.74 12.7078 9.90821 13.0719 12.9827 12.3092 12.6914 12.5537 11.8808 12.0094 11.9889 11.215 12.0347 11.2126 A0A0D3S156 A0A0D3S156_PIG Periphilin-1 splice variant 2 PPHLN1 Sus scrofa domesticus (domestic pig) negative regulation of DNA-templated transcription [GO:0045892] AYRRDEMWSEGR 0.99239 9.403 0 0 0 0 6.50056 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4.88245 0 0 0 6.60729 6.01821 0 0 0 0 7.90725 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A0D3S1L5 A0A0D3S1L5_PIG Periphilin-1 splice variant 1 PPHLN1 Sus scrofa domesticus (domestic pig) negative regulation of DNA-templated transcription [GO:0045892] AGASYKR 0.97482 315.13 12.7851 12.3141 12.8828 13.318 13.164 11.3881 12.9443 13.2971 13.0186 12.9571 13.2167 13.0675 14.1228 13.4517 13.9464 11.7983 12.8352 13.111 12.5863 10.925 12.6748 12.2912 13.0524 12.7806 12.8668 11.616 13.0519 12.4647 10.1848 12.7677 13.627 13.6881 14.0431 10.1662 12.8475 12.8151 12.5125 13.2131 13.8611 12.207 12.2652 12.262 13.5863 13.3419 13.3899 12.7469 12.3369 12.4793 13.1525 12.9001 12.7856 11.7007 12.396 12.2309 12.4392 12.3586 12.4175 11.8516 11.6859 11.585 11.309 11.4455 10.4342 A0A0D4CYJ6 A0A0D4CYJ6_PIG Receptor protein-tyrosine kinase (EC 2.7.10.1) ERBB2 Sus scrofa domesticus (domestic pig) ERBB signaling pathway [GO:0038127]; phosphorylation [GO:0016310]; regulation of cell population proliferation [GO:0042127] cytoplasm [GO:0005737]; ruffle membrane [GO:0032587] ATP binding [GO:0005524]; transmembrane receptor protein tyrosine kinase activity [GO:0004714] ACPPCSPACK 0.96479 311.36 10.2984 10.7198 10.4746 11.1511 11.834 11.464 10.8246 10.8707 8.6978 9.64731 12.2486 12.2707 11.5004 12.1297 8.89833 11.4508 9.77187 10.3554 11.0572 10.3384 11.3202 11.5359 10.6194 11.0734 8.92867 10.4375 11.6954 0 12.2946 10.6953 11.5508 11.8309 9.64695 9.29439 10.4609 11.765 10.8571 10.2868 10.5681 9.44313 9.47393 10.0761 7.50803 10.827 11.1693 11.8064 8.20291 9.44501 9.04532 10.0337 9.2754 11.3312 8.90542 11.2444 7.41768 8.77821 10.0592 5.71784 8.07414 5.54337 0 8.76308 5.16245 A0A0P0CMB5 A0A0P0CMB5_PIG "Dihydroorotate dehydrogenase (quinone), mitochondrial (DHOdehase) (EC 1.3.5.2)" dhodh Sus scrofa domesticus (domestic pig) 'de novo' pyrimidine nucleobase biosynthetic process [GO:0006207]; 'de novo' UMP biosynthetic process [GO:0044205] mitochondrial inner membrane [GO:0005743] dihydroorotate dehydrogenase (quinone) activity [GO:0106430] AGASLVQLYTALTFR 0.95037 131.12 11.5094 11.1258 11.295 8.22506 11.0787 10.8421 10.7612 10.8893 8.39708 10.9423 12.2445 9.34554 10.1773 11.4009 12.9366 11.3527 12.3274 11.2567 12.8097 9.42274 10.0296 11.8118 12.0821 11.1706 11.8229 10.3346 11.8847 8.41945 12.4877 0 11.8482 9.81746 11.7502 5.75443 8.14272 0 8.98419 8.49366 10.4351 9.15264 2.98346 7.87762 9.41513 7.69244 9.29485 12.1189 9.63677 9.06897 10.5211 10.1961 9.88474 9.8443 10.8268 11.0643 9.98328 10.0058 9.60947 7.86357 10.361 9.29303 8.20682 8.28545 10.3044 A0A140KFW8 A0A140KFW8_PIG Serum amyloid A-2 protein SAA2 Sus scrofa domesticus (domestic pig) QSFVGEAYE 0.99967 4.0128 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 9.20474 6.17167 9.10415 0 0 0 0 9.17879 8.76852 0 7.60785 7.88911 8.25673 0 8.11551 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A160EE36 A0A160EE36_PIG NADH-ubiquinone oxidoreductase chain 4L (EC 7.1.1.2) ND4L Sus scrofa domesticus (domestic pig) ATP synthesis coupled electron transport [GO:0042773] mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469] NADH dehydrogenase (ubiquinone) activity [GO:0008137] PLVYMNIIVAFAIALAGLLMYR 0.9966 4.9525 0 0 0 0 0 0 0 8.38845 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A172JU18 A0A172JU18_PIG Cytochrome b CYTB Sus scrofa domesticus (domestic pig) membrane [GO:0016020]; mitochondrion [GO:0005739] electron transfer activity [GO:0009055] LGGVLALMASILILILMPMLHTSK 0.99373 9.7682 0 0 6.27495 0 7.48382 0 0 0 0 0 0 0 0 0 8.34029 0 0 0 0 5.16748 0 0 4.66221 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6.35002 0 0 0 0 0 8.40263 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A172JU23 A0A172JU23_PIG Cytochrome b CYTB Sus scrofa domesticus (domestic pig) membrane [GO:0016020]; mitochondrion [GO:0005739] electron transfer activity [GO:0009055] GMMFRPLSQCLFWMLVADLIT 0.99269 9.6941 8.25323 0 0 7.0247 0 0 0 0 0 0 0 0 0 0 0 0 0 8.79054 0 0 0 0 0 7.77959 0 0 0 0 0 0 0 0 0 0 0 0 0 5.9479 0 0 0 0 0 4.01516 0 0 0 0 0 9.79339 0 0 0 5.87487 0 0 0 0 0 0 0 0 0 A0A1B3B5W0 A0A1B3B5W0_PIG Heat shock protein beta-2 HSPB2 Sus scrofa domesticus (domestic pig) MSGRSVPHAHPATTEYEFANPSR 0.99183 14.215 0 8.33069 0 0 0 0 0 0 0 0 0 0 0 0 9.45321 0 0 0 0 0 0 0 0 0 0 0 7.42626 0 0 0 0 8.06975 0 0 0 8.34261 0 0 0 0 0 0 0 0 7.04876 6.25999 0 0 0 0 0 0 0 0 5.99318 0 0 0 0 0 0 7.56003 0 A0A1B3B5W3 A0A1B3B5W3_PIG 27 kDa heat shock protein 1 HspB1 Sus scrofa domesticus (domestic pig) cytoplasm [GO:0005737]; nucleus [GO:0005634] DGVVEIT 0.99385 27.418 0 8.6392 0 0 0 9.6556 0 0 0 0 0 0 0 8.93281 0 0 0 0 0 0 0 7.29398 0 7.66945 0 0 0 0 0 0 0 0 9.87421 0 0 0 8.19205 0 0 0 0 7.3353 0 0 0 10.1619 0 0 9.16998 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A1D8BBG5 A0A1D8BBG5_PIG Cysteine-rich intestinal protein 1 CRIP1 Sus scrofa domesticus (domestic pig) cellular response to antibiotic [GO:0071236]; cellular response to UV-B [GO:0071493]; intrinsic apoptotic signaling pathway in response to DNA damage [GO:0008630]; response to zinc ion [GO:0010043] cytoplasm [GO:0005737] peptide binding [GO:0042277]; zinc ion binding [GO:0008270] CPKCNKEVYFAER 0.97623 39.961 0 7.37678 6.86468 9.73696 9.26447 8.46589 0 0 8.8021 10.0318 7.84078 7.85842 0 0 9.31084 0 0 0 5.68364 0 0 0 0 0 0 0 0 0 6.44831 7.39661 0 0 7.63445 9.43486 5.79228 0 0 0 8.83646 7.21208 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6.81839 6.09946 0 0 0 7.76168 0 4.94186 A0A1D8BBG9 A0A1D8BBG9_PIG Interleukin 22 Sus scrofa domesticus (domestic pig) extracellular region [GO:0005576] DIVKKLGESGEIK 0.96579 64.732 0 10.7364 6.426 0 12.046 0 0 0 8.38401 5.39256 9.65746 10.4292 10.643 9.30841 9.56007 6.82069 8.11884 0 0 6.8674 9.43233 5.64429 10.8213 11.1628 0 6.95675 0 0 0 0 11.9878 5.39451 9.28269 4.28385 5.81186 8.89042 8.30319 0 0 5.22813 6.31839 9.43881 0 0 0 10.6373 0 0 0 8.67384 7.41134 7.08884 0 0 6.22392 0 0 7.26416 0 0 7.46164 6.26059 7.50486 A0A1L4APN6 A0A1L4APN6_PIG Insulin-like growth factor binding protein 7 splice variant IGFBP7-814 IGFBP7 Sus scrofa domesticus (domestic pig) regulation of cell growth [GO:0001558] extracellular region [GO:0005576] insulin-like growth factor binding [GO:0005520] AASLRAESR 0.96473 80.463 0 10.7479 0 8.36877 0 0 10.2719 6.73742 6.42883 0 7.99418 2.20345 0 7.46818 10.3045 0 7.59813 0 0 10.1752 4.5302 6.13044 10.0146 6.71672 0 0 0 8.73213 10.4341 10.1447 8.13484 10.3502 0 0 0 8.5018 10.4657 8.21626 0 10.5805 0 0 5.70786 10.2129 0 10.3217 0 10.0814 6.44614 0 8.42253 5.93168 5.75564 0 4.4161 0 0 7.5697 10.7566 10.9757 0 5.792 0 A0A1P8P029 A0A1P8P029_PIG Interferon-alpha-8 IFNa8 Sus scrofa domesticus (domestic pig) defense response to virus [GO:0051607] extracellular space [GO:0005615] cytokine activity [GO:0005125]; cytokine receptor binding [GO:0005126] AEVMRAFSSSTNLQDR 0.98604 32.707 6.15393 0 8.12453 6.87713 7.21306 10.0896 0 0 0 8.81842 6.37095 0 8.03353 0 0 9.14499 9.83627 0 7.16289 6.43314 0 0 0 7.31841 5.11894 7.12701 0 0 0 10.0296 6.06035 0 0 7.11749 0 0 0 7.27361 0 5.96606 6.52824 0 0 0 0 5.21054 0 0 0 6.7849 0 0 0 0 0 0 0 6.13523 0 0 0 0 0 A0A1S7J1Y9 A0A1S7J1Y9_PIG Alpha2 chain of type I collagen COL1A2 Sus scrofa domesticus (domestic pig) collagen trimer [GO:0005581] extracellular matrix structural constituent [GO:0005201] AGEDGHPGKPGRPGER 0 323.31 13.2457 12.9238 12.7497 14.4286 13.5012 13.8045 14.0578 13.2629 13.2915 12.333 12.6444 12.7165 13.1188 13.0837 13.005 12.1209 13.6875 12.1474 12.7497 13.1715 13.6331 13.9581 14.1131 13.2279 10.9841 12.4162 12.1552 12.4465 5.16792 12.9892 12.1236 13.2809 10.666 10.7944 9.5391 8.26852 11.7714 0 11.2664 8.99277 9.34207 0 11.3647 9.11744 9.24686 9.05368 8.47172 10.8468 6.57051 8.83457 12.1303 9.34321 9.90775 10.4534 8.99166 11.1904 9.87869 8.54778 7.77386 8.52384 6.7097 7.52591 7.88557 A0A1S7J210 A0A1S7J210_PIG Alpha1 chain of type I collagen COL1A1 Sus scrofa domesticus (domestic pig) collagen trimer [GO:0005581]; extracellular region [GO:0005576] extracellular matrix structural constituent [GO:0005201]; metal ion binding [GO:0046872] ADDANVVR 0 323.31 13.9138 14.3587 14.0577 15.0846 15.2123 13.7096 14.965 15.8164 15.1128 14.9084 14.646 14.3624 15.1976 15.315 14.898 14.4718 14.4629 14.467 14.5097 14.6913 14.8286 15.05 15.3554 15.1907 14.3206 14.493 14.3721 9.9847 12.1807 12.3921 13.4264 11.5676 13.6907 13.151 12.8076 9.32791 12.6016 13.1299 9.0096 6.97659 10.3162 11.4331 9.24748 9.36159 10.4115 12.4073 12.3493 13.008 12.8347 12.3985 9.61149 7.50993 10.3783 11.977 10.6769 10.9427 10.7828 9.04305 9.71735 10.8351 9.75686 9.46956 10.3689 A0A218PI30 A0A218PI30_PIG Exportin 1 XPO1 Sus scrofa domesticus (domestic pig) protein export from nucleus [GO:0006611] cytoplasm [GO:0005737]; nucleus [GO:0005634] nuclear export signal receptor activity [GO:0005049]; small GTPase binding [GO:0031267] AHWKFLK 0.92962 279.5 11.6378 10.5945 9.31007 11.8598 11.1133 12.1492 10.8014 11.24 10.5951 7.45179 8.77033 10.444 9.23788 11.8874 12.8219 10.8375 8.34824 9.79996 7.40011 8.36501 13.3014 10.9559 9.72865 10.2401 13.0757 8.37003 9.29122 8.15071 10.3452 9.23774 10.9898 11.7181 8.02674 0 11.3688 8.39253 9.14417 9.01033 0 10.4303 9.41642 10.7625 8.09708 10.0703 8.48993 8.63278 5.72963 4.60763 11.5387 9.95012 7.29462 8.93422 8.23055 6.35364 11.8509 8.13273 10.9335 5.75593 7.82782 0 10.3306 8.28683 6.96475 A0A220NL95 A0A220NL95_PIG Y-linked ubiquitously transcribed tetratricopeptide repeat protein UTY Sus scrofa domesticus (domestic pig) ASGETKESSLSLTTEEKEALSGMDSR 0.98548 31.391 0 7.36973 9.00121 0 11.0798 11.665 0 11.9863 11.0845 11.856 3.86324 0 11.0118 10.3487 0 0 0 6.80168 10.8976 11.1915 0 0 3.58183 0 10.5523 0 11.5592 5.57386 0 7.03276 0 0 0 0 5.61055 0 0 9.14593 0 9.51379 9.6774 0 0 0 0 10.1807 8.70539 0 0 4.20711 0 0 0 0 0 0 9.11463 0 0 0 0 0 0 A0A220QT48 A0A220QT48_PIG Angiotensin-converting enzyme (EC 3.4.-.