Protein best hit	ID detail best hit	Peptide	ID Score	KD_FNS_1 Int (Treated)	KD_FNS_2 Int (Treated)	KD_FNS_3 Int (Treated)	KD_LNS_1 Int (Treated)	KD_LNS_2 Int (Treated)	KD_LNS_3 Int (Treated)	MT2_FNS_1 Int (Treated)	MT2_FNS_2 Int (Treated)	MT2_FNS_3 Int (Treated)	MT2_LNS_1 Int (Control)	MT2_LNS_2 Int (Control)	MT2_LNS_3 Int (Control)
label				KD_FNS	KD_FNS	KD_FNS	KD_LNS	KD_LNS	KD_LNS	MT2_FNS	MT2_FNS	MT2_FNS	MT2_LNS	MT2_LNS	MT2_LNS
gi|1002227274	protein IQ-DOMAIN 14	YMAGTASSAAR	10.51000023	17.07941	17.32313	17.51199	17.36197	17.27066	17.37365	17.28839	17.13528	0	16.95364	17.01494	16.84494
gi|1002227580	fimbrin-2	QMNASYIISVARK	9.850000381	17.04829	16.87387	16.89049	17.3715	17.28774	0	17.09235	17.91586	16.77849	16.48985	16.50268	16.09566
gi|1002228437	uncharacterized protein LOC107280842	YKMDNGATDGEVVDK	14.47000027	17.84557	18.04726	18.021	18.49731	18.46797	18.43468	18.14911	18.20275	18.07701	17.15176	17.27386	17.24987
gi|1002230781	protein ROS1	YIPQTGSCQLQSLEHDMVK	12.23999977	18.39608	18.4558	18.4146	18.77791	18.70742	18.8048	18.79922	0	18.79543	17.94157	17.9596	17.98811
gi|1002230947	probable receptor-like protein kinase At5g39020 isoform X2	LVHPSGAASMDQRSAK	7.599999905	17.38539	17.6129	17.4138	17.75129	18.0821	18.23354	17.34671	17.05943	16.97162	0	16.17314	16.14274
gi|1002230974	"ATP-dependent Clp protease proteolytic subunit-related protein 4, chloroplastic"	DVVAMVVPFLR	11.80000019	0	14.13824	0	14.69315	0	15.12145	15.29334	14.72663	15.29718	15.56247	15.734	15.44321
gi|1002231743	callose synthase 7 isoform X4	APQVRSMMSFSVLTPYFK	5.320000172	14.60734	14.56037	14.5723	15.20574	15.17576	15.10691	14.2468	13.95612	14.32912	13.14412	12.95291	12.92135
gi|1002232225	protein DDB_G0276689 isoform X3	NKSASEK	10.52999973	16.36171	14.41973	14.46695	16.64228	13.96965	14.18828	16.3997	14.71462	14.70148	16.45732	16.48874	16.63214
gi|1002235443	DNA ligase 3	TMLAASK	6.5	0	19.40108	19.44762	19.22471	19.37007	0	0	19.20172	19.19085	18.74934	18.98326	0
gi|1002235461	protein root UVB sensitive 6	APTVGIKR	25.12999916	16.33237	16.31539	16.3532	16.16394	16.1531	16.19447	16.41283	16.41462	16.38824	16.58727	16.58047	16.53495
gi|1002235949	chaperone protein dnaJ 15	MEGPSAPAMRR	13.88000011	16.89268	17.08835	16.86127	17.45022	17.36022	17.3032	16.85757	16.72532	16.59148	15.84892	15.71063	16.02527
gi|1002236984	pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha	CGAAPISSMMTVKRWSRGPAATQIGKPAVHMATVDLK	11.31000042	17.69425	17.44934	17.68785	0	18.43323	18.42828	18.33116	18.3549	18.36051	16.10217	15.8652	15.25832
gi|1002238086	G-type lectin S-receptor-like serine/threonine-protein kinase At5g35370	LRIVKLGVEGK	11.43999958	13.9571	12.59219	11.0795	17.62224	17.56003	15.65468	8.803547	7.044686	8.551451	5.463809	5.787561	5.97653
gi|1002238246	probable polygalacturonase	SLVSAGISIGSEMSGGIANVTVEDVR	18.13999939	19.58125	19.58544	19.59201	19.58986	19.62902	19.62546	19.75038	19.6548	19.65978	18.58611	18.59016	18.58424
gi|1002238994	remorin isoform X3	AQKKMSSILSWENTR	16.27000046	19.39056	19.40898	19.44123	18.92244	18.96898	18.99975	19.39772	19.3562	19.32447	19.68049	19.70621	19.67842
gi|1002239334	protein trichome birefringence-like 19	NNLPLPK	9.640000343	18.44057	18.24721	0	18.37871	18.04015	18.1744	18.2618	18.26589	18.21486	17.95869	17.68159	17.06923
gi|1002239619	glutelin type-B 2-like	FPILNIIQMSATR	76.72000122	20.72574	20.73694	20.71832	20.8948	20.86977	20.89228	21.14452	21.15705	21.12664	19.61151	19.58017	19.57892
gi|1002240098	wall-associated receptor kinase 5	GGNGTVYR	13.86999989	19.58666	19.56718	19.51571	20.38041	20.36299	20.37685	19.65263	19.74154	19.61616	18.57586	18.62123	18.62132
gi|1002240387	uncharacterized protein LOC107280008	VGVLNSR	6.78000021	18.06169	18.04484	18.14949	17.98707	17.87475	17.94797	18.02392	17.99904	17.93568	17.99516	17.89485	17.56218
gi|1002241535	protein ROS1-like	NVTHVPSK	7.619999886	17.38174	17.27237	17.29395	17.42716	17.52662	17.40972	17.55721	17.28957	17.12902	17.01849	16.50777	16.45094
gi|1002242400	ultraviolet-B receptor UVR8	NDEGQLGR	7.559999943	17.19423	17.30002	17.23532	17.34123	17.8003	17.68045	16.95293	17.30258	17.28772	16.87607	16.47049	16.51092
gi|1002242483	protein TONSOKU	ARMITAWPKLKEFSK	13.39999962	17.78995	0	17.8466	18.45615	18.48249	18.44792	17.97356	17.96171	17.83566	16.77142	16.62211	16.70609
gi|1002242647	peroxidase P7	DSTTASK	11.47000027	0	14.20373	13.63719	16.53899	15.22179	18.2293	13.5348	13.38308	12.95178	11.74123	12.04699	11.89416
gi|1002244705	protein trichome birefringence-like 19	ASYASGGGGGAACDVAR	5.579999924	17.39054	0	17.33385	17.55107	17.57064	17.67674	17.35205	17.3539	17.25821	16.5564	16.55924	16.48722
gi|1002245955	DNA excision repair protein ERCC-8 isoform X3	RQMDFVVDEDNWSD	9.770000458	17.99947	18.14377	18.13056	18.86541	18.82215	18.96964	18.56528	18.48214	18.41895	17.33805	17.4549	17.41969
gi|1002246540	glutelin type-A 1-like	EGFAWVSFK	48.79999924	18.35015	18.30937	18.32368	18.79823	18.82982	18.8344	18.61384	18.65717	18.65538	17.34826	17.3182	17.30552
gi|1002251712	synaptotagmin-5-like	MGFISGVVMGMIIGVALIAGWSR	13.43000031	18.71359	18.68541	18.67524	18.95022	18.94084	18.9418	19.16708	19.22501	19.17792	17.35921	17.3572	17.3247
gi|1002258166	cytochrome b561 and DOMON domain-containing protein At3g07570	KHGLLAMMAWGVLMPLGMMAARYFR	12.60000038	15.82269	15.25667	14.99679	17.61441	17.51281	17.40496	16.04633	16.02438	15.66812	13.45135	13.06621	12.67277
gi|1002260011	putative RING-H2 finger protein ATL50	QIPRPIVALFK	14.21000004	15.57301	15.56336	15.68089	16.32546	18.30945	0	15.859	15.40599	15.60586	14.69572	14.87592	14.50916
gi|1002260688	salt stress-induced protein-like	HGGGQLK	3.220000029	18.06552	18.02073	17.96977	18.02462	18.23113	18.18921	18.02601	18.02572	17.51948	0	17.78412	17.36693
gi|1002261272	alpha-L-arabinofuranosidase 1-like	DILDSLEFARGSTNSTWGSLR	10.90999985	17.68958	17.6078	17.68006	18.71659	18.71882	18.70785	18.26901	18.22196	17.93041	17.11152	17.04782	17.17641
gi|1002261310	WAT1-related protein At1g68170	TKMTWRVLMLSFVCGLSGGSLAQNLYISGMK	7.460000038	14.86416	17.26417	17.23468	15.65647	16.03143	15.51875	15.6923	18.37852	18.29635	14.3812	14.16065	14.72338
gi|1002261603	receptor-like serine/threonine-protein kinase SD1-8	DASGGCRR	16.69000053	17.26401	17.25855	17.24464	17.46432	17.39472	17.28431	17.39665	17.1688	17.17851	16.96348	16.69664	16.22329
gi|1002265466	BTB/POZ domain-containing protein At5g03250	LGLGGRSAARR	14.61999989	18.55872	18.49877	18.5176	18.4832	18.36861	18.47152	18.49691	18.57169	18.49978	18.64224	18.65937	18.60369
gi|1002265996	probable ubiquitin-conjugating enzyme E2 26	DIADGPSTFKSMAELDADITKK	16.18000031	18.27035	18.28791	18.26713	18.60898	18.49336	18.54011	18.65428	18.71761	18.67029	16.90279	16.73411	16.69998
gi|1002268263	prolamin PPROL 14E-like	QYQLQSPLLLQQHVLSPYNEFVR	50.56000137	19.15468	19.0138	18.76118	20.13196	19.97426	20.00534	18.92649	19.3907	18.80918	17.24031	17.03732	17.2747
gi|1002268791	ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X3	HLSVLLA	10.65999985	18.78089	18.69078	18.74032	18.63656	18.67282	18.69114	18.73681	18.76463	18.77088	18.41773	18.38659	18.40999
gi|1002270230	E3 ubiquitin-protein ligase KEG-like	AVHWQADPSDMEK	8.210000038	18.42259	18.39916	18.38842	18.74487	18.74989	18.74044	18.98312	19.01089	18.99112	17.18673	17.1395	17.07735
gi|1002270856	dual specificity protein kinase shkB isoform X2	LQRQKLPLEK	15.06999969	18.80345	18.73397	18.71915	19.09096	18.94504	18.99619	18.76652	18.91659	18.6657	17.81903	17.33294	17.41238