-) ACE2 Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] apical plasma membrane [GO:0016324]; cilium [GO:0005929]; cytoplasm [GO:0005737]; extracellular region [GO:0005576] carboxypeptidase activity [GO:0004180]; metal ion binding [GO:0046872]; metallopeptidase activity [GO:0008237]; peptidyl-dipeptidase activity [GO:0008241] AISMSRSR 0.98606 32.585 0 6.44258 4.20672 0 0 0 8.37391 0 10.4358 0 8.04374 7.29205 0 0 0 7.73186 0 0 8.12148 0 0 6.53619 7.42139 7.44915 0 0 0 0 0 10.5045 7.46858 0 0 7.41244 0 0 4.16848 0 0 7.00439 12.5472 0 0 0 0 5.07095 5.30564 0 4.91667 4.22843 0 3.6248 0 0 0 4.80612 0 3.75638 10.9078 4.74093 0 0 0 A0A344X2S3 A0A344X2S3_PIG HTRA2 serine protease HTRA2 Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] serine-type endopeptidase activity [GO:0004252] AALRAGR 0.95472 156.57 8.1127 8.99529 10.4909 8.92905 10.2636 9.70051 10.9651 11.3139 14.255 0 9.66217 7.86071 0 10.4455 13.502 10.8285 0 7.12216 6.1148 9.3881 5.21331 14.1095 10.5538 11.5621 10.5193 0 7.35562 9.30342 8.90689 7.21839 12.3472 7.1418 7.50914 10.8273 0 6.7003 10.6562 7.08289 8.8913 10.2511 10.1464 7.68895 8.18775 0 8.2181 0 9.23091 9.88602 9.7889 9.61243 9.76489 11.317 8.89812 6.97315 8.75535 11.8184 11.9927 9.6808 10.3726 8.22964 0 10.9196 5.6646 A0A344X2S4 A0A344X2S4_PIG Sodium/potassium-transporting ATPase subunit alpha ATP1A4 Sus scrofa domesticus (domestic pig) plasma membrane [GO:0005886] ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; metal ion binding [GO:0046872]; P-type potassium transmembrane transporter activity [GO:0008556] AAVPDAVSK 0 323.31 10.5781 7.40863 9.68979 11.9091 10.3559 11.6272 11.8205 7.37808 11.1473 11.5962 11.4258 11.0084 13.6608 13.08 11.4915 10.5092 13.0083 11.1737 10.2374 11.325 11.0066 11.3063 11.3109 13.5071 10.973 9.8248 10.2279 10.5939 12.4953 5.95882 8.67705 11.1798 11.4312 10.0258 10.4277 10.8961 9.05721 0 11.5904 11.5987 9.19751 9.0698 10.7602 0 10.9949 10.0836 9.72717 9.75096 10.6809 9.77132 11.3273 0 10.7664 8.11489 11.5281 9.93829 11.1631 8.67331 10.6015 10.0635 0 8.66576 0 A0A5K0UAN1 A0A5K0UAN1_PIG C-type lectin domain family 4 member A-like mRNA variant X4.2 clec4a Sus scrofa domesticus (domestic pig) membrane [GO:0016020] carbohydrate binding [GO:0030246] ALECMKENLTMEAVHGMR 0.99327 13.988 0 0 0 0 0 0 0 0 0 8.48047 0 0 0 0 0 0 8.66587 0 0 4.59329 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4.73682 0 0 0 0 0 0 0 0 0 5.7765 0 0 0 8.01391 0 0 0 0 0 0 A0A5K0UAP7 A0A5K0UAP7_PIG C-type lectin domain family 4 member A-like mRNA variant X4.1 clec4a Sus scrofa domesticus (domestic pig) membrane [GO:0016020] carbohydrate binding [GO:0030246] AEQDFIIQK 0.99594 4.8606 0 0 0 0 0 7.98003 0 0 0 0 0 0 0 0 0 0 0 8.14965 0 0 6.70072 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6.78633 0 0 0 0 0 0 6.90893 0 0 0 0 0 0 A0A5K0UBV1 A0A5K0UBV1_PIG C-type lectin domain family 4 member A-like mRNA variant X2.2 (C-type lectin domain family 4 member A-like mRNA variant X2.4) clec4a Sus scrofa domesticus (domestic pig) carbohydrate binding [GO:0030246] MVFSPLPLLSTAFAR 0.9924 9.3432 0 0 0 0 0 8.21854 0 0 0 0 0 0 8.12681 0 0 0 0 0 0 0 0 6.39924 5.6528 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6.74214 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A650DFJ0 A0A650DFJ0_PIG argininosuccinate synthase (EC 6.3.4.5) (Citrulline--aspartate ligase) ASS1 Sus scrofa domesticus (domestic pig) arginine biosynthetic process [GO:0006526] argininosuccinate synthase activity [GO:0004055]; ATP binding [GO:0005524] FAELVYTGFWHSPECEFVRHCIAK 0.98828 30.679 0 0 0 0 6.32826 0 0 0 0 9.05547 8.23563 0 0 0 0 0 9.49482 0 0 0 0 0 0 0 0 8.27789 0 0 0 0 0 9.48138 0 0 0 0 0 0 0 8.62388 0 7.86487 0 0 0 8.06528 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.66782 A0A650DFJ7 A0A650DFJ7_PIG Argininosuccinate synthase 1 ASS1 Sus scrofa domesticus (domestic pig) arginine biosynthetic process [GO:0006526] argininosuccinate synthase activity [GO:0004055] QGLGLKFAELVYT 0.99694 4.9588 0 0 0 7.32841 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.90923 0 0 0 0 0 0 6.32912 5.61686 0 5.94792 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A7M4BIS4 A0A7M4BIS4_PIG Nicotinamide phosphoribosyltransferase (NAmPRTase) (EC 2.4.2.12) Sus scrofa domesticus (domestic pig) circadian regulation of gene expression [GO:0032922]; NAD biosynthetic process [GO:0009435] cytoplasm [GO:0005737]; extracellular space [GO:0005615]; nucleus [GO:0005634] cytokine activity [GO:0005125]; nicotinamide phosphoribosyltransferase activity [GO:0047280] CSYVVTNGLGINVFK 0.92759 215.09 8.59347 7.7106 12.5025 14.2369 11.0011 14.6017 11.0974 11.8426 10.9819 9.48452 8.87486 14.2494 10.4954 9.13571 10.2354 14.701 10.717 16.1675 9.45333 8.97882 13.5555 9.00593 11.2494 15.5427 9.99209 9.48315 9.06961 9.83594 8.81887 9.06504 10.2003 9.81841 9.47881 9.98114 9.46305 8.5238 8.78441 8.45162 9.22978 13.2238 13.751 7.60266 9.61137 9.42007 7.01592 9.62943 7.69725 9.56643 9.45212 8.8708 7.11082 9.74361 8.42068 9.66913 10.9025 6.87578 9.23551 9.93981 13.4355 7.21878 11.0433 12.5013 8.81638 A0A7R8NBU6 A0A7R8NBU6_PIG MHC class II antigen SLA-DQB1 Sus scrofa domesticus (domestic pig) adaptive immune response [GO:0002250]; antigen processing and presentation of peptide or polysaccharide antigen via MHC class II [GO:0002504] MHC class II protein complex [GO:0042613] AELDTVCKHNYQIEEGTTLQR 0.97053 49.951 8.03111 7.43471 0 0 9.31445 0 0 9.59813 0 8.13545 0 6.79233 9.18822 0 0 9.14583 13.858 7.10077 9.75914 7.23678 0 9.18088 0 7.42038 9.24474 8.40523 6.96255 0 7.3249 13.668 0 7.89845 0 0 0 0 6.82171 6.17089 0 0 0 0 0 0 0 6.55568 6.76593 5.24161 0 0 8.60366 0 0 8.39313 0 6.45704 0 0 3.47586 0 0 0 10.1455 A0A7R8NBV5 A0A7R8NBV5_PIG MHC class I antigen SLA-2 Sus scrofa domesticus (domestic pig) antigen processing and presentation of peptide antigen via MHC class I [GO:0002474] lumenal side of endoplasmic reticulum membrane [GO:0098553]; MHC class I protein complex [GO:0042612]; phagocytic vesicle membrane [GO:0030670] AEPPKTHVTR 0.96158 125.3 0 11.5528 0 15.1383 0 9.99081 15.245 7.54226 15.1796 14.6183 14.5381 8.73213 14.6904 15.0363 14.7159 14.8139 14.9928 0 0 14.1297 9.38963 15.2499 9.04726 15.275 14.057 9.00293 0 6.68902 0 12.3045 13.8713 14.2556 8.69627 3.32955 8.0983 6.06994 0 6.99921 13.3792 7.60962 9.70451 0 12.9126 9.65152 9.72998 12.7484 8.73958 12.88 13.9258 13.5187 13.7271 10.445 10.4341 10.5147 10.637 10.574 10.5083 8.57505 0 8.81874 6.08155 5.27352 7.22516 A0A7R8NBW9 A0A7R8NBW9_PIG MHC class I antigen SLA-1 Sus scrofa domesticus (domestic pig) antigen processing and presentation of peptide antigen via MHC class I [GO:0002474] lumenal side of endoplasmic reticulum membrane [GO:0098553]; MHC class I protein complex [GO:0042612]; phagocytic vesicle membrane [GO:0030670] AQWIQQEGPEYWDR 0.9659 42.522 7.05929 8.33575 0 8.33981 7.8899 9.86899 0 0 6.45704 9.21917 0 0 8.87015 0 0 0 6.75074 6.96648 0 6.67271 0 3.63215 0 0 0 8.67179 0 6.41298 0 0 6.35094 0 8.78869 0 6.53338 0 6.66917 0 0 0 8.18869 0 0 0 0 8.80184 0 0 0 0 9.52529 0 0 0 6.6844 0 0 0 0 0 0 0 0 A0A7R8NC15 A0A7R8NC15_PIG MHC class I antigen SLA-1 Sus scrofa domesticus (domestic pig) antigen processing and presentation of peptide antigen via MHC class I [GO:0002474] lumenal side of endoplasmic reticulum membrane [GO:0098553]; MHC class I protein complex [GO:0042612]; phagocytic vesicle membrane [GO:0030670] AQWIQQEGQEYWDR 0.9938 9.0243 0 0 0 11.7977 11.6176 11.4497 10.3773 0 0 0 0 9.13227 0 0 0 0 9.94396 10.0419 0 8.47857 0 9.64721 9.73005 0 0 0 0 10.5158 10.4807 10.3419 8.74049 0 0 0 0 0 0 0 0 0 10.5326 10.3032 0 0 0 0 0 0 0 0 0 0 0 9.1767 0 0 0 0 0 0 10.8372 0 10.4023 A0A7R8NC20 A0A7R8NC20_PIG MHC class II antigen SLA-DQB1 Sus scrofa domesticus (domestic pig) adaptive immune response [GO:0002250]; antigen processing and presentation of peptide or polysaccharide antigen via MHC class II [GO:0002504] MHC class II protein complex [GO:0042613] AEALNHHNLLVCAVTDFYPSQEMPVK 1.0007 18.986 0 0 6.89869 0 7.4536 0 0 0 5.13204 3.29196 0 0 0 0 0 0 5.88694 0 5.19767 0 0 0 0 5.78678 0 0 0 0 6.4424 4.13512 0 0 7.06803 0 0 0 0 0 0 0 0 0 0 0 0 5.31383 0 0 0 0 2.81221 0 0 0 0 0 0 0 0 0 0 0 0 A0A7R8NC23 A0A7R8NC23_PIG MHC class I antigen SLA-1 Sus scrofa domesticus (domestic pig) antigen processing and presentation of peptide antigen via MHC class I [GO:0002474] lumenal side of endoplasmic reticulum membrane [GO:0098553]; MHC class I protein complex [GO:0042612]; phagocytic vesicle membrane [GO:0030670] TAVSRLDLGDSR 0.99833 4.1375 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.8454 0 11.2337 0 0 11.4323 10.9432 10.918 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.25068 0 0 0 0 0 0 0 0 0 8.15076 0 0 0 0 0 0 0 0 0 0 0 A0A7R8NC35 A0A7R8NC35_PIG MHC class I antigen SLA-1 Sus scrofa domesticus (domestic pig) antigen processing and presentation of peptide antigen via MHC class I [GO:0002474] lumenal side of endoplasmic reticulum membrane [GO:0098553]; MHC class I protein complex [GO:0042612]; phagocytic vesicle membrane [GO:0030670] APWIQQEGQDYWDQETQITQR 0.99418 8.5507 0 0 0 0 0 7.15137 0 0 0 7.40088 0 7.79181 0 0 0 0 0 0 0 0 0 0 0 0 0 5.4721 0 0 0 0 0 0 0 0 0 0 7.3746 0 0 0 0 6.9404 0 0 0 6.24342 0 0 0 6.57793 0 0 0 6.58565 0 0 0 6.14276 0 0 0 0 0 A0A7R8NC40 A0A7R8NC40_PIG MHC class I antigen SLA-1 Sus scrofa domesticus (domestic pig) antigen processing and presentation of peptide antigen via MHC class I [GO:0002474] lumenal side of endoplasmic reticulum membrane [GO:0098553]; MHC class I protein complex [GO:0042612]; phagocytic vesicle membrane [GO:0030670] APWIQQEGQEYWDR 0.99544 12.729 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.60622 0 0 0 0 0 0 0 9.00537 8.52137 5.4956 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5.49355 0 0 0 9.54533 0 0 0 0 A0A7R8NC79 A0A7R8NC79_PIG MHC class I antigen SLA-1 Sus scrofa domesticus (domestic pig) antigen processing and presentation of peptide antigen via MHC class I [GO:0002474] lumenal side of endoplasmic reticulum membrane [GO:0098553]; MHC class I protein complex [GO:0042612]; phagocytic vesicle membrane [GO:0030670] APWIQQEGQDYWDR 0.96156 59.538 8.91319 10.1101 7.25663 8.16284 6.38786 0 11.5594 7.02259 8.65059 6.2303 0 8.1192 9.33224 10.084 10.2361 0 6.2418 0 7.60363 0 0 0 6.25944 11.1398 0 6.61104 0 0 0 6.25603 10.0475 6.27019 9.08146 0 5.33807 0 0 0 0 0 0 6.39573 8.39455 0 6.6595 7.50835 0 0 0 7.99283 9.12743 5.63538 8.73203 0 0 8.65728 5.53506 0 0 0 0 5.53872 0 A0A7R8NC97 A0A7R8NC97_PIG MHC class I antigen SLA-2 Sus scrofa domesticus (domestic pig) CSVSFPISR 0.96596 44.272 0 0 0 0 8.1497 0 9.10345 0 8.74762 8.33302 8.81234 7.91612 7.47224 9.74903 6.77057 11.3823 8.85219 6.56279 0 6.89797 8.66359 0 0 0 0 11.0746 0 0 4.13972 0 5.22501 0 7.64487 5.76956 6.25527 0 0 0 8.57194 0 6.76924 0 0 0 0 0 0 0 0 9.36124 9.80106 0 10.1132 6.23076 6.06959 0 6.23984 0 6.23276 0 0 0 5.14409 A0A7R8NCC0 A0A7R8NCC0_PIG MHC class I antigen SLA-1 Sus scrofa domesticus (domestic pig) antigen processing and presentation of peptide antigen via MHC class I [GO:0002474] lumenal side of endoplasmic reticulum membrane [GO:0098553]; MHC class I protein complex [GO:0042612]; phagocytic vesicle membrane [GO:0030670] APWIEQEGPEYWDR 0.9927 27.536 0 0 0 10.1223 0 0 0 0 0 6.626 0 9.22137 0 0 0 0 0 0 0 0 0 0 0 0 0 8.8346 0 0 0 0 8.7087 0 0 0 0 0 0 0 0 0 0 0 9.267 0 0 0 0 0 9.24198 0 0 0 0 0 0 0 0 0 8.24883 0 0 0 0 A0A7R8NCX7 A0A7R8NCX7_PIG MHC class I antigen SLA-1 Sus scrofa domesticus (domestic pig) antigen processing and presentation of peptide antigen via MHC class I [GO:0002474] lumenal side of endoplasmic reticulum membrane [GO:0098553]; MHC class I protein complex [GO:0042612]; phagocytic vesicle membrane [GO:0030670] APWIQQEGQDYWDQETQNTK 0.99888 23.042 5.64218 0 7.45047 0 9.64142 0 0 0 0 0 0 0 7.96428 0 0 0 0 0 6.14413 0 0 10.2599 9.51258 0 0 0 0 0 0 6.52464 0 5.75109 0 6.69516 0 2.82481 0 0 0 0 0 0 0 7.53099 6.91456 0 0 0 0 0 0 0 0 0 0 0 6.61005 0 0 0 0 0 0 A0A7R8NFR9 A0A7R8NFR9_PIG MHC class I antigen SLA-1 Sus scrofa domesticus (domestic pig) GRTIGIGRHR 0.98236 34.076 10.2951 10.333 10.3646 11.6806 11.8351 11.6409 0 11.1737 11.6804 11.3523 10.7947 10.8521 11.5908 11.4098 11.4557 8.81388 11.4439 11.4235 11.0571 10.2564 10.2677 11.3877 13.2506 11.6812 10.1929 9.34529 0 0 0 8.0607 10.8311 11.0101 11.0278 0 9.33351 0 0 0 7.41996 9.6746 0 0 10.6628 9.51861 11.3004 10.0501 0 9.90244 10.6812 10.7717 10.703 9.69139 9.58695 9.81984 0 9.03023 9.08154 0 8.47723 8.52054 8.39133 8.14721 7.79259 A0A7R8NFT0 A0A7R8NFT0_PIG MHC class I antigen SLA-1 Sus scrofa domesticus (domestic pig) antigen processing and presentation of peptide antigen via MHC class I [GO:0002474] lumenal side of endoplasmic reticulum membrane [GO:0098553]; MHC class I protein complex [GO:0042612]; phagocytic vesicle membrane [GO:0030670] APWIQQEGQEYWDK 0.97697 37.405 7.58511 4.44493 6.51872 8.03733 0 0 0 0 0 0 0 0 0 0 0 0 0 5.57086 0 7.74086 0 8.07264 0 0 0 0 9.05319 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.39021 0 0 0 0 0 0 0 0 0 0 0 A0A7R8RIG9 A0A7R8RIG9_PIG MHC class I antigen SLA-1 Sus scrofa domesticus (domestic pig) FIAVGYVDDTQFR 0.99288 14.356 13.9595 13.8943 13.9131 11.6504 14.6989 11.3757 14.5041 14.2305 14.4217 13.9987 13.8172 10.9122 14.5451 14.7098 11.6364 14.0257 14.0632 14.0381 13.338 13.0889 12.675 13.9315 13.6275 13.7156 12.135 11.1749 11.9554 13.4644 13.3902 13.4916 14.7115 15.0065 14.8867 12.9205 12.8651 12.4322 13.574 13.5748 12.9821 13.5012 13.5696 13.4671 13.283 12.8479 13.0485 0 13.4809 0 12.7472 12.8213 12.7084 13.3476 0 13.5288 11.3225 11.3255 0 11.5779 11.1497 11.104 0 0 5.05948 A0A7R8RIS7 A0A7R8RIS7_PIG MHC class I antigen SLA-1 Sus scrofa domesticus (domestic pig) GTPRFISK 0.9945 8.8959 0 0 0 0 9.92339 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.73721 0 0 0 0 0 0 0 0 0 0 0 0 9.22542 0 0 0 0 0 0 0 0 0 0 9.01355 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A7R8RJR0 A0A7R8RJR0_PIG MHC class I antigen SLA-1 Sus scrofa domesticus (domestic pig) antigen processing and presentation of peptide antigen via MHC class I [GO:0002474] lumenal side of endoplasmic reticulum membrane [GO:0098553]; MHC class I protein complex [GO:0042612]; phagocytic vesicle membrane [GO:0030670] APWIQQEGQDYWDEETRKVK 1.0007 22.149 9.4177 0 6.81545 0 0 0 0 0 0 9.29577 0 0 10.0132 0 0 0 0 0 0 0 8.42987 0 0 0 0 0 0 0 0 0 7.95768 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 9.0136 0 A0A7R8RJY0 A0A7R8RJY0_PIG MHC class I antigen SLA-2 Sus scrofa domesticus (domestic pig) antigen processing and presentation of peptide antigen via MHC class I [GO:0002474] lumenal side of endoplasmic reticulum membrane [GO:0098553]; MHC class I protein complex [GO:0042612]; phagocytic vesicle membrane [GO:0030670] APWIEKEGQEYWDR 0.96931 40.85 0 0 0 0 7.2948 0 10.0493 0 0 7.51286 0 0 0 9.07772 0 6.24869 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.96041 8.21621 0 0 0 0 0 0 0 0 0 0 4.62486 0 0 7.91839 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A7R8RJZ2 A0A7R8RJZ2_PIG MHC class I antigen SLA-1 Sus scrofa domesticus (domestic pig) antigen processing and presentation of peptide antigen via MHC class I [GO:0002474] lumenal side of endoplasmic reticulum membrane [GO:0098553]; MHC class I protein complex [GO:0042612]; phagocytic vesicle membrane [GO:0030670] APWIQQEGQDYWDQETQK 1.0011 18.109 0 0 0 0 5.30148 0 0 0 4.00594 0 0 0 0 0 0 0 0 0 0 6.86617 0 0 0 0 7.97103 0 0 0 9.76271 8.89791 0 0 0 0 0 0 7.19308 0 0 0 9.80608 0 0 0 0 0 0 0 0 0 0 0 6.38697 0 0 0 0 0 0 0 0 0 8.58725 A0A7R8RJZ9 A0A7R8RJZ9_PIG MHC class I antigen SLA-1 Sus scrofa domesticus (domestic pig) antigen processing and presentation of peptide antigen via MHC class I [GO:0002474] lumenal side of endoplasmic reticulum membrane [GO:0098553]; MHC class I protein complex [GO:0042612]; phagocytic vesicle membrane [GO:0030670] DNAQTYRVNLK 0.99437 13.36 0 0 0 0 6.62091 0 0 0 0 0 7.34634 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.71524 0 0 0 0 0 0 0 0 0 0 0 8.44717 0 0 0 0 0 0 0 3.01437 0 0 0 0 0 0 0 6.89008 3.29569 0 0 0 A0A7R8RN08 A0A7R8RN08_PIG MHC class I antigen SLA-1 Sus scrofa domesticus (domestic pig) FDSDAPNPTEGAAGAVDTAGGAGVLG 0.99697 4.5373 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.57418 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A809VZS6 A0A809VZS6_PIG Uromodulin UMOD Sus scrofa domesticus (domestic pig) innate immune response [GO:0045087] apical plasma membrane [GO:0016324]; basolateral plasma membrane [GO:0016323]; ciliary membrane [GO:0060170]; extracellular region [GO:0005576]; side of membrane [GO:0098552] calcium ion binding [GO:0005509] CKPTCSGTRFR 0.95556 158.26 5.51828 7.19417 5.94263 8.29843 10.5214 8.12422 10.2947 7.32625 10.238 8.75529 8.24821 6.84034 8.35218 8.41777 6.9956 10.2082 9.83101 8.8703 6.08901 9.43575 9.0649 7.94474 10.2651 10.3579 0 0 0 9.1274 9.37819 7.90189 7.55865 7.95588 8.60988 5.53981 8.34061 5.58286 0 10.1258 8.60378 0 5.74459 0 7.42433 7.68391 8.00265 9.06145 7.55712 9.88586 8.96596 5.56721 0 0 7.60058 7.33825 0 10.5796 3.04979 7.65284 0 0 7.14629 6.34215 9.84412 A0A8B6PI35 A0A8B6PI35_PIG Mucin 1 Muc1 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] DAYHPMSEYPTYHTHGR 0.99925 23.072 0 0 5.94603 0 0 0 0 0 0 0 0 4.69816 10.1434 0 0 0 8.42412 7.79708 4.74373 0 0 0 0 0 0 0 0 0 0 0 0 9.44307 0 0 0 0 0 9.50361 0 0 6.51805 0 5.60493 0 0 0 8.63099 0 7.07938 0 0 0 0 0 0 8.77913 0 5.6735 0 0 0 0 0 A0A977SQJ4 A0A977SQJ4_PIG Cerebral dopamine neurotrophic factor CDNF Sus scrofa domesticus (domestic pig) extracellular region [GO:0005576] growth factor activity [GO:0008083] ACAEKTDYVNLIK 0.96842 91.116 7.24631 9.65723 10.5544 4.96056 7.98134 0 12.1127 0 10.118 0 5.03672 0 12.7927 0 0 0 3.55447 0 0 7.08428 10.8533 9.69194 14.1918 0 9.25524 6.43756 12.1319 9.98413 7.20496 9.27889 4.47242 10.3443 11.8815 10.8387 0 9.91253 12.783 12.1441 10.8583 10.4949 10.4845 11.2038 11.5049 10.5559 11.9129 0 12.0931 7.26003 11.3911 8.15568 0 5.12242 6.17323 12.1961 6.59464 6.90364 7.7845 8.22168 0 5.26944 5.07176 0 13.0082 A2THZ2 A2THZ2_PIG Albumin Sus scrofa domesticus (domestic pig) extracellular space [GO:0005615] lipid binding [GO:0008289]; metal ion binding [GO:0046872] AACLLPK 0 323.31 17.7858 17.657 17.6204 18.7139 19.6368 19.2926 19.6799 18.9595 19.0661 18.8651 18.8728 18.7697 18.875 19.3377 19.3162 19.1246 19.1909 19.049 17.1256 18.3123 18.0964 19.347 19.4074 19.3647 17.8188 17.3639 17.8972 16.6841 16.1077 16.4072 18.3955 17.4308 18.1234 15.663 16.1519 16.2067 17.4583 17.4037 17.4573 15.8092 14.2997 16.2266 15.5062 15.407 15.4942 16.9776 16.9792 16.9894 17.8671 17.9617 17.9999 16.6106 16.569 15.6491 16.3793 16.9223 15.9874 16.5722 16.3232 16.3357 15.3849 15.2291 15.2576 A2VBP0 A2VBP0_PIG Melanocortin 1 receptor MC1R Sus scrofa domesticus (domestic pig) AALPQHRDAAPR 0.95571 168.83 0 10.001 9.03254 8.70484 9.82764 6.96058 11.1351 11.1579 11.4456 0 6.71644 10.4047 9.13878 9.18738 9.6151 5.67322 7.56163 0 10.7325 11.595 0 6.66021 9.19365 10.8602 10.3993 5.52366 10.0551 10.8317 8.07382 9.66436 10.2184 8.48897 9.60491 10.0583 9.36944 0 13.6148 8.86419 0 8.44555 6.78346 5.66625 6.88069 10.6471 0 9.68436 9.27561 7.22362 14.8135 9.76014 8.66516 0 8.40297 9.38388 9.56272 7.15684 12.6171 10.8839 7.62117 5.65466 8.15502 0 0 A2VBP1 A2VBP1_PIG Melanocortin 1 receptor MC1R Sus scrofa domesticus (domestic pig) AAAAGGGRPGRPGRRGAAAGQCHGR 0.99384 8.5494 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.75315 0 0 0 0 0 0 0 0 4.18301 0 0 0 0 4.82263 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.32544 0 0 0 A3RLM8 A3RLM8_PIG Toll-like receptor 7 TLR7 Sus scrofa domesticus (domestic pig) activation of innate immune response [GO:0002218]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; regulation of macromolecule metabolic process [GO:0060255]; regulation of nitrogen compound metabolic process [GO:0051171]; regulation of primary metabolic process [GO:0080090]; signal transduction [GO:0007165] endoplasmic reticulum membrane [GO:0005789]; lysosome [GO:0005764]; phagocytic vesicle [GO:0045335] AKIKGYQR 0 323.31 13.8045 13.8468 13.918 14.6562 14.8292 14.6487 15.0165 15.2582 14.9874 14.1637 14.1095 14.0229 14.9858 15.1296 14.8901 13.8268 13.7752 13.7427 14.1977 14.6869 14.347 14.6352 14.7476 14.783 14.4881 13.822 14.4196 13.3046 13.5746 13.4924 14.1758 14.2957 14.7158 14.1898 13.849 14.15 14.7393 14.8785 14.7729 13.2988 13.171 13.0125 13.1031 13.0825 12.9694 14.1785 13.9204 14.1795 15.0151 14.7996 14.7376 12.2523 11.974 12.5016 13.7763 13.584 13.7997 12.4688 12.2282 12.3349 11.9104 11.9064 11.9618 B2CR55 B2CR55_PIG peptidylprolyl isomerase (EC 5.2.1.8) Sus scrofa domesticus (domestic pig) endoplasmic reticulum [GO:0005783] calcium ion binding [GO:0005509]; peptidyl-prolyl cis-trans isomerase activity [GO:0003755] DEKPRDK 0.95044 154.68 0 6.45562 6.65964 14.0198 8.96677 10.05 5.9735 7.44774 10.6079 13.6088 5.66129 11.1363 10.7903 5.70595 0 9.25668 9.30451 9.94202 9.92135 11.0056 9.9358 10.694 9.64823 8.85477 10.7355 0 9.43336 9.67696 0 4.07193 0 11.2046 13.3678 0 0 9.66936 8.54342 8.96339 5.89057 9.81711 7.9926 5.20906 0 0 0 10.3277 8.47934 9.28149 4.33428 0 13.4877 5.94434 8.01959 9.53004 7.2292 8.17408 0 0 0 4.38598 