gi|1002271619	histone deacetylase 8	GLGYNLNIPLPNGSGDAGYEYAMNELVVPAIEK	8.359999657	19.2716	19.25149	19.22948	19.93651	19.51074	19.92126	19.6219	19.62891	19.60355	18.52049	18.47254	18.45448
gi|1002272423	ecotropic viral integration site 5 protein homolog	VEEKQSPASGNQDTK	15.10999966	18.82356	19.12365	19.14514	19.71781	19.66216	19.73186	19.43736	19.40541	19.47442	18.58551	18.60675	18.58712
gi|1002274753	"crocetin glucosyltransferase, chloroplastic"	SVGEMVDALAAR	13.82999992	18.62646	18.6486	18.60683	19.3096	19.29436	19.29948	18.50943	18.58918	18.47474	17.32531	17.25036	17.23428
gi|1002276486	galactoside 2-alpha-L-fucosyltransferase	MSGWASPSRMYASKGSKR	11.47999954	0	0	0	17.25892	0	17.31738	18.54946	18.54942	18.51307	13.38023	13.00172	17.25488
gi|1002277061	pre-mRNA-processing-splicing factor 8	RLGQLAKWK	9.93999958	16.05344	17.08386	17.18192	17.26132	17.14597	17.21524	17.379	16.26947	16.34854	16.29095	16.06239	15.91994
gi|1002278964	serine/arginine-rich splicing factor SR45a	SPVPDPR	6.03000021	16.08961	16.49404	16.14124	16.43996	16.75232	16.63557	16.37734	16.64358	16.49343	15.82949	15.78011	15.84527
gi|1002279282	GDSL esterase/lipase APG	VYLCNPATAGLCR	13.25	18.14034	18.05521	17.79349	18.38654	18.27446	18.30314	18.24651	18.03814	18.75035	16.9846	16.77769	16.5509
gi|1002279467	"probable cyclic nucleotide-gated ion channel 20, chloroplastic"	RLEMQLRRR	7.650000095	16.38132	15.2474	14.75666	18.03344	17.83134	18.03211	0	14.6298	14.39891	13.03873	12.77433	12.72524
gi|1002279822	pentatricopeptide repeat-containing protein At5g39710	MADAAAAAAGGGGSHR	10.78999996	17.5383	17.43729	0	17.48382	17.52727	17.6508	0	17.36026	17.07334	17.08758	16.78438	16.53065
gi|1002279928	pectate lyase	FRASDDMKLK	8.720000267	16.47353	16.72348	16.46644	17.25643	17.22674	17.10117	13.96515	17.29195	14.15361	13.54363	13.31965	13.10114
gi|1002281080	COP9 signalosome complex subunit 7 isoform X4	MAMDAER	14.18999958	19.22587	19.32265	19.30449	19.83397	19.79974	19.75291	19.34161	19.29411	19.20529	18.45136	18.37347	18.66252
gi|1002282446	cytochrome P450 709B1	AQAVGGPGYRFFSGNLGEIR	9.069999695	13.83868	14.17018	13.44997	17.69626	15.93518	15.61716	13.47532	17.4418	14.37205	13.22085	11.26274	0
gi|1002283270	extensin-like	LAVANPR	17.04999924	14.52649	16.96645	13.41648	18.34582	17.30739	17.02204	18.6863	12.965	12.48385	11.58901	10.73635	11.17412
gi|1002285232	protein N-methyltransferase nnt1 isoform X2	MADSGSASERREEGKK	13.78999996	18.97874	19.08886	19.11403	19.40004	19.36016	19.50032	0	19.2287	19.15518	18.35288	18.42659	13.10819
gi|1002285852	probable glycosyltransferase At5g03795	VLCNANTSEGFDPSR	18.15999985	20.03391	0	19.97205	20.42382	20.51051	0	20.10502	20.05446	19.86227	19.20243	18.98875	18.43905
gi|1002287345	disease resistance protein RGA2	GIGNLHR	14.15999985	18.2237	18.22973	18.33194	17.89888	18.05497	17.97052	18.15522	17.89524	17.96885	0	17.79407	17.34647
gi|1002287563	histone deacetylase 6	SFNIPMMVLGGGGYTIRNVAR	15.01000023	18.04138	18.10474	18.03305	18.46069	18.48327	18.52699	18.30626	18.52583	18.02673	17.09057	17.30055	17.24634
gi|1002287618	pentatricopeptide repeat-containing protein At3g59040	EPLPRDAVLGTLMRFKQLK	10.48999977	18.06837	18.13666	18.2077	18.57345	18.52658	18.68939	18.5012	18.50809	18.47629	17.90144	17.92169	17.8814
gi|1002288736	pentatricopeptide repeat-containing protein At4g22760	GRAGAHSFLVSR	10.34000015	13.79432	12.75721	12.08868	18.48638	18.55778	18.57162	14.93916	14.30674	11.72121	10.90276	10.64058	10.77353
gi|1002288955	glutelin type-A 1-like	GQMVVVPQSFAVAGR	35.97000122	16.97293	17.38711	17.47395	15.54726	15.30566	15.72438	14.01989	18.71677	13.89298	13.08779	12.82173	11.85881
gi|1002289648	ctenidin-1	VGVGGCGGGGGGGGKEAAAAR	15.60000038	19.24215	19.27806	19.24565	19.73133	19.7211	19.6473	19.44114	19.39079	19.35976	18.97075	18.90184	19.01223
gi|1002291242	far upstream element-binding protein 1	GGMGWDQR	10.06000042	14.14616	14.16973	13.83268	14.40245	14.38611	14.43605	14.55079	14.53756	14.53532	15.29196	16.15467	14.34838
gi|1002291612	protein ELF4-LIKE 4	SSGGGGGK	0.050000001	17.82083	17.86411	17.73275	18.46038	18.43753	18.38038	17.65506	17.5957	17.4694	16.46285	16.23231	16.46627
gi|1002294088	ankyrin repeat-containing protein At5g02620	HTIIMFVRR	11.06000042	16.86578	17.36246	17.21184	17.11649	16.73395	17.11862	16.73198	16.38	16.30563	16.42711	15.712	16.1606
gi|1002294960	"probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8"	LLAMESLLETYPALR	18.04999924	18.31393	18.33053	18.31593	19.49563	19.48029	19.48421	18.37505	18.41229	18.40903	16.35475	16.29754	16.28015
gi|1002295499	basic 7S globulin-like	AVAMPVVRDGATR	12.18999958	17.85389	15.76943	18.06352	18.70915	18.68932	18.71431	16.83679	16.82203	15.19307	15.25665	15.1574	14.72211
gi|1002297131	phosphoenolpyruvate carboxylase 2	MSAMSAAGGGGGVGK	5.630000114	13.23294	13.45937	16.8597	16.93414	14.95386	14.41185	12.86647	13.34034	12.75236	11.32948	11.11111	10.64433
gi|1002297336	ETHYLENE INSENSITIVE 3-like 3 protein	GKPISDQAMRK	6.610000134	18.25714	18.37353	18.45872	18.44724	18.26417	18.38969	18.3603	18.29559	18.11367	17.29846	17.39556	17.40488
gi|1002297807	S-adenosylmethionine decarboxylase proenzyme	GMFIFPGAQPSPHR	9	17.82124	14.57448	17.79192	17.6274	17.91605	17.86509	17.33955	18.01114	18.00832	15.17172	15.09342	14.4789
gi|1002297928	"DNA-directed RNA polymerases II, IV and V subunit 3"	DTDASMANALR	12.35000038	0	17.42025	17.28461	17.6379	17.44579	0	17.34171	17.09705	17.22892	17.20833	16.9687	16.56925
gi|1002298368	F-box protein At1g47056	APEVTDVGLGK	44.24000168	18.43099	18.4008	18.44537	19.07979	19.18754	19.16436	18.70343	18.67635	18.64983	17.974	17.8155	17.91997
gi|1002298677	protein DETOXIFICATION 16 isoform X2	MATAMDTLCGQAYGAR	3.980000019	15.35838	16.9829	14.29432	17.39872	17.04118	17.08227	13.66623	17.33226	12.9114	11.3005	10.98263	11.23584
gi|1002305960	probable WRKY transcription factor 3	SSAASSK	8.140000343	16.84228	16.89869	16.89045	16.82522	16.91468	16.90854	17.38033	17.24013	17.35603	16.74833	16.45537	16.78947
gi|1002308117	cell number regulator 13	LKMIGDLLK	13.60999966	16.60214	16.40095	17.30077	0	0	0	0	16.37303	15.79	0	14.19883	13.95365
gi|1002308346	F-box/WD-40 repeat-containing protein At3g52030 isoform X1	RGPGGGGGGSGSTAQALNDDTLR	11.06000042	18.05494	18.09248	18.04321	18.53442	18.54092	18.5452	18.13793	18.21638	18.14557	16.70534	16.68185	16.66739
gi|1002308906	putative disease resistance protein RGA4	VEMLSNLRYLNLSQTDIDK	15.23999977	0	18.50272	18.23155	19.32372	19.14897	19.16604	18.91615	18.597	18.42711	17.82319	16.30303	16.70107
gi|1002312648	structural maintenance of chromosomes protein 1	IKEDAGMSTAK	6.480000019	17.83007	17.81486	17.84174	17.80978	17.76523	17.85772	17.61923	17.66401	17.45775	17.38421	17.33422	17.09505
gi|1002312890	serine/arginine repetitive matrix protein 1-like isoform X1	LPSHTGR	1	18.37344	18.16211	18.39587	18.46168	18.60428	18.55846	18.33526	18.17421	18.46011	17.91282	17.90291	17.79905
gi|108705848	"pentatricopeptide, putative, expressed"	MEVGMVDGKLLESVSEVDKK	17.63999939	18.05729	18.02931	18.07762	17.95404	0	18.05111	17.83518	17.65399	17.54023	17.08118	17.01611	16.88276
gi|108705950	expressed protein	YFGGGMK	8.829999924	14.97433	15.07349	15.29682	15.20591	15.17287	16.05125	15.87456	15.33402	16.25726	16.49543	15.81571	16.36805
gi|108706671	"Cupin family protein, expressed"	GFEVEVLRPGFGVPR	13.30000019	18.26545	18.18486	18.1889	18.72395	18.76382	18.78036	18.20343	18.27528	18.32808	17.51819	17.45881	15.30535