8.04751 7.84405 0 B4Y7M5 B4Y7M5_PIG CD44 Sus scrofa domesticus (domestic pig) DKHPSYSGSGIDDDEDFI 0.99183 14.237 8.32405 0 0 8.85362 0 0 8.51751 0 0 0 7.14965 0 0 0 8.72976 0 0 0 0 5.63474 9.07178 0 0 0 0 7.70224 0 9.11043 0 0 0 0 0 7.81025 0 0 7.31188 0 6.61178 8.29774 0 0 0 0 6.1006 0 8.52732 0 0 0 6.7137 0 0 8.96454 0 0 0 6.42215 0 0 0 0 0 B9ZUV0 B9ZUV0_PIG Cytochrome c oxidase subunit 2 COII Sus scrofa domesticus (domestic pig) mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469] copper ion binding [GO:0005507]; cytochrome-c oxidase activity [GO:0004129] ILYMMDEINNPALTVK 0.98416 32.262 0 8.06733 0 8.94351 0 0 0 0 0 0 8.80639 7.65878 8.96852 9.01842 0 0 0 0 6.11815 0 0 0 0 0 0 8.93861 0 0 0 9.5001 0 9.6353 10.1271 0 8.86929 8.54678 9.93108 0 10.5121 0 8.00416 0 7.80187 0 0 0 8.40011 8.34833 0 9.48456 0 7.43204 0 0 0 0 0 0 0 0 0 0 0 C4B7Q6 C4B7Q6_PIG Gap junction protein cx45 Sus scrofa domesticus (domestic pig) cell communication [GO:0007154] connexin complex [GO:0005922] AARSKPYAMR 0.95994 102.04 9.40901 8.0427 8.55186 9.47425 6.74174 11.067 7.33682 10.082 7.67758 0 6.91433 0 12.4535 11.3404 0 5.50646 8.94623 7.77867 7.69759 10.2677 8.13371 0 0 9.97699 9.24909 8.88411 0 8.79214 0 8.58387 9.43129 11.3841 11.258 6.2484 10.6151 0 10.4001 0 9.18475 9.4172 8.85403 9.90433 9.90385 7.69995 4.52469 7.14578 0 0 10.4815 10.6374 11.7782 5.54887 0 0 9.65891 7.94994 0 6.85524 0 6.36229 8.68919 0 0 C4PGL9 C4PGL9_PIG Mannan-binding lectin serine peptidase 2 Sus scrofa domesticus (domestic pig) "complement activation, classical pathway [GO:0006958]; innate immune response [GO:0045087]; proteolysis [GO:0006508]" extracellular region [GO:0005576] calcium ion binding [GO:0005509]; carbohydrate binding [GO:0030246]; serine-type endopeptidase activity [GO:0004252] AGYVLHR 0.93962 208.58 9.67726 6.84837 10.61 11.9491 7.13668 10.0912 10.3545 8.25016 11.0153 11.2737 8.41155 8.98524 11.7821 0 0 11.5895 10.0968 8.46561 8.49317 5.28081 6.96243 9.57429 12.1015 11.1575 11.0086 9.52511 9.47399 5.74327 0 7.6837 11.0595 10.1609 8.76577 0 3.6819 10.1333 7.05257 7.86888 9.92205 8.26285 9.87814 6.25378 12.1839 8.16466 5.56148 7.87418 10.0665 6.47792 0 9.12967 6.02634 0 9.63751 6.48183 9.75161 7.21655 9.40916 7.49273 8.41659 9.3443 8.0237 0 6.35669 C5JA71 C5JA71_PIG Occludin ocln Sus scrofa domesticus (domestic pig) bicellular tight junction assembly [GO:0070830] bicellular tight junction [GO:0005923]; plasma membrane [GO:0005886] APAKGRAGK 0.96935 183.15 10.2141 8.96653 10.7908 11.4891 10.5658 9.67101 9.91434 9.8384 10.4135 10.2778 13.0916 10.9763 12.1437 10.4929 10.8518 8.68965 11.2238 4.44751 9.75864 0 9.31488 12.7182 5.98696 10.4125 10.3473 5.64518 10.8304 8.05599 10.1073 9.54919 11.0893 10.7569 10.4924 9.16787 9.07588 9.16385 0 11.1785 5.06682 11.3466 7.17842 10.6815 10.7659 10.5969 10.3413 13.0488 9.73882 8.31216 0 9.29994 10.0656 11.2166 8.6034 10.7736 10.2469 7.02835 0 0 5.18998 8.68534 11.8844 6.59246 4.97251 D0G7F9 D0G7F9_PIG Ferrochelatase (EC 4.98.1.1) FECH Sus scrofa domesticus (domestic pig) heme biosynthetic process [GO:0006783] mitochondrial inner membrane [GO:0005743] "2 iron, 2 sulfur cluster binding [GO:0051537]; ferrochelatase activity [GO:0004325]" CQSGMAAAAAEAVQHAR 0.97179 178.48 12.1837 10.3604 10.069 12.4213 0 9.34094 11.0932 9.41958 9.22465 10.6608 12.2219 11.3917 12.1039 11.6119 12.3594 10.0411 6.58227 11.4381 11.3552 10.8204 11.9368 10.9273 10.6628 11.152 9.70591 5.19598 11.0638 11.0098 11.093 10.8933 5.45395 10.3061 11.9058 10.1551 9.42761 9.50128 12.4941 9.06496 10.3635 0 9.27165 8.7656 10.6822 8.21466 9.17113 11.3197 8.93746 9.05861 8.0072 11.236 7.88698 7.38033 9.05232 8.72035 8.46708 9.41832 10.5686 8.67094 9.4508 5.31886 7.10224 7.22429 8.63804 D3KVS6 D3KVS6_PIG NPC intracellular cholesterol transporter 2 (Epididymal secretory protein E1) NPC2 Sus scrofa domesticus (domestic pig) intracellular cholesterol transport [GO:0032367] extracellular region [GO:0005576] sterol binding [GO:0032934] DCGSGVGVIKEVNVNPCPTQPCQLHK 0.96591 42.48 0 0 0 0 0 0 11.5774 10.5638 0 7.15157 0 0 0 8.79019 10.6733 0 7.00023 0 0 11.8198 7.83687 0 7.31433 11.2909 9.97126 7.29921 0 8.54199 0 6.32952 0 10.4093 10.2959 5.7151 0 0 0 0 6.00025 0 0 0 0 0 0 7.57818 0 7.03672 9.17435 7.96058 9.66384 0 0 0 0 0 0 0 11.346 0 0 9.4718 0 D3UD03 D3UD03_PIG DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide DDX3Y Sus scrofa domesticus (domestic pig) GSGTRGR 1.0004 22.263 0 0 0 9.96557 0 0 0 0 0 0 0 0 6.78764 0 0 0 0 4.84333 7.86845 0 0 0 4.24952 9.01937 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6.70349 0 8.00315 0 0 8.05713 0 0 0 7.56818 0 0 0 0 8.42454 6.59643 0 0 0 0 7.32085 0 0 0 0 D3UD04 D3UD04_PIG DEAD box protein 3 DDX3Y Sus scrofa domesticus (domestic pig) AGSSRSGGGGHSSSR 1.0033 18.37 11.4607 0 0 0 12.3993 12.0967 0 7.09466 0 0 0 5.26258 0 11.9419 0 0 0 7.6686 0 0 0 12.2326 8.61923 12.4902 0 11.4887 11.7656 0 11.4413 0 12.7035 11.0205 3.85 11.908 0 11.907 0 10.0034 11.2829 10.6358 10.5221 0 0 0 0 11.5983 0 11.1424 0 4.74508 10.8574 10.1267 0 10.1883 0 0 0 0 0 7.92023 0 0 0 E1B1P3 E1B1P3_PIG Cytochrome b cytb Sus scrofa domesticus (domestic pig) respiratory electron transport chain [GO:0022904] mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469] electron transfer activity [GO:0009055]; metal ion binding [GO:0046872] GGFSVDK 0.99729 4.8728 0 6.34003 8.52137 0 6.2014 0 0 0 0 0 0 0 0 0 0 0 8.87061 0 0 0 0 0 8.61739 0 0 6.57043 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5.24477 0 0 6.90845 0 0 0 0 0 0 0 0 0 0 0 0 F8V416 F8V416_PIG Angiotensin-converting enzyme 2 (EC 3.4.17.23) ACE2 Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] apical plasma membrane [GO:0016324]; cilium [GO:0005929]; cytoplasm [GO:0005737]; extracellular region [GO:0005576] carboxypeptidase activity [GO:0004180]; metallopeptidase activity [GO:0008237]; peptidyl-dipeptidase activity [GO:0008241] AQNGNSSVGWNTDWTPYADQSIK 0.99257 13.929 0 0 0 0 0 0 0 0 9.44147 0 0 9.49249 0 0 0 0 0 0 0 0 0 0 0 0 0 3.24358 0 4.00189 0 0 0 0 8.40841 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 G0W2Z1 G0W2Z1_PIG "Troponin T, cardiac muscle (Cardiac muscle troponin T)" TNNT2 Sus scrofa domesticus (domestic pig) regulation of muscle contraction [GO:0006937] troponin complex [GO:0005861] AEQQRIR 0.99764 4.6864 9.83678 10.163 10.1189 0 0 0 0 0 10.4963 10.1692 0 0 0 0 0 0 0 0 0 0 9.81417 0 0 0 0 0 10.1972 0 0 0 0 0 0 0 0 0 9.78909 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 9.06199 0 0 0 8.24289 0 0 0 0 0 0 G5DU48 G5DU48_PIG Cytochrome c oxidase subunit 1 (EC 7.1.1.9) CO1 Sus scrofa domesticus (domestic pig) oxidative phosphorylation [GO:0006119] mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469] cytochrome-c oxidase activity [GO:0004129]; heme binding [GO:0020037]; metal ion binding [GO:0046872] NLNTTFFDPAGGGDPILYQHLF 0.99626 4.937 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.89476 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 G8HUY6 G8HUY6_PIG Mitochondrial IFN-beta promoter stimulator 1 Sus scrofa domesticus (domestic pig) immune system process [GO:0002376]; response to stimulus [GO:0050896] cytoplasm [GO:0005737]; membrane [GO:0016020] APWVGVAVVGVLLATLLAMLYRR 0.95862 88.77 0 11.2385 11.3692 9.19707 9.8611 6.85649 8.36405 0 10.295 5.57876 0 0 0 0 10.3571 0 10.3704 4.98404 0 6.75395 0 6.77413 0 11.3089 0 11.6426 9.72588 6.6844 0 10.0631 7.2484 0 0 8.87658 0 8.18537 7.62125 0 0 0 0 9.05357 0 0 10.8432 10.615 8.29834 0 0 6.63211 7.77301 0 0 0 0 0 0 0 0 4.41664 0 6.18339 10.0105 H6TB54 H6TB54_PIG Amino acid transporter Sus scrofa domesticus (domestic pig) L-alpha-amino acid transmembrane transport [GO:1902475] plasma membrane [GO:0005886] symporter activity [GO:0015293] ASGKMGMR 0.99694 4.9536 4.66738 0 0 0 0 0 0 6.21496 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 I7IIB2 I7IIB2_PIG Ubiquitin-like protein 5 UBL5 Sus scrofa domesticus (domestic pig) IEVVCNDR 0.99799 4.1375 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6.10934 0 0 0 0 0 I7KIU7 I7KIU7_PIG Ubiquitin-like protein 5 UBL5 Sus scrofa domesticus (domestic pig) protein modification process [GO:0036211] cytoplasm [GO:0005737]; nucleus [GO:0005634] CNTDDTIGDLK 0.96615 48.427 0 10.299 0 9.37075 10.7187 10.1792 9.50789 12.0129 10.6519 7.56209 10.2135 10.1444 9.11327 11.3515 0 10.3256 0 10.0602 10.0056 0 0 7.54535 10.8128 10.5609 7.97378 8.55348 6.0998 9.71819 8.92074 9.13942 9.92751 0 0 11.3801 0 10.6152 10.752 7.06318 0 8.06829 8.05664 8.44514 7.77492 5.73739 7.19219 8.6631 10.5944 8.80206 9.99181 8.58188 8.72195 8.72918 8.94962 8.20833 9.06988 0 8.61353 0 0 0 6.23022 5.55244 0 M1PYC4 M1PYC4_PIG Solute carrier family 18 member 2 SLC18A2 Sus scrofa domesticus (domestic pig) establishment of localization in cell [GO:0051649]; neurotransmitter transport [GO:0006836]; serotonin transport [GO:0006837] synaptic vesicle membrane [GO:0030672] xenobiotic transmembrane transporter activity [GO:0042910] AIGFPWLMTIIGIIDILFAPLCFFLRSPPAK 0.96894 78.199 0 0 9.21483 0 0 9.20433 9.15023 0 8.615 8.63912 0 0 0 0 8.87646 0 0 5.05098 9.27018 6.9279 7.86901 8.08343 0 12.6519 6.68215 0 0 0 8.21014 7.91952 0 0 0 8.70888 0 0 0 0 7.84975 8.21854 0 0 0 6.25563 5.37803 7.72021 7.53387 6.2241 5.29675 7.44485 0 8.14721 0 9.22918 0 6.16416 0 4.65667 0 0 0 0 0 M4M6F6 M4M6F6_PIG NADH-ubiquinone oxidoreductase chain 1 (EC 7.1.1.2) ND1 Sus scrofa domesticus (domestic pig) mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469] NADH dehydrogenase (ubiquinone) activity [GO:0008137] ASYPRFR 0.99486 8.5955 0 0 0 0 0 0 0 0 0 0 4.21023 0 0 0 0 0 0 0 0 0 0 0 0 10.5648 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.151 0 0 0 0 0 0 M5DFC0 M5DFC0_PIG CD93 CD93 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] calcium ion binding [GO:0005509] AAENPYR 0.95355 149.65 6.80012 0 7.25937 10.4456 11.4122 10.069 4.59461 7.36947 10.8488 10.5017 8.92582 6.43132 11.8832 7.13843 9.27209 9.61244 9.11228 10.164 9.28778 3.71326 0 10.8263 10.7116 11.0775 0 7.78038 7.32256 9.73586 8.90533 7.81269 10.1355 9.86276 10.4145 9.82912 0 8.31841 8.30022 3.39149 7.26857 7.74167 9.38126 7.92505 7.09265 9.33561 0 4.62029 9.74199 7.22159 8.0227 8.55873 8.23352 7.20486 3.98231 7.3378 3.49863 7.83327 5.20261 0 0 6.7922 9.74556 0 5.16092 M5DFN4 M5DFN4_PIG Syndecan syndecan-1 Sus scrofa domesticus (domestic pig) extracellular region [GO:0005576]; membrane [GO:0016020] AAFWLWLCALALR 0.9682 51.345 9.01505 0 0 0 0 10.4564 9.37297 0 8.28276 10.1993 0 0 0 9.55057 9.27491 0 0 0 8.39656 7.42105 0 0 0 0 0 7.23362 12.7396 9.13548 0 0 0 11.1745 7.93286 10.1464 0 0 0 0 0 0 7.50985 0 7.01089 0 8.87722 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.77152 0 M5DNE0 M5DNE0_PIG CD7 CD7 Sus scrofa domesticus (domestic pig) adaptive immune response [GO:0002250] membrane [GO:0016020] signaling receptor activity [GO:0038023] ARLLGLPLLPLLLALSFNR 0.96686 73.951 8.86102 0 8.25172 9.25621 0 0 0 0 0 5.4768 10.587 0 8.62172 0 7.54435 10.2426 8.58737 0 7.25352 5.24112 0 6.29453 10.8539 0 7.21675 0 0 4.62275 0 9.19925 7.90761 7.93068 8.0332 0 0 0 7.63125 3.72126 8.31818 0 0 4.05476 5.28222 0 7.98618 0 10.1393 0 0 0 4.34476 3.38929 6.52373 0 8.88823 5.27865 0 7.13873 4.6143 0 0 8.01005 7.96029 O18758 O18758_PIG Submaxillary apomucin Sus scrofa domesticus (domestic pig) AATGAGTAVGATSR 0 323.31 10.7328 12.2959 12.7204 12.6564 12.707 11.1431 13.0404 12.0666 12.5149 11.7476 12.1946 12.8037 13.6733 14.1569 12.5702 11.5841 11.5289 11.602 12.5068 11.4499 12.3204 12.8594 13.4941 12.0885 13.7687 13.0844 11.0059 10.6203 11.192 11.3033 12.3104 14.7796 12.481 12.1015 11.6054 12.5397 12.6972 11.3224 12.2215 11.6078 11.6609 9.55886 10.3383 10.6154 15.4062 10.4568 12.3557 11.1346 10.5402 11.4384 9.71284 10.132 8.39189 11.6077 10.2186 12.2259 14.1995 7.75669 9.95507 9.51477 10.7394 10.1267 12.2485 O46511 O46511_PIG Mineralocorticoid receptor MLR Sus scrofa domesticus (domestic pig) DVVPSPDTHEK 0.99283 8.2934 0 6.29355 0 0 0 0 9.10116 0 0 0 0 0 0 0 0 0 8.46773 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 O62686 O62686_PIG Calpain large polypeptide L3 CAPN3 Sus scrofa domesticus (domestic pig) LGANLFTIGFAIYE 0.99271 9.5131 0 0 0 0 0 0 0 0 0 9.19564 0 0 9.09524 0 10.0094 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.6175 6.70086 0 0 0 7.97923 0 0 0 0 0 0 O62687 O62687_PIG Calpain large polypeptide L3 CAPN3 Sus scrofa domesticus (domestic pig) ARSRTYINMR 0.96888 52.137 0 7.28401 8.4085 0 8.07114 0 6.11201 0 0 8.56209 9.96561 0 0 0 0 11.7531 7.46687 0 5.07026 0 0 9.46025 0 0 0 0 0 0 9.05721 4.27329 0 0 3.26668 0 0 6.00529 0 8.2666 0 11.9015 0 0 0 0 0 0 0 0 0 0 8.79763 0 0 11.4504 0 0 0 7.92428 0 0 0 4.73368 0 O97510 O97510_PIG Syntaxin 3 homolog Sus scrofa domesticus (domestic pig) membrane [GO:0016020] PDNIELNVMHTVDHVERAR 0.99731 4.5799 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.68025 0 0 0 0 0 0 0 0 0 0 0 5.5077 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 O97573 O97573_PIG Fibroblast growth factor (FGF) FGF7 Sus scrofa domesticus (domestic pig) growth factor activity [GO:0008083] ECNEDCNFK 0.97019 52.694 0 0 0 4.19148 0 0 0 0 0 3.03425 7.07489 5.89581 0 0 8.27058 4.42068 6.21657 5.49256 0 8.69707 0 0 0 0 0 0 0 0 0 0 0 6.98675 4.78994 0 0 0 0 0 0 6.92303 5.89045 0 5.83756 0 6.80374 0 0 6.63346 0 0 0 0 0 0 7.7866 0 7.78247 0 8.37565 7.42844 0 0 0 O97864 O97864_PIG Retinoid X receptor beta RXRB Sus scrofa domesticus (domestic pig) regulation of DNA-templated transcription [GO:0006355] nucleus [GO:0005634] DNA binding [GO:0003677]; nuclear steroid receptor activity [GO:0003707]; zinc ion binding [GO:0008270] AGWNELLIASFSHR 0.9561 104.96 9.07583 8.26111 0 12.7402 9.34636 8.98812 8.90851 11.232 0 5.19551 10.0711 0 0 0 0 0 0 9.14315 11.1253 7.7341 11.9213 11.0063 10.455 11.3434 10.4847 9.90608 7.97665 9.67594 9.53695 8.39124 10.6644 5.8298 10.8851 9.80497 9.14995 7.97654 0 6.05015 7.35887 8.48639 2.49434 3.74588 4.76633 3.67027 0 0 7.86827 8.62626 9.85256 0 8.56056 0 9.81526 9.25397 8.36977 8.3386 7.4872 8.48309 8.47739 5.8503 0 4.71924 0 O97865 O97865_PIG Myocyte enhancer factor 2A MEF2A Sus scrofa domesticus (domestic pig) GDFHSPVVLGRPPNTEDR 0.99188 28.279 0 0 5.9532 6.5253 0 0 0 9.23589 0 0 0 7.38612 0 9.90516 0 5.29649 4.74416 0 7.13525 0 0 5.86233 0 0 0 0 7.06383 0 0 0 0 0 0 0 5.70027 0 0 0 0 0 0 0 0 4.65059 0 0 0 0 0 0 0 0 0 0 6.30252 0 0 0 0 0 0 0 0 O97866 O97866_PIG Gastric mucin MUC5AC Sus scrofa domesticus (domestic pig) AQNHPEVSIQK 0.96112 107.86 14.9888 14.8347 15.1177 14.4089 14.2985 14.5307 8.97507 9.79095 14.7713 10.0757 15.1856 14.9702 9.00355 9.38812 14.8816 14.3293 10.9538 10.8417 15.5643 15.6405 10.0027 10.7814 9.18247 10.3129 14.6355 0 14.2877 16.9587 16.6719 16.9335 14.6987 14.5946 8.24136 14.4432 9.1811 14.359 11.5495 0 9.40391 12.4046 9.74295 12.3816 12.517 12.7309 0 7.956 8.67828 8.41747 15.5191 15.5196 15.4858 12.7004 12.6799 12.6829 13.3864 13.3754 10.873 13.8839 13.6919 14.8794 12.2867 12.1875 12.2875 O97867 O97867_PIG Gastric mucin MUC5AC Sus scrofa domesticus (domestic pig) AFSYTEVEK 0.95325 110.1 6.55958 0 7.50064 0 5.69861 8.52951 0 0 0 6.28387 8.81887 0 0 9.26482 10.2175 0 0 7.8525 9.50768 5.63113 11.8551 8.375 10.1943 9.46655 0 3.81342 8.02763 7.89379 0 6.79896 8.96125 0 0 10.366 0 0 0 5.43273 8.99537 6.29657 8.32202 0 0 11.6664 0 8.49665 6.92208 7.38085 9.62987 4.97824 7.06124 10.3975 6.37396 6.86975 0 0 0 0 10.6037 9.81901 5.73571 0 7.62447 O97931 O97931_PIG Ran-binding protein homolog Sus scrofa domesticus (domestic pig) intracellular transport [GO:0046907] AKLYRWDR 0.968 65.749 0 10.0569 0 7.56864 9.67682 12.2572 9.03006 9.23845 10.1709 0 0 8.55566 0 10.1729 10.7345 0 5.92277 8.39742 0 0 7.82833 10.9221 8.54411 10.3099 0 9.45138 0 0 8.11181 10.9243 0 10.3801 0 0 10.1534 0 0 7.60251 0 9.49462 0 0 0 0 0 0 9.32414 5.99777 0 0 11.2246 9.18088 8.47699 0 9.28151 0 7.10654 7.64645 8.74913 0 7.72663 0 10.0572 P87375 P87375_PIG Polyprotein Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] aspartic-type endopeptidase activity [GO:0004190]; endonuclease activity [GO:0004519]; RNA-directed DNA polymerase activity [GO:0003964] DKKSWVMGATGQQQYPWTTR 0.96476 76.793 0 8.34043 0 5.85417 11.8971 8.12122 8.78833 3.54213 9.60442 2.63255 7.47517 9.8627 8.51396 0 6.12584 9.60789 0 0 6.07763 0 7.08852 9.86436 9.6808 0 3.6017 0 7.23754 0 0 0 9.25696 9.93223 0 4.57222 9.68996 7.65693 8.56723 0 0 10.2411 10.4959 9.13109 0 8.27882 8.70428 9.25063 8.99452 0 6.78293 8.99232 0 0 0 9.03169 5.21047 0 7.75722 0 9.21208 7.99243 6.47682 0 0 Q0EF93 Q0EF93_PIG Taste receptor type 1 member 3 TAS1R3 Sus scrofa domesticus (domestic pig) plasma membrane [GO:0005886] G protein-coupled receptor activity [GO:0004930] AARSLFSHSLHCR 0.95144 201.72 7.20183 10.142 10.0412 7.5588 9.87708 9.89113 9.98499 9.36648 8.69118 0 9.1249 11.0121 11.8159 11.2312 10.382 11.4766 10.4961 8.46099 10.3366 8.40548 6.99729 11.4432 9.72105 11.6028 11.2312 5.03822 6.56651 11.026 8.83769 0 8.66413 10.5731 9.96924 9.73872 8.73846 7.07028 9.07895 9.01449 9.02555 9.1139 10.6488 5.03007 9.37634 8.52525 8.09165 6.84862 10.2115 8.88475 8.86521 7.01167 10.1492 8.01262 10.3696 11.1241 6.28803 6.77255 0 5.9782 8.78015 6.54617 9.70361 8.92763 7.0082 Q0EF96 Q0EF96_PIG "Dishevelled, dsh homolog 1" DVL1 Sus scrofa domesticus (domestic pig) ALGREKESR 0.96741 48.579 9.2688 11.3791 10.1384 5.15097 0 0 11.5872 11.0202 10.2321 0 0 10.0796 10.2484 8.6334 9.90317 0 11.3897 0 8.33883 9.89656 9.24947 11.6295 10.3618 0 8.94629 8.83573 8.80009 10.3549 12.0944 10.118 11.1307 9.42498 11.0423 0 10.8341 10.6572 10.8602 0 0 17.7009 9.29285 9.234 9.30047 8.52779 9.46377 10.0276 11.4996 0 11.2742 11.0273 10.5522 9.53191 9.43039 9.53459 0 8.33566 0 0 5.17373 9.33302 0 8.42798 8.3015 Q152V0 Q152V0_PIG Calpain 10 transcript variant 1 Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] calcium-dependent cysteine-type endopeptidase activity [GO:0004198] ALCHTQQLPGAWVK 0.99695 4.8704 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3.03104 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q28821 Q28821_PIG Sister of P-glycoprotein Spgp Sus scrofa domesticus (domestic pig) membrane [GO:0016020] ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887] AIVRDPK 0.97118 87.128 7.85169 9.65921 7.07489 7.24859 8.67447 8.71651 10.4874 7.98579 5.3929 3.07317 8.03881 0 9.45354 11.0347 10.8203 6.63819 11.0222 0 0 0 10.5127 7.51057 10.7997 11.6125 0 0 0 0 8.00607 8.66427 8.66519 0 9.07828 9.70862 6.44137 8.9661 9.47958 11.4176 0 8.17068 8.82346 10.2704 0 0 0 7.86722 7.96578 8.76208 8.66107 4.64818 8.47167 0 0 7.58384 0 0 6.36573 0 6.98732 0 0 0 0 Q3HWE5 Q3HWE5_PIG Vimentin Sus scrofa domesticus (domestic pig) intermediate filament [GO:0005882] structural molecule activity [GO:0005198] DNLAEDIMR 0.99928 17.931 9.10032 0 0 0 0 9.46128 0 8.29893 0 0 0 7.82024 0 0 0 0 0 0 0 0 0 0 6.39139 0 0 0 0 0 0 0 6.0383 0 0 0 0 0 0 0 0 0 0 0 0 6.87541 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q5TIL9 Q5TIL9_PIG Leptin (Obesity factor) LEP Sus scrofa domesticus (domestic pig) response to insulin [GO:0032868] extracellular region [GO:0005576] hormone activity [GO:0005179] DLLHLLASSK 0.96806 49.372 9.61077 0 8.83586 7.30834 11.9225 7.70722 9.47541 0 0 7.19042 7.51971 10.0904 9.75616 0 9.59395 8.78336 9.52505 9.791 7.76388 10.7886 8.69206 0 9.55098 9.67083 0 0 0 0 8.38297 0 6.39383 9.15629 0 10.9009 0 0 9.17585 8.8479 0 0 9.83115 0 0 0 8.24703 7.20212 8.29774 9.89127 9.15959 0 4.98668 0 7.59231 3.95065 10.6121 7.42643 0 8.21286 0 0 0 7.93434 0 Q6LEL6 Q6LEL6_PIG Cytochrome P450 (EC 1.14.14.