gi|108706744	"CUE domain containing protein, expressed"	LLDLPKLLDICAIYGHDNCK	10.77999973	17.45442	17.34054	17.25757	18.97803	18.86895	19.06918	18.17322	18.05169	17.8017	15.91011	15.79751	15.71454
gi|108706796	"cp protein, putative"	GKLSAIEGMK	16.79999924	0	17.02705	15.73679	0	0	0	15.27793	15.14151	14.45156	13.27641	12.91187	12.9717
gi|108707230	"zinc finger family protein, putative, expressed"	GNAGSNGGGGSPGHR	13.89999962	18.32823	18.28516	18.34267	17.91394	17.66262	17.72518	18.37707	18.3675	18.10914	17.62037	17.56328	17.45596
gi|108707364	"lipase, putative, expressed"	GGKKSSK	0.850000024	17.56872	17.54086	17.41465	17.46464	17.64337	17.75513	17.40189	17.12339	17.32572	17.08629	17.0214	16.61002
gi|108707991	"possible Photosystem II reaction center Psb27 protein, putative, expressed"	ALQASRRELVVAAAAVALWPCGGAAR	17.45999908	15.9547	15.83886	15.84346	18.51547	18.4027	18.36864	17.58601	17.57144	17.54275	15.17799	14.78197	14.61393
gi|108708272	"transposon protein, putative, CACTA, En/Spm sub-class"	GMSAPVK	2.849999905	13.88436	13.96715	14.07514	14.45748	14.15165	14.42983	14.61672	14.47924	14.84132	14.95967	14.72454	14.68643
gi|108708632	"retrotransposon protein, putative, Ty1-copia subclass"	GLKGLLVHEMVDGIR	7.710000038	18.49839	18.43872	18.46729	19.36338	19.36748	19.34431	18.78276	18.89251	18.7981	17.57438	17.49664	17.37675
gi|108710641	"Mitogen-activated protein kinase 1, putative, expressed"	RGADASSMDSSSR	9.699999809	18.61402	17.91473	17.94968	18.49376	16.66787	0	19.07913	19.05123	18.97226	17.69458	14.92186	17.59065
gi|108710937	"retrotransposon, putative, centromere-specific, expressed"	KMDGASK	11.53999996	18.70077	18.64326	18.70926	19.09883	19.09029	19.07165	19.16039	19.18843	19.15782	17.39338	17.25616	17.32763
gi|108711062	" HTH DNA-binding protein, putative, expressed"	GQGMAFLVGGGSVMQKILAPR	15.19999981	19.23899	19.25423	19.24373	20.16914	20.17352	20.17867	19.21681	19.28733	19.2308	17.34789	17.34121	17.34981
gi|108711277	hypothetical protein LOC_Os03g55940	FEILAAIVDR	28.80999947	15.71201	16.0629	15.96762	17.79259	16.08152	16.55844	15.98229	15.48631	15.8332	14.92964	14.95825	14.99082
gi|108711408	"retrotransposon protein, putative, Ty1-copia subclass"	SQVAGAPTAAAAWK	20.43000031	16.74394	17.35405	16.58562	17.05283	16.79456	16.52792	16.96371	16.88415	16.75891	16.39632	16.5085	16.3638
gi|108862388	"PDR-like ABC transporter, putative, expressed"	RGISGGEMKRLTTEGHNTR	11.02000046	17.88032	17.97576	17.96703	18.53838	18.51788	18.48933	18.15452	0	18.11255	16.52297	16.41176	16.40866
gi|108935877	Prolamin PPROL 17D	QQCSTVATPFFQSPVFQLR	32.49000168	15.68604	15.38232	15.21253	17.12253	16.58915	16.95615	17.93873	16.29527	15.46791	13.80111	13.68794	13.67479
gi|110288524	Transferase family protein	ACLLMTMNARGK	10.11999989	15.58989	15.32524	15.35527	15.66616	15.966	15.8134	15.45591	15.70128	15.60036	15.14064	15.30281	15.33423
gi|110288671	"transposon protein, putative, CACTA, En/Spm sub-class"	IISTKDKKFTNLK	12	18.24048	18.26298	18.29161	18.73303	18.69654	18.6972	18.42356	18.42587	18.41494	17.73142	17.70408	16.5005
gi|110288904	"transposon protein, putative, CACTA, En/Spm sub-class"	TMVAAVEGAVAVVATGRDMDR	12.21000004	19.5939	19.60309	19.57463	20.46062	20.46657	20.46152	19.48335	19.55217	19.49441	17.69127	17.59305	17.57083
gi|110289429	" hydrolase, alpha/beta fold family protein, expressed"	AVMPPPPR	21.87000084	14.46245	13.89762	13.93222	15.62395	14.70124	14.80886	14.63457	14.63385	13.76656	15.97113	16.85899	16.00327
gi|110808553	Hexokinase-3	VEQQPIPEELTK	7.71999979	17.43676	17.46411	17.49281	0	18.00583	17.96799	17.72333	17.6918	17.69981	16.56359	16.32595	16.3486
gi|11138070	OSJNBa0036E02.17	YSKSGRSEAEEIAAAEAQR	8.590000153	17.15355	17.18438	17.17809	17.38375	17.34766	17.32689	17.84288	17.87831	17.79209	16.14582	16.04147	16.02517
gi|113532921	Os01g0575500	ISMLPRTIR	14.32999992	16.92989	16.17931	15.44535	0	18.34306	18.50486	15.20916	15.0309	17.81029	13.95165	13.79235	13.56138
gi|113535317	Os02g0130900	LSPSAMI	9.619999886	17.58994	18.00889	17.8958	17.78431	18.00319	17.98685	18.07075	17.83405	17.6312	17.35835	17.37535	16.95294
gi|113594946	 Os06g0165200	MRGVSIFTTSISFLLALTIALAEDQR	9.449999809	16.59098	16.4445	15.81666	18.33999	18.12997	18.63312	16.86907	16.71955	16.59	14.39702	14.30973	14.62278
gi|113648747	Os12g0165300	RPSSPPLTAGAGR	9.399999619	15.72935	15.76664	15.89786	16.16337	15.70689	16.32592	15.60767	14.38682	15.34331	14.31313	14.22467	14.02138
gi|116309491	OSIGBa0113K06.5	TLVQSVLSSMPTHHLIALQAPK	10.56999969	19.64614	19.64258	19.6799	20.22724	19.80621	20.22806	20.15558	20.14524	20.17484	18.25313	18.20308	18.22344
gi|121475	Glutelin type-A 2	SQAGTTEFFDVSNELFQCTGVSVVR	107.3899994	22.12361	22.09386	22.11475	23.09093	22.99772	22.98902	22.1566	22.19199	22.07632	20.32982	20.29359	20.26861
gi|122207238	"GDT1-like protein 2, chloroplastic"	RREDGAGPPLLLRR	3.5	16.97902	0	17.146	16.88811	17.3106	17.62286	16.64586	17.22714	16.92859	16.36939	16.34007	15.98507
gi|122208319	CBL-interacting protein kinase 15	VAKRGKLTEVVAHK	19.97999954	20.11821	20.15108	20.13479	20.7272	20.73532	20.72846	20.06733	20.07472	20.0507	18.65542	18.60276	18.63402
gi|125524449	hypothetical protein OsI_00429	QNASEDLPGAGLHPR	14.18000031	18.22462	18.1958	18.2189	18.871	18.95614	18.91739	18.60207	18.62628	18.59087	17.06542	16.91683	16.9438
gi|125525480	hypothetical protein OsI_01477	RQPGGSLVVVAVAASPR	19.68000031	21.80215	21.7907	21.77291	22.18803	22.20189	22.17121	21.89309	21.87523	21.86765	21.36094	21.33188	19.48011
gi|125527001	hypothetical protein OsI_03010	MAIIGVTTMDFLVPR	8.720000267	15.73703	15.02568	0	16.93341	16.90792	0	17.00646	14.41437	14.02368	13.34699	13.02801	0
gi|125532012	hypothetical protein OsI_33674	GPMMVGGS	9.819999695	16.43726	17.34476	16.27239	16.93628	17.13497	17.11032	16.54953	16.72976	16.51237	16.07541	15.86316	15.9096
gi|125532538	hypothetical protein OsI_34209	RGLLLLRGGGGLLRR	16.51000023	17.40331	17.15412	17.11306	18.20315	17.85708	17.90052	17.81137	17.84671	18.16843	16.20542	16.07584	15.90765
gi|125534410	hypothetical protein OsI_36139	AAAPAQVAAPLTRR	4.340000153	14.96579	14.64347	14.01202	17.36635	15.99371	15.8364	14.19789	13.08064	19.20172	13.94574	11.2762	9.767121
gi|125546565	hypothetical protein OsI_14455	DGEAARR	10.68999958	17.23893	17.50043	17.32571	18.87425	18.86866	18.84321	17.27748	17.05075	17.23632	16.47907	16.06685	15.47544
gi|125555916	hypothetical protein OsI_23557	VPRAAAGTDRVPR	8.270000458	16.01374	15.40261	14.91824	16.74665	16.68719	16.71974	14.64867	14.44589	13.78867	12.78349	12.86378	12.15552
gi|125557479	hypothetical protein OsI_25157	VKNSFKLPSTRPAAPAAADAKPK	10.46000004	16.55763	16.60398	16.56261	16.94463	16.97163	16.90256	17.29729	17.35261	17.31591	15.288	15.27835	15.23362
gi|125557709	hypothetical protein OsI_25393	SNDLAGIEVVINEMK	18.32999992	18.10289	18.10417	17.50045	18.5831	0	18.76802	18.70052	17.4737	15.80322	14.58965	0	13.94278
gi|125557744	hypothetical protein OsI_25426	KMVEAGSSSGSNR	8.06000042	18.36276	18.51045	18.53102	19.21452	19.15802	19.35537	18.88388	18.88408	18.81434	17.56548	17.62361	17.56398
gi|125558415	hypothetical protein OsI_26087	RWCSMGAK	9.529999733	14.42122	0	13.86176	16.50738	15.86722	15.9095	17.08774	13.72819	13.16852	11.43016	12.12628	0
gi|125558535	hypothetical protein OsI_26210	SASNFAK	11.89000034	18.06159	17.99491	17.98105	17.98139	0	17.84299	18.02102	17.92615	17.8193	17.89085	17.70436	17.67631