-) Sus scrofa domesticus (domestic pig) endoplasmic reticulum membrane [GO:0005789] "heme binding [GO:0020037]; iron ion binding [GO:0005506]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen [GO:0016712]" AWREQRR 0.95588 161.31 0 9.32829 9.05542 9.77278 9.53241 10.385 9.80624 0 10.4483 9.31936 4.04396 7.67122 9.38843 5.67381 10.4987 7.0177 7.68321 9.25536 9.22675 0 11.24 7.82369 5.54117 9.43546 7.70266 0 8.50653 13.1065 8.84458 0 9.9419 7.10758 7.99095 8.39288 5.48062 0 7.89724 7.01792 6.55801 8.73897 0 0 0 6.47776 10.3534 10.3904 7.1633 0 8.91657 5.81047 6.83061 10.9934 7.87646 0 5.91798 10.544 5.41843 0 0 10.9612 0 5.22743 8.53947 Q6V7J9 Q6V7J9_PIG Phosphatidylcholine-sterol acyltransferase (EC 2.3.1.43) (Lecithin-cholesterol acyltransferase) (Phospholipid-cholesterol acyltransferase) Sus scrofa domesticus (domestic pig) cholesterol metabolic process [GO:0008203] extracellular region [GO:0005576] O-acyltransferase activity [GO:0008374] DLLAGLPAPGVEVYCLYGVGLPTPR 0.99694 4.9382 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.48655 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q6VFT9 Q6VFT9_PIG Adiponectin Sus scrofa domesticus (domestic pig) extracellular region [GO:0005576] DGRDGVPGEK 0.97122 87.008 8.99291 0 0 9.6767 9.94657 10.4762 8.41519 10.3185 9.7106 8.324 0 5.05996 8.99565 11.1537 10.5127 0 10.4197 0 10.9055 0 10.3421 10.1009 8.31854 6.19639 7.1919 9.48935 9.3996 9.75729 8.15396 9.1855 7.99305 7.96376 8.27128 0 7.80838 8.71194 0 9.44816 8.49482 8.75699 8.6697 0 8.7227 9.92046 8.36951 6.26544 8.74776 7.62724 8.69777 8.70418 7.55834 8.39673 9.81826 0 0 0 0 0 0 7.93286 8.52845 5.97897 0 Q6XCF8 Q6XCF8_PIG G-protein-coupled receptor GPR34 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] G protein-coupled receptor activity [GO:0004930] FPNSGKYATTAR 0.96327 76.177 10.1109 8.76673 0 0 8.21747 10.1898 0 7.91689 0 0 0 10.3588 12.3253 3.25232 0 11.2444 0 9.16619 9.48639 9.32274 9.85711 6.5753 10.8412 0 4.34703 9.44143 9.75196 0 0 0 0 8.98832 0 10.1293 0 0 4.47942 0 0 0 8.47013 0 11.0932 0 0 11.2789 5.11103 7.63118 11.9554 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q7M2N9 Q7M2N9_PIG Uteroferrin-associated glycoprotein Sus scrofa domesticus (domestic pig) VLEVALK 0.99628 4.849 0 0 0 0 0 0 0 0 0 0 0 0 0 9.07007 9.14453 8.20989 0 0 0 0 0 8.86168 0 8.86146 0 0 0 0 0 0 0 0 9.67158 8.76378 0 8.78754 0 9.05867 0 7.9367 7.852 7.54264 0 7.79149 0 8.40854 0 0 0 0 0 0 0 0 0 0 7.41117 0 0 0 0 0 0 Q7M2P2 Q7M2P2_PIG Dipeptidyl-peptidase IV (EC 3.4.14.5) Sus scrofa domesticus (domestic pig) dipeptidyl-peptidase activity [GO:0008239] GTDDAAADSRRTYTLT 0.99272 9.4619 0 0 0 0 3.18301 0 0 0 0 0 0 0 0 0 0 10.2279 8.11155 0 0 9.47462 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 9.38558 0 0 0 0 0 0 0 0 0 7.34438 0 0 Q7M2P3 Q7M2P3_PIG "Basic fibroblast growth factor, long form" Sus scrofa domesticus (domestic pig) SPGGAMAAGSITTLPALP 0.99933 4.4855 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.3528 0 0 0 0 0 0 0 0 0 Q7M2P4 Q7M2P4_PIG Annexin 36K chain Sus scrofa domesticus (domestic pig) LGLGTDEDR 0.9938 9.0766 10.4001 10.2876 0 10.1115 0 0 0 0 9.35138 0 0 7.90941 0 0 0 9.71278 0 0 0 0 0 0 0 0 10.8132 0 0 8.92701 0 8.83927 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.95553 0 9.8647 0 0 0 0 0 0 0 0 7.18071 Q7M2P5 Q7M2P5_PIG Amine oxidase (Copper-containing) (EC 1.4.3.6) Sus scrofa domesticus (domestic pig) HSDAVFTYNYR 0.99731 4.5414 0 0 0 0 0 0 0 0 9.1738 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q7M2R7 Q7M2R7_PIG Secretogranin II Sus scrofa domesticus (domestic pig) ASFQRNQLLQK 0.9946 27.803 6.90364 0 0 9.57211 0 0 0 0 8.22675 0 5.93845 0 0 0 0 0 0 0 7.0091 0 0 7.2589 6.55321 0 0 0 0 10.0225 0 5.10593 0 0 0 0 0 0 0 8.79142 0 0 0 8.5016 0 8.33235 0 0 0 8.48349 9.35716 8.2896 0 6.79377 7.27118 9.16136 0 7.68454 0 0 0 0 0 0 9.02605 Q7M2S1 Q7M2S1_PIG Galectin Sus scrofa domesticus (domestic pig) carbohydrate binding [GO:0030246] FDMHGDINTIVCNSKGGAWGAEQR 0.99451 8.7286 0 0 0 0 4.54343 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6.79896 0 0 0 0 0 0 0 0 Q7M2S5 Q7M2S5_PIG 78 kDa glucose-regulated protein (Binding-immunoglobulin protein) (Heat shock protein 70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein) Sus scrofa domesticus (domestic pig) ATP binding [GO:0005524]; ATP-dependent protein folding chaperone [GO:0140662] DAGTIAGLNVMR 0.94631 303.72 12.4894 12.2833 12.7522 13.4567 13.4497 13.5104 11.1997 13.4362 13.4457 12.9578 13.3211 13.2109 13.6963 13.7025 13.5827 13.2221 13.3257 10.9079 12.8278 12.6196 12.752 13.1106 13.289 10.4919 12.7349 12.1626 12.7636 12.4135 12.599 12.4232 13.3486 13.3817 13.2703 12.3778 12.5432 12.5434 12.8902 13.2741 12.951 12.0834 11.9947 11.9403 12.1268 9.49713 9.56383 12.4519 12.2695 12.0852 12.625 12.6258 12.3008 12.2699 10.0035 12.2235 12.4772 12.4474 10.1922 11.4286 11.6381 11.539 11.65 11.367 11.3494 Q7M2T8 Q7M2T8_PIG Glycine cleavage system protein H Sus scrofa domesticus (domestic pig) GVSKFTDK 0.99764 4.6034 0 0 8.99197 0 0 7.05463 0 0 6.38633 5.65274 0 0 0 0 0 0 0 7.51979 0 0 7.34952 9.27882 7.81198 0 0 0 0 0 6.84398 0 7.14323 0 0 0 0 0 0 7.08204 6.79429 0 0 0 0 0 0 6.50107 0 0 6.29258 0 0 6.93026 0 7.17183 0 0 0 5.79953 0 0 0 0 3.71194 Q7M2W3 Q7M2W3_PIG Alpha-internexin Sus scrofa domesticus (domestic pig) intermediate filament [GO:0005882] AQQRDVDGATLAR 0.97402 40.592 7.91803 0 9.2341 0 8.77126 0 0 7.8334 0 4.87051 0 0 0 0 7.53013 0 10.2209 4.13208 0 7.66334 6.80129 7.61699 0 9.40429 0 0 0 0 5.93173 0 0 0 6.9514 6.11201 0 0 0 9.69091 0 0 0 0 8.64667 0 0 7.40667 6.64305 0 7.60999 0 7.02447 0 0 5.16655 6.92861 6.71987 6.58099 7.05105 7.18706 7.39318 0 0 0 Q7M2Y3 Q7M2Y3_PIG Nonhistone chromosomal protein HMG-14 Sus scrofa domesticus (domestic pig) chromatin [GO:0000785]; nucleus [GO:0005634] nucleosomal DNA binding [GO:0031492] LSAKPAPAK 0.99534 17.049 0 0 0 0 0 0 0 0 0 0 0 0 11.4664 11.6434 6.97659 0 0 0 0 6.36776 0 0 7.03529 6.86258 0 0 0 0 0 0 6.76713 8.42139 0 0 0 0 0 10.9998 0 0 0 0 0 7.22747 9.83758 0 0 0 0 0 0 0 0 0 0 0 6.04341 0 0 0 0 0 0 Q7M2Z7 Q7M2Z7_PIG Enkephalin Sus scrofa domesticus (domestic pig) DAEEDDGLGNSSDLLK 0.99306 9.5234 0 0 0 0 0 0 0 0 0 0 10.2758 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q7M313 Q7M313_PIG Proteinase inhibitor (Kunitz type) Sus scrofa domesticus (domestic pig) serine-type endopeptidase inhibitor activity [GO:0004867] ARMIKYFYN 0.99733 4.0832 0 0 0 0 0 0 0 0 0 9.35506 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q7M320 Q7M320_PIG Calpain large chain 2 (EC 3.4.22.17) Sus scrofa domesticus (domestic pig) DREAAEGLGSHER 0.99346 27.586 6.90977 0 0 0 0 0 0 0 0 11.2674 11.6438 11.8593 0 0 0 0 0 0 9.69782 7.91073 13.3507 0 0 5.67044 0 7.74551 4.72454 0 0 0 5.35269 0 0 8.75932 0 0 0 0 0 0 0 8.75027 0 0 0 0 0 9.69047 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q7M324 Q7M324_PIG Acrosin-like proteinase (EC 3.4.21.-) Sus scrofa domesticus (domestic pig) FRQKLESGMR 0.99866 4.2247 0 0 0 0 0 10.42 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 9.91322 0 0 0 0 0 0 9.93899 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q7M325 Q7M325_PIG Chymotrypsin-like proteinase (EC 3.4.21.-) Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] serine-type endopeptidase activity [GO:0004252] LASPAQYTTR 0.99866 4.0408 0 0 0 0 0 0 0 0 0 0 0 0 9.72363 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.6865 0 0 0 0 0 8.44497 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.75057 7.79701 0 0 0 0 0 0 0 0 Q7M326 Q7M326_PIG Acylaminoacyl-peptidase (EC 3.4.19.1) Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508] omega peptidase activity [GO:0008242]; serine-type endopeptidase activity [GO:0004252] ARNVPVR 0.96449 46.297 7.52395 0 7.72363 12.4492 12.3921 12.4181 12.2535 12.0455 12.4232 12.2944 0 12.7181 12.9468 12.6185 11.8101 0 0 11.6182 12.2997 0 12.1579 0 0 12.2335 14.9724 9.70306 10.4751 11.5899 12.3779 10.3903 12.3331 12.6022 0 13.4531 13.1454 13.0166 11.6591 11.8235 11.7174 9.25167 10.0737 9.97671 16.1766 17.7426 16.3065 0 12.1544 10.5511 13.2785 11.4865 13.3078 13.2011 13.3461 12.834 13.217 13.0595 0 12.5405 10.8155 12.1309 12.1038 10.7557 12.1759 Q7M328 Q7M328_PIG Alpha-amylase (EC 3.2.1.1) Sus scrofa domesticus (domestic pig) carbohydrate metabolic process [GO:0005975] alpha-amylase activity [GO:0004556]; metal ion binding [GO:0046872] ALVFVDNHDNQR 0.96536 137.02 8.23386 8.78202 9.92853 11.427 9.53197 10.391 6.88862 6.27503 11.6932 11.2447 8.26679 0 11.3801 11.2223 10.9796 6.63723 8.73934 10.281 0 6.56384 8.42773 7.82979 3.2168 0 4.46558 9.35698 9.75049 9.94563 9.75856 9.11684 11.6176 0 7.59119 8.9853 8.54129 8.43717 8.49677 7.2075 8.47094 7.26341 9.99308 7.57622 8.99209 9.71603 9.64441 4.17816 8.10502 0 10.2313 7.97562 6.43281 7.97039 6.05285 0 0 7.27501 8.19795 8.20984 5.05342 8.46446 10.0535 7.42668 6.16716 Q7M333 Q7M333_PIG "Phospholipase A2 homolog, non-pancreatic" Sus scrofa domesticus (domestic pig) arachidonic acid secretion [GO:0050482]; lipid catabolic process [GO:0016042]; phospholipid metabolic process [GO:0006644] extracellular region [GO:0005576] calcium ion binding [GO:0005509]; phospholipase A2 activity [GO:0004623] AVLAPTQSSFWQFQR 0.9924 9.3327 0 0 9.64129 0 0 0 0 6.88557 0 0 0 6.43284 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.67002 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6.59326 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q7M335 Q7M335_PIG "Phospholipase A2, membrane associated (EC 3.1.1.4) (GIIC sPLA2) (Group IIA phospholipase A2) (Phosphatidylcholine 2-acylhydrolase 2A)" Sus scrofa domesticus (domestic pig) arachidonic acid secretion [GO:0050482]; defense response to bacterium [GO:0042742]; killing of cells of another organism [GO:0031640]; lipid catabolic process [GO:0016042]; phospholipid metabolic process [GO:0006644] extracellular region [GO:0005576]; mitochondrial outer membrane [GO:0005741] calcium ion binding [GO:0005509]; phospholipase A2 activity [GO:0004623] APVPNYAFYGCYCGLGGK 0.99103 9.2736 0 0 0 0 0 0 0 0 0 0 0 0 0 10.1802 0 0 0 8.94216 0 0 0 0 0 0 0 0 0 0 0 0 0 7.05734 0 9.55426 0 9.29625 0 0 0 0 7.14883 8.5895 0 0 0 0 6.00706 0 0 0 0 0 8.82899 0 0 0 0 0 8.32818 7.25805 0 0 0 Q7M336 Q7M336_PIG Creatine kinase chain M1 (EC 2.7.3.2) Sus scrofa domesticus (domestic pig) creatine kinase activity [GO:0004111] AEEEYPDLLK 0.99384 27.752 10.0949 0 0 0 0 0 8.81285 8.31583 0 0 8.8699 0 0 0 0 0 0 0 9.56138 0 0 0 0 8.76868 0 0 0 0 0 0 0 0 9.41134 0 0 0 0 0 0 9.15355 0 0 0 0 0 0 0 0 0 0 0 5.38474 0 2.9748 0 0 0 0 0 0 0 0 0 Q7M337 Q7M337_PIG Creatine kinase chain M2 (EC 2.7.3.2) Sus scrofa domesticus (domestic pig) creatine kinase activity [GO:0004111] AEEEYPDLSKHNNHMAK 0.98384 31.878 7.60014 7.9747 0 10.8732 10.7678 7.50048 3.52945 7.50383 0 5.71251 0 0 0 10.9461 9.57677 8.29223 9.286 10.8615 4.71545 7.86635 0 0 0 9.03821 0 0 0 4.104 0 0 0 0 6.13264 0 0 0 5.12569 7.23802 5.48565 7.36894 0 5.02799 5.22099 0 0 0 8.65932 0 0 0 0 7.32094 7.43863 0 0 6.22895 0 0 0 0 0 0 6.36554 Q7M357 Q7M357_PIG Insulin-like growth factor R3 Sus scrofa domesticus (domestic pig) mitochondrion [GO:0005739]; respiratory chain complex IV [GO:0045277] FPHQNQTR 0.99346 9.0665 0 0 0 0 8.86022 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.20984 0 0 0 0 0 0 0 0 0 0 0 7.62768 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q7M364 Q7M364_PIG Antithrombin-III (Serpin C1) Sus scrofa domesticus (domestic pig) blood coagulation [GO:0007596]; regulation of blood coagulation [GO:0030193] extracellular space [GO:0005615] heparin binding [GO:0008201]; serine-type endopeptidase inhibitor activity [GO:0004867] AKLPGIVAEGR 0 323.31 12.1765 10.0682 9.63604 11.502 11.8115 11.6565 11.3808 11.5755 9.54117 10.3456 10.0971 12.1683 11.6837 12.52 12.3091 11.468 12.8826 12.2222 11.5233 12.6497 12.7551 12.4015 12.055 12.4643 11.4539 10.8741 10.0319 6.05526 8.73424 11.4107 12.9011 12.6884 