gi|125569540	hypothetical protein OsJ_00899	GGAGPAR	1.370000005	17.49144	17.59666	17.78122	17.75875	17.77758	0	17.56918	17.51632	17.55604	17.33559	17.29134	16.88284
gi|125570007	hypothetical protein OsJ_01388	NSIHAYVARAGANVVKVPLR	7.900000095	16.67479	17.7218	16.12581	18.43571	18.37162	18.41322	16.25681	15.71165	14.89067	13.34605	13.67375	12.91673
gi|125570060	hypothetical protein OsJ_01441	RPCGDAAGVGR	9.420000076	16.13958	15.83583	15.7885	16.27612	16.01742	16.01481	16.58571	16.32391	16.25488	15.59103	15.48496	15.59276
gi|125571835	hypothetical protein OsJ_03272	GPALGPDK	17.29999924	20.01696	20.02999	20.01777	20.01213	19.94866	19.99677	20.02465	20.03677	19.9792	20.10909	20.10182	20.08951
gi|125580208	hypothetical protein OsJ_37011	MEKQQQPGEK	23.95999908	18.8774	18.87547	18.85143	19.45463	19.46953	19.46059	18.75658	18.78787	18.71325	17.43233	17.32443	12.68013
gi|125581158	hypothetical protein OsJ_05750	RNLLLLVDLK	16.23999977	20.3757	18.14484	20.36283	20.84563	20.86916	20.85539	20.05458	20.06097	20.03471	19.0042	18.9552	18.93483
gi|125582075	hypothetical protein OsJ_06701	LAGEGRR	10.81000042	17.34858	17.45076	17.29017	17.45493	17.49001	17.65818	0	17.51171	17.4472	17.32753	16.95177	16.66968
gi|125584730	hypothetical protein OsJ_09212	MVEAEATKGPHR	23.07999992	18.61987	18.7213	17.79397	19.38115	18.32378	19.49648	18.95294	18.92869	18.87496	18.06787	18.06746	17.97642
gi|125584862	hypothetical protein OsJ_09350	GDAQMLMTTPRFR	6.210000038	17.78454	17.7562	17.5901	18.31136	17.76292	18.09173	17.75371	18.04235	17.75836	17.58411	17.01322	17.6436
gi|125598594	hypothetical protein OsJ_22749	MSSLAYFMSK	8.899999619	0	0	0	0	17.76859	17.74103	0	0	0	0	16.99179	16.80479
gi|125602503	hypothetical protein OsJ_26367	GREGLAAGGTAAAAAAAQEKGR	13.30000019	15.98577	15.07238	14.25175	18.21791	17.99614	0	13.9843	13.6231	13.08705	12.55366	12.33535	12.48622
gi|13486715	putative polyprotein	LAGQIASLSR	5.480000019	15.32209	0	16.16653	16.77223	16.53915	16.80774	0	15.04041	16.7528	13.69511	13.68674	13.63536
gi|14626298	putative protein kinase	DVKAENMLLDRK	8.909999847	0	16.10423	16.45767	16.50485	14.84543	16.808	12.91254	12.70889	12.02918	10.07495	10.51843	9.432107
gi|148886767	Actin-1	AEYDESGPSIVHRK	11.27000046	18.00228	15.80167	17.97771	18.09492	18.73686	18.78548	15.75606	15.81289	15.60445	14.31458	14.28092	14.33283
gi|152013370	E3 ubiquitin-protein ligase BRE1-like 2	AILKCGVCFDRPK	11.14999962	16.66533	16.80749	16.63203	17.61276	17.4187	18.37382	17.32156	0	16.6746	15.62664	15.59262	15.09596
gi|15528675	P0560B06.2	NSLSMGV	7.679999828	18.31046	18.26075	18.1657	18.58596	18.55749	18.56671	18.29388	18.26293	18.25825	17.97044	17.82331	17.96613
gi|158513173	"Granule-bound starch synthase 1, chloroplastic/amyloplastic"	FSLLCQAALEAPR	52.43999863	17.61558	17.62473	17.56399	17.53539	17.56059	17.54335	18.4991	18.52988	18.45491	16.88274	17.24066	17.30669
gi|158513187	Phytochrome A	LMNGDVR	12.18999958	10.95886	11.48698	11.19034	11.3774	11.23704	11.38552	10.17547	10.90107	12.78391	15.81109	15.8495	15.43136
gi|158517736	"Granule-bound starch synthase 1, chloroplastic/amyloplastic"	LTGITGIVNGMDVSEWDPSKDK	47.68000031	18.23269	18.30768	18.30716	18.10865	17.96101	17.95123	18.78553	18.75528	18.73416	17.40027	17.42931	18.02389
gi|158517793	Prolamin PPROL 14E	NLAQAQALLAFNVPSR	99.12999725	19.46429	19.51091	19.47056	20.60331	20.63019	20.61013	19.6069	19.64931	19.66768	17.34159	17.35329	17.31798
gi|160185554	Squamosa promoter-binding-like protein 2	TAVVTVAGQQQR	32.59000015	18.00355	18.12322	18.17579	18.83595	18.79365	19.01753	18.1635	18.15795	18.10439	17.43577	17.52665	17.4314
gi|169118099	granule-bound starch synthase	ILNLNNNPYFKGTS	8.409999847	17.69886	17.73376	17.6749	17.87088	17.91606	17.8551	17.49199	17.52599	17.48248	17.49157	17.01314	16.62439
gi|16924113	putative RNA binding protein	ILIPAQKVGAIIGRK	11.69999981	18.53584	16.51639	14.18599	19.92867	19.69233	19.74382	0	13.8225	20.16103	12.65121	12.35159	0
gi|171769908	Putative cellulose synthase-like protein D5	RGGGDDGAKMDRR	11.88000011	13.42568	13.56586	13.62157	14.02489	13.59171	14.04939	14.08241	14.18798	14.53355	14.56681	14.43269	14.711
gi|18057115	putative gypsy-type retrotransposon	RLNANLRNVLNEWR	3.279999971	13.41135	13.92093	13.09144	14.90408	15.24553	17.74726	17.42871	12.96118	12.72358	11.703	11.91671	12.10983
gi|18087874	putative HD domain protein	QTSINHFHEK	12	17.56992	17.60119	17.59456	17.60068	17.53927	17.51472	17.66399	17.51986	17.50313	17.21704	17.00699	16.93877
gi|19225016	putative polyprotein	VAHFIPVHTTYSGK	11.56000042	17.89052	14.16282	17.36059	17.04078	17.69625	17.75934	14.45639	18.2878	17.60403	14.03661	13.82332	14.15698
gi|19387258	putative AAA-type ATPase	LASETST	8	17.52614	17.88297	17.71641	17.93174	17.90865	18.05207	17.6844	17.57932	17.46724	17.44671	17.50698	17.08893
gi|19571123	OSJNBb0008G24.19	GRHGCRTAAGRPEAAAAGGVGGALFLGFR	17.21999931	17.65844	17.66373	17.56829	18.80999	18.81079	18.77043	17.76181	18.00215	17.80931	15.93863	15.86406	15.77856
gi|19881597	Hypothetical protein	AGEGPGDGLGGK	13.77999973	14.77289	14.7731	13.85911	10.68389	15.65121	15.47246	14.96361	8.132884	14.69672	5.583371	3.205377	6.518891
gi|20212	glutelin	FPILNLIQMDATR	34.36000061	17.4304	17.52756	17.41376	19.19214	19.13042	19.1082	18.23409	18.30754	17.81368	16.05798	16.12512	16.21
gi|20303620	 putative retrotransposon	SDRILPRR	11.14000034	14.99107	15.05788	15.092	16.0615	16.81884	17.11046	15.29162	14.73046	15.33127	14.24814	14.17793	14.05903
gi|205688361	Zinc finger CCCH domain-containing protein 19	SGQVSDR	19.25	15.90316	14.82002	14.28781	16.70309	17.05396	17.31222	13.57779	13.84455	13.23544	12.58482	12.53685	12.09898
gi|21671964	Putative protein with FAR1 domain	SMVYTHGPGVSSDLVPK	21.28000069	0	18.90871	18.87536	19.82123	19.54664	19.56911	18.64164	18.31655	19.05232	18.11114	17.05166	17.15014
gi|218184343	hypothetical protein OsI_33155	MEATATRAR	9.159999847	11.30814	14.56404	14.70742	16.64225	16.60612	16.79615	14.67374	16.83401	10.28381	8.855421	9.271885	8.387938
gi|218184942	hypothetical protein OsI_34480	TFGGQGR	9.989999771	17.67783	17.59336	17.44638	0	18.44623	18.56648	17.61557	17.99554	17.33979	15.799	15.83829	15.87245
gi|218186000	hypothetical protein OsI_36609	LRAGGGK	19.5	17.11028	17.05046	17.04854	17.09017	16.83706	16.83818	17.04418	17.0319	16.85997	17.09573	17.21453	17.12918
gi|218186131	hypothetical protein OsI_36876	MADKMAK	12.22999954	14.0258	17.81575	12.84343	19.12975	15.31124	15.45516	11.97429	10.78583	6.431026	3.457625	4.795951	2.508632
gi|218186380	hypothetical protein OsI_37365	NLPRIMMMTPMLVQASK	12.96000004	17.78679	17.76667	17.75735	18.32152	18.22922	18.24169	17.32512	17.33051	17.32973	17.17777	17.04325	17.31734
gi|218187404	hypothetical protein OsI_00153	GSTPCSGTPWASMARGGRR	11.63000011	17.88113	17.84634	17.94327	18.49434	18.5041	18.64066	0	18.35655	16.94911	17.1314	13.25896	15.56021
gi|218188280	hypothetical protein OsI_02079	EVEALGDGNSGGRGEGGGGGDGGGARR	18.34000015	19.9745	19.95	19.96157	20.43207	20.4442	20.44463	20.47218	20.48329	20.48734	18.72182	18.707	18.67107
gi|218190480	hypothetical protein OsI_06734	RLPSLSGCGTGRKAVR	9.699999809	16.00279	16.34348	16.11053	16.34086	17.83067	17.95812	15.89364	16.12928	15.75641	15.2997	14.97068	14.57584
gi|218190679	hypothetical protein OsI_07091	NQNIFAGFNPDLLSEALSVSK	72.37999725	17.35782	17.29921	17.27353	18.95548	18.99425	18.93283	18.09336	18.16987	18.11542	15.79383	15.55099	15.45956
gi|218191902	hypothetical protein OsI_09617	IAPEESS	0.100000001	17.42252	17.57335	17.56073	17.69056	17.88713	17.93271	17.74487	17.77993	17.51686	17.35028	17.30875	17.47861
gi|218192116	hypothetical protein OsI_10067	LNLAYGK	6.340000153	17.10425	17.76779	17.89952	17.56302	18.10577	18.05482	17.40511	18.05693	18.04734	16.97728	17.23575	17.27851
gi|218192161	hypothetical protein OsI_10168	AGRLAGAGAGAGAGDER	15.26000023	18.39411	18.2916	18.31804	19.0335	19.09826	19.08046	18.70116	18.71987	18.72528	17.09071	17.12153	17.07921
gi|218192622	hypothetical protein OsI_11156	DGSVLRFDATVSGTLEK	9.56000042	15.00682	14.86274	14.26753	15.80433	16.16622	17.57063	13.26538	12.36715	11.04608	17.5249	17.48154	17.37609
gi|218192866	hypothetical protein OsI_11640	SLPGTGNAVTGPGGGDGR	8.720000267	17.23676	17.24286	17.20784	18.56566	18.53777	18.55167	17.43341	17.41856	17.38963	15.49036	15.46535	15.66351
gi|218193184	hypothetical protein OsI_12324	EDRPTMKGVEMKLQVLR	9.569999695	16.38115	16.41046	16.38308	18.27474	18.29794	18.33854	17.41985	17.35561	17.23768	14.85776	14.72913	14.75285
gi|218194153	hypothetical protein OsI_14423	RMPGAMGRVDGDVR	12.78999996	0	18.91315	18.72804	19.56211	19.549	19.57657	18.8626	18.79758	18.66373	17.52982	16.96654	17.2386
gi|218194606	hypothetical protein OsI_15398	SKILQLENQRGIDSIDKDIR	8.710000038	17.75953	14.49904	13.62769	18.15985	17.55723	17.00341	12.84592	12.80038	12.11468	10.72706	10.43665	10.80938
gi|218195702	hypothetical protein OsI_17678	LSSLAVFSVAYNNLSGCIPNSGQFGTFGMDSYQGNSNLR	15.18999958	0	17.41145	17.2527	0	18.4737	18.45106	15.53369	15.39948	15.33682	13.76926	13.41376	13.82898
gi|218196906	hypothetical protein OsI_20188	LDAASLF	1.169999957	16.62006	17.10198	16.73427	16.2877	16.87537	17.13446	15.8475	16.18956	16.21142	15.37671	15.07798	14.56624
gi|218198948	hypothetical protein OsI_24579	DVDAARR	6.610000134	17.40586	17.68796	17.50445	0	17.84104	18.027	17.4867	17.56827	17.61492	16.91549	17.19054	17.20828
gi|218199534	hypothetical protein OsI_25851	IQGVHALK	5.869999886	18.09662	17.72335	17.6085	17.78002	17.78212	17.85253	17.79492	17.89261	17.85064	17.40369	17.23456	16.72414
gi|218200555	hypothetical protein OsI_28013	KNGSEGKTISIEPVEKLQR	8.5	0	0	0	0	0	0	17.61893	17.70383	17.6377	15.53225	15.38139	15.32903
gi|218200559	hypothetical protein OsI_28021	IKLPPLK	6.809999943	17.66262	17.62083	17.44765	17.87641	0	17.80315	17.64183	17.6066	17.46222	17.17131	17.60732	17.25481
gi|218200782	hypothetical protein OsI_28475	AGGGGSSK	10.68000031	19.21038	19.0344	19.01455	0	18.28072	18.45234	19.05608	18.65864	18.46393	16.75402	17.25841	16.60611
gi|218202209	hypothetical protein OsI_31510	IRAAAGVRSALVDDDDHK	18.01000023	16.97014	16.16169	17.42344	18.07743	17.97686	18.05728	15.79893	15.64263	14.75546	0	13.1864	13.02195
gi|22213215	putative exostosin family protein	YVYVQELPPRFNTDMVK	10.10000038	17.86479	17.90446	17.85511	18.5169	18.4547	18.48826	17.99566	18.04649	18.00282	15.98576	16.01056	15.86731
gi|222617175	hypothetical protein OsJ_36280	MSCLAGPK	2.019999981	14.06571	14.22718	14.01939	14.50486	14.40803	14.63274	14.7476	14.89675	0	15.47994	0	15.26722
gi|222617438	hypothetical protein OsJ_36801	MASAKAK	0.930000007	15.43032	15.43016	15.3152	16.13184	15.98661	15.97603	15.98046	15.95174	15.86501	16.24656	16.20563	16.29911
gi|222619399	hypothetical protein OsJ_03761	TMKTTGQETMEKR	14.19999981	17.33632	17.14652	17.36308	0	17.42389	17.51108	17.0802	17.07542	16.86452	16.96903	16.55602	15.80112
gi|222619527	hypothetical protein OsJ_04056	GAGPAVR	0.930000007	13.90713	14.10804	14.06123	14.38919	14.25231	14.23847	14.34057	14.15291	14.76367	15.03393	14.38957	14.52907
gi|222619752	hypothetical protein OsJ_04536	YDDDGGK	12.80000019	15.78317	15.81172	17.33401	16.54661	16.43286	16.34831	15.29786	15.02782	15.11089	14.06015	13.88828	14.09459
gi|222622076	hypothetical protein OsJ_05179	VPGSPEGR	8.670000076	18.16144	0	18.23571	18.40571	18.3549	0	18.09986	18.19488	17.70123	17.72157	17.68655	17.1276
gi|222623383	hypothetical protein OsJ_07808	TDAGAQLSTNRARMSVKGR	10.75	17.52983	17.603	17.5578	18.28076	18.01915	18.01478	15.87879	16.12078	15.92235	15.02934	14.83344	14.76119
gi|222624233	hypothetical protein OsJ_09502	HRRSYGDRQVLPR	6.760000229	0	18.00565	18.03962	18.68307	18.61677	18.77932	18.32233	18.29084	18.24739	17.1359	17.15655	16.99782
gi|222624568	hypothetical protein OsJ_10136	VEAEGSV	5.909999847	17.32642	17.5686	17.53199	17.11324	17.37312	17.2479	17.11791	17.08457	17.11363	17.03144	16.87361	16.67317
gi|222629625	hypothetical protein OsJ_16297	AKVWKEKEDECK	9.430000305	19.71939	19.7602	19.74834	20.28051	20.24395	20.29679	19.58882	19.6111	19.55398	18.28085	18.22416	18.22403
gi|222631171	hypothetical protein OsJ_18113	GGGGGVGRLEVLLRPT	6.610000134	15.42443	15.73568	15.78912	17.39728	16.28085	16.21702	15.89216	17.91254	16.1591	14.7395	14.92499	14.95855
gi|222631274	hypothetical protein OsJ_18218	HGGPPRR	4.909999847	17.40651	17.55115	17.46492	17.55202	17.41971	17.35365	17.41053	17.28179	17.59962	17.3147	16.96912	16.64577
gi|222632201	hypothetical protein OsJ_19173	ARLLLRGGEDEQRR	13.10000038	17.73235	17.62844	17.67113	17.81053	17.80536	0	17.65175	17.75482	17.54481	17.13122	17.00299	16.69814
gi|222632465	hypothetical protein OsJ_19449	GGAAGSR	3.849999905	17.57956	17.59804	17.49456	17.60034	17.5085	17.66672	17.27629	17.4067	17.25676	17.4187	17.0173	16.75947
gi|222635327	hypothetical protein OsJ_20835	LVGGGAHR	8.680000305	16.28112	16.41392	16.38515	16.6799	16.9605	16.84953	16.71509	16.80909	16.85183	15.79403	15.58189	15.58256
gi|222635372	hypothetical protein OsJ_20937	IWPPILK	4.349999905	17.94553	17.77329	17.74033	17.69053	17.72655	17.78855	17.77476	17.93938	17.849	17.40033	17.36128	17.22433
gi|222636023	hypothetical protein OsJ_22224	AVLPRVLDAAMVMK	8.380000114	16.56333	17.8306	15.8679	18.12807	17.6883	17.71707	15.91358	15.70272	0	13.58633	13.77713	13.3269
gi|222636046	hypothetical protein OsJ_22273	DAPQAARR	7.420000076	17.23259	17.27212	17.36045	17.37841	17.42505	17.19973	17.1414	17.1	17.17886	16.8821	16.55648	16.49456
gi|222636268	hypothetical protein OsJ_22742	MAVAAFAAVSSLELPDRLSHHK	14.61999989	19.1442	19.13774	19.14083	19.22536	18.88813	19.2365	19.5271	19.44869	19.50284	17.77869	17.78249	17.87625
gi|222637584	hypothetical protein OsJ_25392	LLEKLTSSTQTMARLISMLDWSSR	12.39000034	14.90075	14.79112	14.71815	16.11567	18.42904	16.28066	15.02135	18.98433	15.68045	13.47419	13.90108	13.62537
gi|222637738	hypothetical protein OsJ_25685	MSESLDNHLVHGRR	9.619999886	0	17.78209	17.64084	17.8364	17.68738	17.81436	17.78699	17.73472	17.39277	17.14409	17.39059	17.19183
gi|222640194	hypothetical protein OsJ_26603	MKMNDQAQQVAPPLSPVISEGR	6.929999828	16.94326	16.98347	16.94866	16.91945	16.74749	16.71872	16.82185	16.87	16.41174	15.39014	15.59352	15.33548
gi|222640486	hypothetical protein OsJ_27161	GGGVSGR	7.739999771	17.60731	17.68326	17.58504	17.62373	0	17.63623	17.54062	17.47931	17.4522	17.43742	17.20054	16.68627
gi|222641208	hypothetical protein OsJ_28658	TVLRGAHPYR	5.28000021	14.23895	14.26099	14.31357	15.2479	15.24202	14.53868	13.5348	13.00052	12.87991	11.98839	11.90825	0
gi|22831262	hypothetical protein	CMESILRGVGSLR	10.17000008	16.7159	16.86315	16.77344	17.03997	17.1023	17.46665	16.60918	16.47213	16.45338	16.18469	15.76313	15.0415
gi|242117497	putative unclassified retrotransposon protein	ARTGAARR	13.68999958	17.40591	17.46397	17.23001	17.34954	17.23893	17.95477	17.22684	17.43154	17.31844	17.02189	16.71183	16.28777
gi|251764789	Endoribonuclease Dicer homolog 3b	IITAKAVER	7.880000114	16.53713	16.54979	16.54734	18.30161	18.40199	18.36508	17.12466	17.29251	17.15724	15.73583	15.59955	15.59827