12.6438 8.88121 9.64825 8.46218 10.5425 9.05544 9.0731 8.93245 0 8.89445 0 9.18847 10.7032 11.2643 9.64735 10.7895 11.7787 10.8287 11.6934 10.0843 9.90331 7.92475 9.4652 7.29774 8.17936 8.73512 0 7.89063 8.57864 10.3362 9.04428 Q7M383 Q7M383_PIG Lactate dehydrogenase Sus scrofa domesticus (domestic pig) LSGLNSADTLWGIQK 0.99387 5.0485 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4.72661 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q7M385 Q7M385_PIG "Glycogen phosphorylase, cardiac (EC 2.4.1.1)" Sus scrofa domesticus (domestic pig) "1,4-alpha-oligoglucan phosphorylase activity [GO:0004645]; linear malto-oligosaccharide phosphorylase activity [GO:0102250]; SHG alpha-glucan phosphorylase activity [GO:0102499]" KQISVRGL 0.9945 8.9453 0 0 0 0 6.85537 0 7.64674 0 0 7.84518 0 5.97932 0 0 0 0 0 0 0 0 0 0 0 0 7.20574 0 0 0 0 0 6.39335 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q7M386 Q7M386_PIG Calpain II heavy chain Sus scrofa domesticus (domestic pig) AVKYLNSEK 0.99962 23.233 0 10.7072 0 9.8299 0 0 8.00416 8.29779 9.84057 0 0 10.3793 9.07337 0 0 0 7.22853 0 7.79837 7.75942 7.94544 0 9.60626 0 0 0 0 9.73485 7.37077 7.35156 8.29678 13.1044 10.4098 0 0 0 0 7.68145 9.33123 7.37539 6.45316 0 6.51117 8.77942 0 7.81128 7.45525 0 8.09371 6.99582 6.17943 0 0 9.42393 0 9.21943 0 0 0 0 0 0 0 Q7M399 Q7M399_PIG Zona pellucida glycoprotein beta chain Sus scrofa domesticus (domestic pig) CEPLVSQDPRPAGNLSILRTNRDQLNK 0.99774 23.652 0 0 0 0 0 0 0 9.01302 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 9.16897 0 9.16458 0 0 0 6.29712 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5.49768 0 0 9.30945 0 0 0 7.30597 0 0 0 0 7.78784 0 0 0 0 Q7M3A8 Q7M3A8_PIG Annexin Sus scrofa domesticus (domestic pig) calcium ion binding [GO:0005509]; calcium-dependent phospholipid binding [GO:0005544] LYDAYELK 0.99293 13.948 0 10.1322 0 9.57314 9.99223 9.37195 0 0 0 0 0 0 0 0 0 5.61067 0 0 0 0 0 0 0 0 0 0 0 8.80678 8.51625 0 0 0 8.83305 0 9.01086 0 9.20653 9.23592 9.43827 0 7.85717 0 0 0 0 0 0 0 0 8.15254 0 6.99061 7.69418 7.89087 8.80058 8.97502 8.73954 9.76232 8.67059 9.03155 8.58376 0 0 Q7M3A9 Q7M3A9_PIG Dystrophin Sus scrofa domesticus (domestic pig) IFNQWLTEAERFLRK 0.9933 13.752 9.86496 0 0 0 9.19227 0 0 0 0 0 0 0 0 11.8202 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6.56265 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q7M3E0 Q7M3E0_PIG Pancreatic elastase III (EC 3.4.21.36) Sus scrofa domesticus (domestic pig) serine-type endopeptidase activity [GO:0004252] CGRPSYNPASR 0.99484 8.968 0 6.60135 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.25011 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.75338 0 0 0 0 0 6.17401 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q7M3E7 Q7M3E7_PIG Glutathione transferase class alpha 6a (EC 2.5.1.18) Sus scrofa domesticus (domestic pig) glutathione transferase activity [GO:0004364] DGSLLFQQVDMYTEGVA 0.99798 4.642 0 0 0 0 0 0 0 0 7.30305 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.63365 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q7M3E8 Q7M3E8_PIG Glutathione transferase class mu 4 (EC 2.5.1.18) Sus scrofa domesticus (domestic pig) glutathione transferase activity [GO:0004364] ILGYWDIR 0.99866 4.2814 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6.24588 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.4203 0 0 0 0 0 6.69056 Q7M3E9 Q7M3E9_PIG Glutathione transferase class mu 8 (EC 2.5.1.18) Sus scrofa domesticus (domestic pig) glutathione transferase activity [GO:0004364] DMILGYWDIR 0.99534 17.38 0 0 10.2861 0 0 0 0 7.43738 0 0 0 0 0 0 0 3.87902 0 0 10.4425 3.734 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.10365 0 0 0 0 0 7.72806 0 0 0 0 5.75213 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q7M3G6 Q7M3G6_PIG 36K microfibril-associated protein Sus scrofa domesticus (domestic pig) FQPQQPLD 0.99866 4.2814 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 9.35786 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q7M3G8 Q7M3G8_PIG GTP-binding regulatory protein Gi alpha-2 chain Sus scrofa domesticus (domestic pig) signal transduction [GO:0007165] GTP binding [GO:0005525] EYQLNDSAAYYLNDLER 0.99489 5.0178 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.05028 0 0 0 0 0 0 0 8.49025 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q7M3H2 Q7M3H2_PIG Met-enkephalin-Arg-Phe Sus scrofa domesticus (domestic pig) FADSLPSDEEGEGYSK 0.99798 4.6683 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5.50163 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3.84157 0 Q7M3I0 Q7M3I0_PIG "2',3'-cyclic-nucleotide 3'-phosphodiesterase (EC 3.1.4.37)" Sus scrofa domesticus (domestic pig) "2',3'-cyclic-nucleotide 3'-phosphodiesterase activity [GO:0004113]" ITPGARGAFTEK 0.99675 17.766 8.03705 0 0 0 12.0646 0 0 12.599 0 0 0 0 10.824 0 0 0 0 0 0 0 0 0 0 0 0 0 7.55397 0 0 12.6507 13.0946 0 0 0 0 0 0 9.32105 0 0 0 0 9.64346 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q7M3J1 Q7M3J1_PIG H+/K+-exchanging ATPase beta chain (EC 3.6.3.10) Sus scrofa domesticus (domestic pig) AQPHYSNPLVAAK 0.99235 9.608 0 0 0 0 0 0 9.79416 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5.92766 0 0 0 0 0 0 0 0 0 0 0 0 6.29074 0 0 5.65555 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6.11285 0 Q7YRK9 Q7YRK9_PIG Interferon alpha Sus scrofa domesticus (domestic pig) defense response to virus [GO:0051607] extracellular space [GO:0005615] cytokine activity [GO:0005125]; cytokine receptor binding [GO:0005126] AEVMRVFSSSTNLQDR 0.96399 68.175 0 11.0215 9.85596 10.9101 8.75965 9.85857 10.7438 9.26882 0 7.87024 10.1071 7.85904 0 0 9.54909 10.6722 0 0 9.43605 9.8895 9.89332 8.75074 7.77577 9.87395 10.3151 0 6.62038 9.56497 8.87101 0 0 10.2981 6.53165 8.72154 7.43813 9.59117 8.64692 9.71624 9.01131 8.88261 0 8.87526 5.06415 0 7.79623 8.07195 9.21752 9.14527 8.64014 8.27938 0 7.87246 0 0 9.12435 6.77281 5.87723 0 0 9.55269 8.12448 7.88142 8.19633 Q8MK46 Q8MK46_PIG Porcine orexin receptor type 1 HCRTR1 Sus scrofa domesticus (domestic pig) feeding behavior [GO:0007631] membrane [GO:0016020] orexin receptor activity [GO:0016499] LDRWYAICHPLLFK 0.99238 9.4396 0 0 7.06996 0 7.14139 0 0 5.28092 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4.46793 0 0 0 0 0 0 0 0 0 4.64027 0 0 0 0 0 0 0 0 0 0 0 6.70612 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q8WN73 Q8WN73_PIG carbamoyl-phosphate synthase (ammonia) (EC 6.3.4.16) Sus scrofa domesticus (domestic pig) nitrogen compound metabolic process [GO:0006807] ATP binding [GO:0005524]; ligase activity [GO:0016874]; metal ion binding [GO:0046872] AADTIGYPVMIR 0.97742 37.21 0 6.40985 9.14116 0 9.92293 0 0 8.61603 4.47528 0 0 0 0 0 0 9.43263 0 0 0 0 0 9.82988 6.04579 5.21117 5.7927 0 0 5.62918 0 4.00495 0 0 0 0 0 0 0 0 0 9.58096 0 0 5.11836 0 0 9.38446 0 0 0 6.50359 0 0 9.29556 0 0 9.16837 0 0 0 0 0 0 6.63939 Q9N1T7 Q9N1T7_PIG Gag-pol Sus scrofa domesticus (domestic pig) proteolysis [GO:0006508]; virion assembly [GO:0019068] membrane [GO:0016020] aspartic-type endopeptidase activity [GO:0004190]; nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270] AHNLSVQVK 0.95702 272.79 11.4537 12.7169 11.5822 13.3629 11.8502 13.4105 10.2655 10.2993 13.012 12.7033 12.7441 12.6951 11.8944 13.371 12.4952 12.982 9.43031 13.8649 12.1894 12.1391 11.2757 13.2836 8.47841 13.1608 11.9277 11.7629 12.2495 11.5134 6.20518 12.4847 12.4531 11.8259 11.5053 10.8976 9.95896 9.33693 11.8878 11.2743 11.6953 11.3188 8.76567 0 10.2692 10.8253 10.5681 11.034 11.1284 11.2938 11.3012 10.9807 11.7212 10.7749 11.2804 8.63274 11.0105 10.9957 0 10.3018 9.94761 9.92727 8.29154 9.87987 8.82788 Q9TUX2 Q9TUX2_PIG Anti-mullerian hormone receptor Sus scrofa domesticus (domestic pig) EGGHTVVWAGQLQGK 0.99137 9.2792 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9085 0 0 0 0 0 0 0 0 0 0 0 0 0 4.336 6.11455 0 9.08648 0 0 0 0 0 0 0 0 0 0 0 0 0 10.8527 0 0 0 0 0 0 0 0 0 0 Q9XS69 Q9XS69_PIG "ADP/ATP translocase (ADP,ATP carrier protein)" ANT1 Sus scrofa domesticus (domestic pig) mitochondrial ADP transmembrane transport [GO:0140021]; mitochondrial ATP transmembrane transport [GO:1990544] mitochondrial inner membrane [GO:0005743] ATP:ADP antiporter activity [GO:0005471] AAYFGVYDTAKGMLPDPK 0.96758 81.038 8.59969 10.2762 10.4115 9.44267 8.15381 9.30154 10.2634 9.9969 11.3021 0 0 10.1258 0 5.62129 9.20819 8.3689 0 10.7348 11.013 0 0 0 8.00983 11.7479 0 0 11.5009 0 10.4414 0 9.60272 10.3199 11.7802 0 9.2412 0 0 9.21607 0 9.41823 8.69408 7.29912 6.74025 6.75101 0 0 5.69988 0 4.25195 0 0 0 10.1927 8.47322 9.60563 5.64261 0 4.87485 8.24679 0 6.05355 6.78581 0 Q9XS73 Q9XS73_PIG Glutamate receptor ionotropic AMPA 1 GRIA1 Sus scrofa domesticus (domestic pig) plasma membrane [GO:0005886] ligand-gated monoatomic ion channel activity [GO:0015276] EEVIDFSKPFMSLGISIMIK 0.99394 14.572 0 0 5.4065 0 0 0 0 0 6.1031 0 0 0 7.83738 0 7.41354 5.79564 0 0 0 0 0 0 5.84411 0 0 0 10.9254 0 0 0 0 0 7.64825 0 0 0 0 0 0 0 6.69697 0 6.81404 0 0 4.72748 0 7.15593 9.1307 0 0 5.89869 0 4.59264 3.75681 6.24157 0 0 6.05987 0 0 0 0 Q9XS74 Q9XS74_PIG Glutamate receptor ionotropic AMPA 3 GRIA3 Sus scrofa domesticus (domestic pig) plasma membrane [GO:0005886] ligand-gated monoatomic ion channel activity [GO:0015276] FSPYEWHLEDNNEEPR 0.9973 4.6783 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.78116 0 0 0 0 0 0 0 0 0 0 0 7.72955 7.09466 0 0 0 0 0 0 0 6.97487 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q9XS75 Q9XS75_PIG Uncoupling protein 1 UCP1 Sus scrofa domesticus (domestic pig) GSWNVILFVCFEQLK 1.0004 19.253 2.01142 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3.95652 0 0 0 3.53132 0 0 8.20745 0 0 0 0 0 0 0 0 0 0 0 8.34038 0 0 0 0 0 0 0 0 5.47768 0 0 0 0 0 0 0 0 0 0 0 S4SAB4 S4SAB4_PIG Pyruvate kinase (EC 2.7.1.40) pklr Sus scrofa domesticus (domestic pig) phosphorylation [GO:0016310] ATP binding [GO:0005524]; kinase activity [GO:0016301]; magnesium ion binding [GO:0000287]; potassium ion binding [GO:0030955]; pyruvate kinase activity [GO:0004743] AALGPEGQGIK 0.99461 17.515 0 0 0 4.9148 7.96018 0 0 0 0 0 0 0 0 0 9.68849 6.02126 0 0 0 0 0 0 0 0 8.66998 0 0 6.0376 0 0 6.58777 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.12412 0 0 0 0 0 5.56925 0 0 0 0 0 5.67155 0 0 T1W3J4 T1W3J4_PIG Complement receptor type 1-like protein CR1-L Sus scrofa domesticus (domestic pig) membrane [GO:0016020] CAAKSCADFLDQLPNGR 0.79618 323.31 11.9456 10.9232 11.8702 13.8109 13.3339 11.9321 14.46 