gi|255670244	Os12g0407100	LPATDPR	6.090000153	0	0	0	0	16.44056	16.4536	16.07274	0	15.90558	15.30368	15.52241	15.41741
gi|255673292	 Os01g0516800	SKAAASK	3.799999952	15.79982	15.54881	15.59311	15.50396	15.49372	15.29289	15.54412	15.64638	15.68426	15.85936	15.8198	15.73698
gi|255675034	Os03g0836800	MHVDAGLPAGVVASRPGPFLAGSAR	11.81000042	17.76866	17.6955	17.43598	17.95807	18.01018	18.08568	17.75536	17.80189	17.5408	15.90746	15.75502	15.6785
gi|255677458	Os07g0115700	TGASTACRR	9.760000229	17.80187	0	18.06673	0	17.92906	17.95266	17.87625	17.52825	17.64019	17.52794	17.5684	17.22722
gi|258644560	splicing coactivator subunit-like	AAARLGSMGTAALR	10.96000004	17.94691	17.9993	18.0112	19.00852	18.98562	19.08364	18.34614	18.37218	18.31398	16.85118	16.90998	16.87785
gi|258644667	 pr1-like	STAMTKK	10.96000004	18.82652	18.66386	18.69299	18.48015	0	18.87719	18.52213	18.29604	18.29695	18.11045	17.93756	17.73817
gi|31415925	putative NPH1 photoreceptor-interacting protein	TTSILQASESARDMLERR	21.11000061	18.03639	18.07132	18.02795	19.23718	19.20865	19.22339	18.10008	18.15097	18.05294	15.845	15.82778	15.8266
gi|31429975	expressed protein	HTAADAR	8.579999924	17.28769	17.31581	17.03473	17.52731	0	17.49559	16.80061	17.6485	16.66503	16.7662	16.34848	16.00429
gi|31429993	expressed protein	RAVRGAAWRGAGPGTTR	13.26000023	18.89903	19.06164	19.05667	19.72102	19.63513	19.83644	19.3761	19.32322	19.24429	18.35553	18.41449	18.3754
gi|31431842	"F-box protein interaction domain containing protein, expressed"	ENLVVHPFFQM	10.89999962	17.34779	14.19765	13.52914	15.41501	17.63727	16.96997	17.19004	12.66984	12.01869	10.24754	9.368388	10.40067
gi|31432638	"NB-ARC domain containing protein, expressed"	LRCLPDGLR	14.27000046	17.07564	17.30019	16.85529	16.99892	17.077	17.13693	17.37483	16.96583	0	16.85489	16.81389	16.83811
gi|31432810	"Ubiquitin family protein, expressed"	VQPSDTVGSVK	8.06000042	16.47026	16.46574	16.35018	16.9638	16.92948	16.95044	17.37305	17.50554	17.38184	15.87501	15.73487	15.81761
gi|32479666	P0041A24.7	AWLVGRR	22.29000092	16.78212	18.07415	18.11163	17.97018	16.60959	16.6254	18.08314	17.66589	17.43411	16.38962	16.38988	16.23945
gi|32483113	OSJNBa0020I02.4	SALEMRPLAKRIGPAAR	8.979999542	18.14651	17.38037	18.39158	17.81194	17.87975	18.03622	16.83662	16.37878	15.61339	14.14834	16.93796	13.81469
gi|34015194	hypothetical protein OSJNBa0003M24.2	ANEESASGWSDR	10.93999958	18.09176	18.19514	18.22185	18.9933	18.87457	19.15087	18.5855	18.55655	18.49519	17.35576	17.44253	17.43971
gi|34015306	hypothetical protein OSJNBa0023H09.20	YGGGGGGGDDDDDSEMMARDDGGVGAGDALGSGIKGEAEIR	11.81000042	17.4856	17.51906	17.68622	18.27049	18.23481	18.19762	18.26042	18.29178	18.08929	16.41376	16.34368	16.18579
gi|34393410	hypothetical protein	NGGGLRG	1.019999981	14.04826	14.24444	14.18829	14.42784	14.32435	14.83902	14.40248	14.07114	15.12083	15.55237	14.99266	14.93234
gi|37700317	putative nicotinamide mononucleotide adenylyl transferase	VGGGGMR	5.579999924	20.12645	19.60015	18.50054	20.37264	20.41779	0	18.01235	17.96807	16.72243	15.39598	15.05313	0
gi|37806342	hypothetical protein	KTRARDGGGLR	12.43000031	17.16544	17.19809	17.21233	17.52597	17.69265	17.83095	16.88746	16.62687	16.66117	16.46113	16.14841	15.71937
gi|38345655	OSJNBb0040D15.9	SDYSIPLAGVHR	7.050000191	14.00718	16.59315	13.72879	13.86731	17.04387	14.70281	16.75081	17.20593	16.60866	12.71659	12.88719	12.71774
gi|38345918	OSJNBb0076A11.6	EGDVASSNQARR	6.420000076	18.88489	19.58202	19.63778	19.75104	20.08379	20.30068	18.7388	19.7572	18.04747	16.78673	16.7653	0
gi|38568047	OSJNBa0065J03.17	AIITLPMGTQITIEDALLYPDSTR	14.02000046	15.71599	15.6228	15.64851	18.35444	18.21139	18.12687	17.4379	17.41739	17.35251	15.11364	14.48073	14.37215
gi|38605789	OSJNBb0045P24.3	DEEIGRK	6.539999962	0	17.45258	17.47192	17.53787	0	17.36653	17.54028	17.59095	0	17.49924	16.82784	16.57369
gi|39546208	OSJNBa0028I23.15	DNLAKRR	13.23999977	16.8999	17.05592	16.9982	16.92509	16.91329	16.94854	16.62463	16.45343	16.32188	16.08055	15.88921	14.74779
gi|403399731	Ent-isokaurene C2-hydroxylase	NPRIMAKAQAEVR	18.42000008	18.17614	18.16343	0	18.12564	0	18.35809	18.08667	0	17.84157	17.45037	17.25212	17.80755
gi|40538893	putative gypsy-type retrotransposon protein	TGSKGMTGK	5.909999847	17.63811	17.45527	17.6522	17.35662	17.35663	17.25369	17.54863	17.39553	17.57416	17.13172	16.89741	16.74623
gi|41052676	hypothetical protein	GGAQSEY	2.299999952	18.11988	18.24981	18.16944	17.09723	18.09075	18.05505	18.31479	17.80936	17.99313	17.51892	17.37642	16.95299
gi|41393245	putative disease resistance protein	LLQPAARR	13.28999996	17.68341	17.50181	17.47233	17.38466	17.37405	17.37454	17.28866	17.25609	17.21711	16.98029	17.30895	16.88328
gi|42407791	hypothetical protein	ASALPAACQEPR	15.93999958	14.68019	17.44278	17.44571	17.97024	17.99749	15.17306	15.31708	14.79894	16.58109	14.36019	13.88919	14.54937
gi|428674400	glutelin	IIEPLGLLLPR	47.93000031	17.4143	17.47557	17.45036	18.18561	18.14058	18.19011	18.33435	18.30563	18.16967	17.48877	17.55561	16.09252
gi|46804968	hypothetical protein	QRVPVGPTSGR	15.47000027	17.41846	17.6209	17.57589	17.81278	17.76544	17.93211	17.58967	17.72323	17.67812	17.26564	17.07413	16.76931
gi|46805549	hypothetical protein	WSEPGRGRESAGTASALCSLGTAGFAGR	8.109999657	17.84534	17.85134	17.84376	18.77804	18.81911	18.78105	18.0449	18.01257	17.97329	16.78252	16.62825	16.66313
gi|46981325	unknown protein	VAMAPAGSARPTGWNAAAAPSSSASWTAR	12.72999954	16.21332	12.71445	13.00109	18.16191	16.04914	15.97495	14.55753	14.5374	14.64841	12.12646	12.36747	12.19917
gi|47847773	hypothetical protein	ISRRDPIINPNPSQLVLAANRLEQSSWASVISNCM	8.489999771	16.53048	15.1787	13.49607	17.87667	17.56663	17.60158	17.76404	12.74417	17.80955	11.57229	11.33795	11.67529
gi|47848152	hypothetical protein	GGPHDGDRGGVVGAATR	8.050000191	16.44808	16.40928	16.40158	18.19402	18.25041	0	16.52704	16.62854	16.49069	15.33406	15.27656	15.16499
gi|48716879	hypothetical protein	LEGNLAAHR	9.880000114	18.73744	18.63144	18.57721	18.12419	17.87066	17.89969	18.54703	18.64931	18.42166	17.72547	17.78509	17.74445
gi|49388241	hypothetical protein	SAHAAAVR	2.160000086	14.59857	13.65762	12.84014	15.69976	15.31254	15.73	12.25806	11.93334	11.62057	10.06783	10.30312	0
gi|49388263	hypothetical protein	LGLGPGK	5.309999943	17.65381	17.48804	17.75411	17.49298	17.44155	17.52691	17.72034	17.45234	17.60054	17.65621	17.71069	18.00756
gi|49389072	hypothetical protein	RDEMDEKHNDSDMVLIL	7.840000153	19.28792	19.3079	19.30413	19.85043	20.18652	20.09319	19.24705	19.20171	19.04217	17.41968	17.26295	17.28658
gi|50252585	hypothetical protein	GGAGSMR	4.239999771	18.24681	17.93659	17.99805	18.28302	18.33577	18.19666	17.89557	17.87237	18.23552	17.87659	17.56679	16.93528
gi|50252688	hypothetical protein	LPAKSGR	4.019999981	17.38895	17.49458	17.36805	17.73208	17.74202	17.76696	17.35737	17.42382	17.29671	17.36848	16.99503	16.74507
gi|50253356	hypothetical protein	LPSAAVNGIRYREEDEDTVAVEMGMAR	9.25	16.33252	16.47852	16.50391	18.56276	18.52466	18.43002	17.41502	17.52661	17.3674	15.4165	15.34741	15.38695
gi|50508234	hypothetical protein	RGPGDAGVSGAAAGGGR	12.02999973	18.64958	18.66588	18.64201	19.16521	19.16179	19.11576	18.7863	18.84497	18.66828	17.64426	17.59264	17.57425
gi|50509225	hypothetical protein	AGMGGGR	6.019999981	15.64724	15.66677	15.67138	15.96375	15.74103	16.12632	16.1678	16.15679	16.29002	16.3817	16.85103	16.22649
gi|50540732	putative retrotransposon gag protein	KPMKVDGNPFPVNMVHTAGQAADRVR	20.02000046	18.52597	18.49519	18.49388	20.0428	20.04101	20.05676	18.83224	18.66595	18.6402	16.16587	15.96206	15.86701
gi|50725932	hypothetical protein	GTNSGSV	12.72999954	16.34074	16.22406	16.15783	16.37166	16.08068	15.92811	16.48419	16.17788	16.04067	15.89541	16.08772	15.82626
gi|51091627	hypothetical protein	NMSGGSK	11.35999966	19.48226	19.48513	19.45672	19.49098	19.48229	19.47247	19.4806	19.52682	0	19.64577	19.64427	19.63205
gi|51535013	hypothetical protein	GGGADMR	7.53000021	0	17.73622	17.83929	17.90695	17.86181	17.92655	17.70473	17.25537	17.29157	17.12683	17.0337	17.06339
gi|51535849	hypothetical protein	GNFPLLIRVR	10.97999954	17.57304	17.51893	17.55892	17.75055	17.78217	17.76904	17.83437	17.76363	17.62437	16.40515	16.3632	16.31104
gi|531874314	 glutelin	VTNLNTQNFPILNLVQMSAVK	81.51999664	19.66105	19.66745	19.6526	19.43162	19.45686	19.42958	19.95693	20.01195	19.93965	18.356	18.36076	18.3841
gi|531874318	 glutelin	VEHGLSLLQPYASLQEQQQEQVQPR	51.45000076	20.28975	20.35684	20.35764	20.84721	20.91487	20.78684	20.60692	20.52349	20.52561	19.15596	19.12201	19.21099
gi|531874320	glutelin	FQQQYYPGLSN	11.46000004	18.86118	18.98877	19.09167	20.09387	20.00794	20.20847	19.37074	19.46025	19.34097	17.93314	18.08698	17.97661
gi|531874322	 glutelin	YTNTPGVVYIIQGR	85.58000183	20.95835	21.02018	21.04323	21.64105	21.5903	21.74632	21.29371	21.24989	21.21788	20.39391	20.45075	20.37585
gi|531874324	 glutelin	ADEIGAFTPR	44.45999908	15.79069	15.78341	15.79092	18.28923	18.42636	16.29444	15.56759	15.29084	15.54167	14.75668	14.57991	14.64137
gi|53791724	hypothetical protein	WTAAADSPPPYLAGGEAVGGGAMGGGGQRR	10.64000034	18.76848	18.79728	18.78452	19.48593	19.4592	19.43712	16.99209	17.02075	16.80179	15.71921	15.73983	15.79571
gi|53791898	pr1-like protein	AGTAGCGAIRGGGGAR	9.760000229	16.94842	16.71499	16.19486	17.97345	18.06395	18.15899	16.42017	16.1627	18.32044	14.77254	14.57747	14.53221
gi|53792147	hypothetical protein	AVTGGGQR	20.34000015	17.44975	17.49379	17.48522	17.47369	17.35939	17.40806	17.50873	17.46634	17.37444	17.51755	17.51649	17.5892
gi|53793246	hypothetical protein	GGGGMPRRR	8.380000114	17.54929	17.54539	17.54906	17.39243	17.36774	17.26854	17.63112	17.71831	17.62853	17.24867	17.27602	17.09346
gi|53982139	putative polyprotein	QIEALKKDKAGLAAER	12.82999992	17.98068	18.08719	18.07008	18.58448	18.44706	18.64182	18.27239	18.24454	18.1818	17.65012	17.72113	17.62501
gi|54290463	hypothetical protein	MAFSPSPDTHPRR	12.80000019	17.16248	15.63496	17.22986	15.7855	16.25031	17.06825	18.52965	18.44448	18.00995	15.92262	15.68421	14.88188
gi|56201650	hypothetical protein	VPLVGSWVKSPGE	8.68999958	16.00584	15.84463	15.9545	16.13698	16.18036	16.08767	16.2367	16.06555	16.13406	15.82324	15.80916	16.01577
gi|57899786	membrane-associated protein-like	VGGASLSPR	21.35000038	17.07048	17.05056	17.11062	16.86094	16.84642	0	17.30391	17.35101	17.36266	17.44217	17.47688	17.52298
gi|57899975	unknown protein	SPGPVFRGGGSLKSTDGGVSVR	8.520000458	17.19016	17.22314	17.24904	18.60534	18.62101	18.59052	17.70908	17.70977	17.67864	15.83011	15.8332	15.80753
gi|57900316	hypothetical protein	EVASASK	14.90999985	15.39667	15.66626	15.42557	15.69314	15.81769	15.783	15.43816	15.61838	15.24431	14.17096	14.20161	14.41762
gi|59940382	glutamate decarboxylase	NPLQGGR	11.31000042	17.9418	18.5104	17.04869	18.84491	18.83262	18.87781	16.63584	15.3653	14.39113	12.8548	12.97275	12.27196
gi|6174927	13 kDa prolamin C	QYQLQSHLLLQQQVLSPCSEFVR	54.97000122	19.95258	19.95687	19.94565	20.78403	20.81128	20.75263	19.64112	19.62647	19.64223	18.17407	18.18059	18.09457
gi|62701793	"retrotransposon protein, putative, unclassified"	SLPNLTGGGREEAGGGADGMER	16.22999954	17.88157	17.85821	17.93096	18.99876	18.15384	19.06813	18.20287	18.16481	18.15578	17.09444	17.20386	17.24869
gi|62701853	"retrotransposon protein, putative, unclassified"	IARPFDK	2.059999943	17.58471	14.32586	14.52834	17.57369	17.31615	17.65368	13.85979	17.42555	17.48055	14.16245	13.92584	13.60985
gi|62733022	expressed protein	DGQTALHQAVR	16.09000015	16.20822	20.36754	16.2254	17.94307	19.60677	16.46248	15.83689	19.50181	15.84762	13.9254	13.70971	13.79426
gi|62733691	HUA enhancer 2	IMSEMIRPERALLYLVPGRLVKVR	15.06999969	17.85145	17.89968	17.87839	19.37496	19.55224	19.54893	18.47395	18.40759	18.4439	12.90775	12.91711	13.2079
gi|62734552	" retrotransposon protein, putative, unclassified"	ELLAAAPTHEATRR	17.65999985	16.30538	15.86507	15.37007	17.21274	17.12056	17.28738	15.0554	14.77855	14.07803	12.97053	12.67044	12.64694
gi|75137454	63 kDa globulin-like protein	EVDELLNAQQESAFLAGPEK	57.18000031	18.21685	18.16115	18.16011	19.12661	19.1346	19.12539	18.54354	18.50207	18.48004	17.59096	17.57886	17.55131
gi|75140646	17kDa alpha-amylase/trypsin inhibitor 2	CDALSVLVR	15.82999992	17.46153	17.47489	17.49337	18.13283	18.06922	18.22258	17.99824	17.92206	17.92418	16.84786	16.983	16.94179
gi|75157117	Transcription factor TB1	FFALQDMLGFDKASK	6.010000229	17.27047	17.29304	17.07115	18.68341	18.55564	18.72527	17.65355	17.66638	17.49625	16.24118	16.1842	16.12975
gi|75226365	ATP-dependent DNA helicase 2 subunit KU80	AVAAVSALARAMSEMNK	8.350000381	16.91727	16.82459	16.72494	18.15565	18.09904	18.01903	18.2084	18.35246	18.24322	16.33076	16.33613	16.34036
gi|75246443	Putative B3 domain-containing protein Os10g0537100	YFPLDAAAGAGGGGGGGGGGGGGKGLVLSFEDR	21.68000031	18.20289	18.13542	18.18817	19.02258	18.91518	18.94773	18.84594	18.79203	18.82598	16.81367	16.68518	16.59781
gi|75248671	"Protochlorophyllide reductase B, chloroplastic"	KGTAVITGASSGLGLATAK	12.63000011	17.21744	17.38162	17.47021	17.95185	18.12096	18.05466	18.03062	17.8929	0	17.34914	17.18001	16.94411
gi|75256177	U-box domain-containing protein 4	EIRLLAKTGKQNR	11.17000008	17.32533	17.38303	17.35999	18.1125	17.94692	18.04653	18.00811	18.10382	18.00897	16.18802	16.00491	16.01832
gi|75288538	"Chloroplastic group IIB intron splicing facilitator CRS2, chloroplastic"	KGGHGRHNGLQNVMECLDSSRELPR	14.22999954	18.18839	18.17248	18.15635	18.83443	18.8345	18.79283	18.75744	18.85516	18.85213	17.17055	17.2652	17.25923
gi|75290219	Glutelin type-B 5	SIEQHSGQNIFSGFNNELLSEALGVNALVAK	102.7600021	16.307	16.10347	16.04989	19.9259	19.8478	19.7718	17.86703	17.92735	17.87416	14.43354	13.933	13.6838
gi|75291046	Glutelin type-D 1	YSNTPALAYIIQGK	38.09000015	18.17333	18.17768	18.15149	18.63684	18.66753	18.63212	18.3178	18.37411	18.29702	17.51612	17.53031	17.5227
gi|75320906	CBL-interacting protein kinase 8	FAQNTESGESVAMK	12.52000046	17.94603	17.85893	17.94865	18.71177	18.7434	18.73636	17.76139	17.912	17.83195	17.44565	16.51258	17.39465
gi|75325561	Chromatin assembly factor 1 subunit FAS2 homolog	FSPSGENLASGADGGGIIIWK	16.71999931	18.94443	18.91476	18.87075	19.58084	19.56647	19.58699	19.39046	19.42769	19.41029	17.75256	14.11945	17.70641
gi|75326437	Heat shock 70 kDa protein BIP4	IINEPTAAAIAYGIDK	21.64999962	17.51436	17.51627	17.54417	18.11163	18.08649	18.07857	18.07363	18.06986	18.01295	17.04394	16.97518	17.01439
gi|75332135	Sugar transport protein MST7	ILLGIGVGFSIQAVPLYLSEMAPAK	16.40999985	14.49393	14.80912	14.99656	18.64934	18.66688	18.69967	15.73412	15.5985	15.37062	13.3433	13.4295	13.27985
gi|77548320	hypothetical protein LOC_Os11g01670	EVAAVVIHARK	14.92000008	14.84857	14.4027	14.63906	16.34678	16.26906	16.39859	18.7802	14.55652	13.19837	10.16111	9.917628	7.909298
gi|77549343	"retrotransposon protein, putative, unclassified"	LMVAGVARAAARR	14.64000034	18.06336	18.14295	18.20661	18.43895	18.42614	18.59468	18.47969	18.41104	18.34233	17.22518	17.19479	17.18867