11.6671 10.8678 12.8117 11.2281 12.2166 13.6838 10.0871 11.9998 13.1011 11.8809 10.9746 10.471 11.2346 11.7227 11.8516 11.469 13.7741 13.736 10.5081 11.0924 13.1122 12.6192 11.4806 12.0766 14.0378 12.6328 11.5823 10.9724 12.6957 12.85 12.2546 12.1357 10.6611 11.9646 10.4564 12.0225 11.2171 9.92429 11.6517 13.0897 12.6135 11.3089 11.2313 12.1164 11.1939 11.7548 12.297 11.1512 10.3168 10.4085 11.2188 11.0076 11.0594 8.18928 11.5827 9.98542 U3N021 U3N021_PIG Truncated melanocortin 1 receptor MC1R Sus scrofa domesticus (domestic pig) CPFPTGSSSAWGW 0.99848 24.362 0 0 0 0 0 0 0 0 7.43237 0 0 0 0 7.55082 7.69961 7.38836 0 0 7.53566 0 8.37326 0 0 8.38124 0 0 0 0 0 0 8.26973 0 0 7.54319 7.72178 0 0 8.61471 7.99594 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4.06927 0 0 0 0 U3N5T9 U3N5T9_PIG Potassium channel subfamily k member 2 variant 2 KCNK2 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] potassium channel activity [GO:0005267] AAPDLLDPK 0.99967 3.806 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8.79175 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 U3N8V7 U3N8V7_PIG Potassium channel subfamily k member 2 variant 3 KCNK2 Sus scrofa domesticus (domestic pig) potassium ion transmembrane transport [GO:0071805] plasma membrane [GO:0005886] outward rectifier potassium channel activity [GO:0015271]; potassium ion leak channel activity [GO:0022841] AHAAEWTANVTAEFK 0.97237 85.9 0 0 0 9.10436 0 7.03287 7.74329 8.8454 5.39094 7.164 0 0 5.35896 0 10.1658 0 0 0 0 5.49422 0 0 0 0 0 0 5.64051 7.73647 7.44394 0 8.85325 11.3901 0 0 6.32501 5.77455 0 0 4.57253 0 0 0 9.52319 0 9.32704 0 0 4.56505 4.62188 0 5.31991 4.31266 0 6.41331 6.21708 0 0 0 0 10.6674 0 0 0 U3NDA6 U3NDA6_PIG Potassium channel subfamily K member KCNK3 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] open rectifier potassium channel activity [GO:0005252] ARYNLSQGGYEELER 0.96769 75.141 9.82849 10.7702 0 0 0 11.0078 10.0116 8.7649 9.83525 8.28086 6.19798 0 6.15759 9.57232 9.45282 8.98746 0 0 11.3671 6.06374 0 1.92744 9.21975 0 8.03897 0 0 6.8089 7.93634 0 5.8283 9.03397 6.44669 0 0 0 0 5.90338 0 0 0 0 7.14241 0 0 7.63706 9.98897 4.18927 10.9685 8.48675 0 0 6.17708 0 0 0 6.51641 0 0 7.38672 0 0 0 V5LWL1 V5LWL1_PIG "Beta 1,4 N-acetylgalactosaminyl transferase" Sus scrofa domesticus (domestic pig) cellular nitrogen compound metabolic process [GO:0034641]; lipid glycosylation [GO:0030259] Golgi membrane [GO:0000139] hexosyltransferase activity [GO:0016758] DLVTIATKTFLRPHK 0.95751 167.7 7.83649 9.63221 7.03496 9.4165 12.2043 7.15381 0 6.97108 12.7226 9.2033 7.50343 8.56925 9.40256 12.0093 10.4339 9.15575 10.2254 8.36755 9.38528 0 9.96392 9.71636 8.89945 9.53411 7.50494 7.57539 5.41044 9.63205 12.0209 9.00397 9.7549 9.29854 11.7193 5.87607 6.4545 0 9.8827 7.53403 8.76198 5.94811 8.91202 8.51684 7.92807 0 9.66131 6.08697 10.097 7.6605 6.46313 5.95093 7.87738 0 7.83586 8.65413 9.12812 5.65647 8.81272 6.84587 8.6249 10.4945 9.47936 8.14766 6.28683 V9VIB0 V9VIB0_PIG BMP/retinoic acid-inducible neural-specific protein 1 Sus scrofa domesticus (domestic pig) negative regulation of mitotic cell cycle [GO:0045930]; nervous system development [GO:0007399]; positive regulation of neuron differentiation [GO:0045666] cytoplasm [GO:0005737] CEPQNVDSER 0.9682 311.55 9.77983 7.62022 9.74886 11.95 10.9928 9.51122 10.0303 10.1719 10.8898 11.1957 10.576 11.1349 11.6924 11.3948 12.443 11.3001 11.7121 11.1169 10.7323 10.3412 11.6951 9.81705 11.6038 10.5705 7.32544 8.43996 10.7957 10.6291 8.24365 9.8047 12.5621 12.4997 10.0486 8.9808 11.4174 10.8107 10.4891 0 11.6745 9.22487 10.0783 10.2716 9.46267 15.7271 8.93837 9.38733 9.6148 0 9.57733 9.88238 9.62682 10.8517 9.11801 7.94169 9.02434 9.67248 9.47921 9.56322 0 8.39146 7.8301 9.62288 8.85178 W0FER3 W0FER3_PIG steroid 11beta-monooxygenase (EC 1.14.15.4) (Cytochrome P450C11) CYP11B Sus scrofa domesticus (domestic pig) steroid biosynthetic process [GO:0006694] mitochondrial inner membrane [GO:0005743] "heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" AALAPKAVLPFEAIPQCPGNKWMR 0.97364 196.69 10.823 6.89166 6.7174 10.2334 9.00158 9.16659 10.6568 9.25297 9.54634 0 11.0093 6.34928 6.96751 6.85175 10.2395 11.3045 6.0191 8.31985 10.9116 9.57852 9.45082 10.5863 8.63554 9.46797 9.02782 9.8099 8.74126 10.139 9.61892 9.98385 5.96035 7.99882 5.55701 10.2073 0 10.5252 8.61563 0 6.81429 8.84797 0 4.06755 10.7958 9.44072 10.5717 8.96725 10.3282 0 9.20521 5.82774 7.12547 7.37816 9.71663 8.7949 6.59249 0 7.24869 9.60705 8.55899 5.11241 0 0 4.57598 W5IDB8 W5IDB8_PIG "Large ribosomal subunit protein uL22m (39S ribosomal protein L22, mitochondrial)" Sus scrofa domesticus (domestic pig) translation [GO:0006412] large ribosomal subunit [GO:0015934]; mitochondrion [GO:0005739] structural constituent of ribosome [GO:0003735] DHNVEFR 0.95985 98.706 8.94155 0 0 5.9565 9.69997 10.028 8.60911 0 9.73877 8.19727 5.13922 7.32094 6.71315 10.1347 7.51286 7.23372 7.89312 0 0 8.70698 0 5.28961 9.63132 10.8361 9.57346 0 7.05333 9.09719 9.22526 7.10476 9.78602 0 7.36168 6.41139 0 7.78673 0 0 8.3267 5.40334 8.83835 7.98442 12.3773 6.31303 8.78934 8.02713 0 0 9.31134 9.53964 9.0204 6.50949 0 0 0 0 0 0 0 0 0 0 8.53768 W5IDB9 W5IDB9_PIG "Large ribosomal subunit protein uL23m (39S ribosomal protein L23, mitochondrial)" Sus scrofa domesticus (domestic pig) translation [GO:0006412] ribosomal subunit [GO:0044391] structural constituent of ribosome [GO:0003735] DHRNIRIK 0.9823 35.103 11.6196 6.76726 11.2817 13.8501 0 14.3376 0 0 13.7559 0 12.6511 0 0 0 6.48631 0 0 0 12.5917 3.96477 0 0 0 13.5953 0 0 12.4592 0 0 7.29149 0 12.3467 0 10.9463 11.1226 8.52066 11.2863 0 12.12 0 0 0 0 9.19286 0 0 6.01431 0 11.9097 12.7446 0 9.94889 9.91474 9.99506 0 0 0 0 10.1024 0 0 0 0 W5IDC0 W5IDC0_PIG "Large ribosomal subunit protein mL62 (EC 3.1.1.29) (Peptidyl-tRNA hydrolase ICT1, mitochondrial)" Sus scrofa domesticus (domestic pig) mitochondrion [GO:0005739]; ribosome [GO:0005840] translation release factor activity [GO:0003747] AAARCLR 0.97249 183.24 7.8708 8.6915 0 10.332 10.7291 9.90727 9.68568 9.32986 0 0 10.5989 9.02112 11.3921 11.1176 11.6111 10.6752 8.64749 0 9.78436 10.0541 7.52709 9.67673 12.5486 11.5839 0 9.68897 5.95073 9.98655 11.0945 10.396 8.1205 10.725 3.17228 11.2116 0 7.84499 0 11.09 7.66775 9.06164 7.56484 9.58868 10.3232 0 7.7174 6.18051 0 7.67186 8.00045 7.21062 0 9.44535 9.99181 0 7.36466 7.61169 7.3984 0 0 7.1036 0 8.27645 8.21965 W5IDC1 W5IDC1_PIG "Large ribosomal subunit protein bL34m (39S ribosomal protein L34, mitochondrial)" MRPL34 Sus scrofa domesticus (domestic pig) translation [GO:0006412] ribonucleoprotein complex [GO:1990904]; ribosome [GO:0005840] structural constituent of ribosome [GO:0003735] AFLARSVGR 0.96364 46.239 0 0 0 10.4789 2.69437 0 0 0 8.61622 0 7.17592 5.77971 9.56872 3.77947 9.72381 0 0 0 8.53877 10.0841 0 3.10883 0 0 0 0 0 8.69206 0 3.39985 0 0 0 0 0 0 0 0 0 5.83405 3.78063 0 0 4.1631 0 9.05004 0 0 0 9.388 0 0 4.9574 0 0 0 0 0 0 0 0 3.28679 0 W5TZE9 W5TZE9_PIG Guanylate binding protein 1 GBP1 Sus scrofa domesticus (domestic pig) innate immune response [GO:0045087] GTP binding [GO:0005525]; GTPase activity [GO:0003924] AEAAQAAAKMLEEMQIR 0.79114 323.31 12.7363 10.2932 11.4756 12.8594 11.2312 11.2334 11.7149 12.9299 8.97968 10.0058 11.7237 9.8649 10.5559 12.0729 10.7381 11.1259 11.6036 11.4504 12.3383 9.84196 10.6582 9.62203 9.77965 13.0661 10.586 0 8.70297 10.7152 11.4278 10.1261 10.7086 11.1394 11.8389 11.7432 11.7199 7.87166 11.6826 11.7707 5.46218 8.46968 11.0182 9.04226 10.2628 7.68152 9.72007 10.2832 9.74047 9.28195 11.8396 10.6075 6.2844 11.1638 10.8215 7.61743 10.8852 11.8432 11.1756 10.8442 9.39021 9.70257 9.20442 9.77388 9.66654 W8EHH3 W8EHH3_PIG NADH-ubiquinone oxidoreductase chain 6 (EC 7.1.1.2) ND6 Sus scrofa domesticus (domestic pig) mitochondrial membrane [GO:0031966]; respirasome [GO:0070469] NADH dehydrogenase (ubiquinone) activity [GO:0008137] EEEVETIFK 0.99486 8.7302 10.3307 10.2544 10.3485 0 11.4091 11.2041 11.243 0 6.27346 0 0 0 11.1999 11.217 0 10.4329 0 10.3243 0 0 10.3874 11.0843 11.1968 0 0 8.98519 9.84043 11.4038 0 11.2004 11.645 0 11.4382 11.3247 11.3453 11.098 11.5209 0 11.664 10.1677 0 9.95826 9.92601 10.0433 9.83916 10.6221 0 0 10.9872 10.9716 11.0338 10.1872 10.1483 10.2029 0 11.0625 11.0719 9.82715 9.63959 0 0 9.7261 9.74693 W8EMY0 W8EMY0_PIG ATP synthase protein 8 ATP8 Sus scrofa domesticus (domestic pig) proton motive force-driven ATP synthesis [GO:0015986] "mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) [GO:0000276]" proton transmembrane transporter activity [GO:0015078] LKNMAPLEK 0.98272 34.858 0 0 0 0 0 0 8.54063 8.81823 0 0 0 0 0 0 0 0 0 0 7.12381 0 0 0 10.2586 0 0 0 0 10.0366 9.64667 6.3879 5.71768 4.88972 0 0 0 0 0 0 0 6.85037 0 0 0 0 8.18388 0 0 9.30019 0 0 9.37523 0 0 8.30044 0 0 7.23161 0 0 0 0 0 0 W8PW88 W8PW88_PIG SLIT and NTRK-like protein 1 SLITRK1 Sus scrofa domesticus (domestic pig) axonogenesis [GO:0007409]; regulation of presynapse assembly [GO:1905606] membrane [GO:0016020] CETPVNFFRK 0.95276 159.15 11.3249 0 11.041 10.9087 11.7452 9.97384 0 9.79823 11.1202 11.2329 11.831 8.31356 11.4956 12.0187 11.8636 10.909 8.49129 10.037 8.95207 10.6102 11.204 11.9781 9.94746 11.6385 10.4025 9.73892 10.3156 11.3078 12.5714 7.43754 12.0048 10.3907 12.2358 11.8471 0 10.8567 11.4509 8.56586 11.658 10.0229 10.1457 9.92089 10.8664 10.4913 9.97528 8.92873 11.2752 11.4985 5.72787 11.2297 11.5576 10.1744 7.13822 9.6973 0 7.62775 10.6723 11.2895 0 11.4337 7.00428 9.46858 8.93097 W8PWU9 W8PWU9_PIG SLIT and NTRK-like protein 6 SLITRK6 Sus scrofa domesticus (domestic pig) axonogenesis [GO:0007409]; regulation of presynapse assembly [GO:1905606] membrane [GO:0016020] ASASARGSCDSLCNCEEK 0.959 199.87 9.81649 11.9338 10.4215 11.1578 7.7828 10.4952 11.3689 8.85094 10.7772 13.0676 12.9924 12.0523 11.5179 13.5459 12.0851 10.2544 11.0071 9.92261 12.7514 11.6299 9.50227 13.7556 12.509 9.50359 11.0331 11.066 9.06086 5.64685 9.35233 9.30383 0 8.14017 8.96887 8.16988 5.8365 9.50561 8.18933 6.67948 9.16113 0 6.96671 8.85783 8.33512 9.14929 6.18076 9.28834 9.68342 10.3603 7.14659 9.83256 8.97154 6.8382 10.5226 0 7.17403 7.71026 5.7165 10.8738 8.41574 7.60666 4.88274 0 0 W8QLQ9 W8QLQ9_PIG Anoctamin Ano1 Sus scrofa domesticus (domestic pig) membrane [GO:0016020] protein dimerization activity [GO:0046983] AEYEARVLEK 0.99766 4.0961 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7.01892 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0