gi|77549358	 expressed protein	QATPVSLR	11.63000011	15.94701	15.93555	15.87958	15.81175	15.78952	15.75975	15.84447	0	15.87745	16.2055	16.15214	16.08981
gi|77550953	"transposon protein, putative, unclassified"	KGSRPPLQLFL	15.05000019	18.91848	18.93058	18.95533	18.61883	18.52269	18.49663	19.02068	18.95671	18.90249	17.96909	17.95067	17.98803
gi|77553586	"retrotransposon protein, putative, Ty3-gypsy subclass"	QSMAGLTGPRGGMTGGTR	14.80000019	18.35203	18.35251	18.35684	19.56098	19.5305	19.51721	18.86	15.14018	18.87605	15.26647	15.1344	15.24919
gi|77554226	hypothetical protein LOC_Os12g16570	LQRSIIAGGPHK	13.15999985	17.96993	14.91847	13.84685	19.20116	19.2382	19.25581	13.18031	12.26266	11.22534	7.437809	13.00582	9.415429
gi|77554437	"retrotransposon protein, putative, unclassified"	MMIDGGAAKLGR	11.22000027	16.80412	16.81172	16.40365	17.06205	17.16076	17.23201	16.80652	16.91835	16.95214	16.26064	16.3842	16.16316
gi|77554792	hypothetical protein LOC_Os12g22850	LGVVHRR	11.46000004	17.55317	17.61205	17.4736	17.66968	17.98421	0	17.47206	17.4158	17.41338	17.11957	16.98666	17.56311
gi|77556060	"transposon protein, putative, CACTA, En/Spm sub-class"	LRGGGVAAR	14.26000023	17.4804	17.42493	17.43604	17.53559	18.20144	17.53099	17.22972	17.56704	17.40526	16.97761	16.88175	17.32373
gi|77556144	Zinc knuckle family protein	DQLGQQENGPLIEK	8.130000114	16.21693	16.2185	16.12611	17.0451	16.94209	17.00164	16.55838	16.56499	16.32964	15.81292	15.71454	15.84391
gi|78707669	expressed protein	RTAAGEATGGGER	19.30999947	18.74138	18.7156	18.70305	17.21118	19.17545	19.17209	18.36607	18.35511	18.3179	15.39271	15.18426	17.29147
gi|78707916	" retrotransposon protein, putative, Ty3-gypsy subclass"	GETPPPTPKLRLTPR	12.68000031	20.0449	20.08173	20.07513	20.59197	20.62035	20.59676	19.88174	19.90349	19.8631	19.05318	18.96553	18.96238
gi|78708717	hypothetical protein LOC_Os10g30270	AVPVVEGENGAEAGMELGGAMPAVAAAWR	8.479999542	16.05685	16.01861	15.95367	18.38836	18.43194	18.44266	16.85086	16.91892	16.72846	14.22235	13.87963	14.0624
gi|90110019	Elongation factor 1-beta	AVGVNLPGGGAASSAAAAAPAAK	15.47999954	17.82549	17.81511	18.11922	18.61297	18.34983	18.59082	18.18621	18.23852	17.46291	17.44271	15.9826	15.28922
gi|90265044	 H0102C09.1	LEGHINGK	14.56000042	20.04955	20.0262	19.97358	19.38312	19.25541	19.24939	19.93414	19.98065	19.81357	19.27192	19.24404	19.32957
gi|90399343	H0811D08.7	WPAPIPQAHSRPHR	13.82999992	17.7662	17.77962	17.78683	18.48394	18.36416	18.60514	18.28198	18.0786	18.28102	14.91073	15.11279	14.81826
gi|937895166	 Os01g0228800	LSIYTEDDDGCTTK	13.89000034	19.67812	19.73672	19.73844	20.28	20.188	20.3415	19.92983	19.87428	19.87103	19.0887	19.10814	19.04161
gi|937896503	 Os01g0526200	QTLGSMMELQEALLER	10.77000046	14.74563	14.69603	14.98189	15.08309	14.74411	14.87856	15.27229	14.99595	14.8487	16.67683	16.75839	16.79332
gi|937896556	 Os01g0534800	RAKAEAARR	10.22999954	0	17.3684	17.45093	17.3001	17.40467	17.48408	17.22118	17.1654	17.03338	17.16813	16.96196	16.26221
gi|937896729	 Os01g0559300	RGGGGGDGAEDGDDLIPMDIQDQEEMVRSLEQK	9.680000305	17.97558	18.00755	17.96794	18.88132	18.88349	18.8678	18.23537	18.32125	18.2195	17.21309	17.10311	17.07503
gi|937897324	Os01g0632100	QGAAAAAAPLRLRPAQLRRR	11.48999977	17.96135	17.33808	17.10895	18.23578	17.93105	18.68132	17.54237	17.85256	0	16.04596	16.02319	15.63584
gi|937897489	Os01g0653300	LTGKDAVAGGPRPDR	9.350000381	18.22718	18.20923	18.02677	18.57073	18.43302	18.42519	18.96877	18.13888	17.71914	16.58841	16.5742	0
gi|937898768	Os01g0795150	EARAAEMKAGLAR	19.62000084	19.63082	19.61435	19.59915	19.95721	19.93631	19.9145	19.60299	19.597	19.56123	18.61832	18.59087	18.58674
gi|937899305	Os01g0855301	HRLELCMGRPLPR	12.22999954	17.18157	16.4261	15.69235	0	0	0	18.0976	18.32315	0	14.37946	14.0342	14.15239
gi|937901838	 Os02g0138300	LARILKILHEQKR	14.43000031	17.59413	17.66684	17.59226	17.7557	17.73053	18.35667	17.42308	18.10995	17.55974	17.22099	16.83116	16.63905
gi|937903187	Os02g0299666	GLGGLEEAGGEMAR	14.27999973	13.84953	12.09237	11.85929	17.09009	18.82613	18.89871	16.24481	18.05482	11.38794	9.949895	9.151972	9.590103
gi|937903378	 Os02g0329800	DDFLLPGVVEVTIKSVPSEAAAPKCTK	11.46000004	16.41288	16.47655	16.41032	18.39184	18.45175	18.4376	16.88588	17.18022	17.0345	14.07973	13.85971	14.03684
gi|937903793	Os02g0508875	MAEAGGAK	8.369999886	17.21878	16.33147	18.25317	16.86001	16.42894	16.98774	15.26495	14.80782	14.07844	12.39305	12.04326	11.77277
gi|937904645	Os02g0609500	MSARWENGK	9.979999542	12.04848	11.45279	11.87211	12.04659	12.52057	12.19117	12.27489	12.26376	12.53362	15.33729	15.61599	15.15832
gi|937904873	Os02g0634100	RALGLDLLTPR	11.78999996	17.59484	17.86164	17.80505	19.09502	19.05682	19.00575	18.16662	18.05735	17.98877	17.53084	17.35921	16.89016
gi|937905315	Os02g0689600	MHVAIASAAALVAASCSEAAKLTGASR	6.230000019	16.93842	16.94558	16.96369	18.59748	18.55754	18.54135	18.05005	18.01092	17.73626	15.07633	14.91865	15.10822
gi|937905437	 Os02g0703050	NGGGGRR	6.230000019	17.73349	17.73716	17.81346	17.68727	17.5598	17.72291	17.90615	17.53773	17.39953	17.61248	17.08917	16.68276
gi|937905526	Os02g0712650	DAGHVGVR	10.81000042	17.69588	17.84631	17.86489	17.75742	17.61732	17.71576	17.80717	17.77531	17.51191	17.16674	17.1328	16.9243
gi|937907495	Os03g0161200	RAKMGSGSAANGGGGGAGAAR	6.989999771	16.81235	16.66979	16.63971	18.33401	18.32474	18.31088	17.10644	16.95681	16.87736	15.98047	15.88421	15.65618
gi|937909391	Os03g0364700	LLLPDAARGVPSLCSSDR	33.18999863	14.22681	14.75942	20.62694	16.39648	15.89217	21.27832	20.8046	14.48433	13.68476	11.15127	12.21534	11.55932
gi|937912167	Os03g0820800	GGGRPAARR	7.550000191	17.42972	17.20849	17.30049	17.33558	17.53115	0	17.31912	17.46769	17.1323	17.04655	16.81124	16.87559
gi|937912885	Os04g0151866	LSLVATLVVRTAMGR	21.97999954	17.66786	17.83695	17.7569	17.68888	18.59968	18.7403	18.50325	18.41884	18.3811	16.35576	17.45552	17.35986
gi|937913354	Os04g0252850	RRGLGSAGGGLGHGR	10.11999989	16.57392	16.21142	15.58723	18.02065	17.95114	17.95945	18.02472	15.66946	18.26693	0	13.98796	13.78604
gi|937914063	Os04g0393200	SQPTQQQRGFGFSGVGAAAAAAAPSPRGMPMAAGAAGPR	9.710000038	16.25721	16.02157	15.49157	17.42759	17.49303	0	0	15.45878	13.47392	12.47618	11.75173	10.17414
gi|937914566	Os04g0453450	QHPPDDEHGNVDR	5.96999979	17.04698	17.1984	16.56822	16.84097	16.70135	16.90508	17.20767	17.32399	17.34212	16.52861	15.39994	16.4478
gi|937915204	Os04g0521001	GHELGDHR	11.44999981	15.25805	15.28275	15.3963	15.47967	15.62943	15.57244	15.97887	15.81605	16.06539	16.48991	16.47229	16.51691
gi|937915326	 Os04g0534300	INLEDFR	17.60000038	16.78922	16.76144	16.75509	17.13581	17.15306	17.10667	17.06949	17.12446	17.05581	16.59604	16.53182	16.56154
gi|937915582	 Os04g0563600	ISANDYR	10.55000019	17.4897	17.18966	17.41595	17.47946	17.61773	17.75559	17.40825	17.54893	17.50224	16.96041	16.97932	16.73132
gi|937915623	Os04g0567500	KKRGMAAGGGTERPPSRPAPVR	8.779999733	17.32709	17.41593	17.38252	17.3542	17.34978	17.52405	17.17461	16.83008	17.08962	16.76388	16.24702	15.80054
gi|937915836	 Os04g0591300	RMGLRSRSVAAGGGGGGR	11.03999996	19.32925	18.04061	20.63139	0	0	0	17.41	17.33203	15.27326	14.23346	13.47241	12.2651
gi|937916319	Os04g0638750	LELAARR	11.18000031	17.81565	17.75707	17.70658	17.6774	17.61548	17.84951	17.79596	17.67031	17.7121	17.36282	17.32022	17.54826
gi|937917163	Os05g0127300	RAGRLHGGALRPAGGEGPAGDGGHRGQPR	17.52000046	21.46775	21.41634	21.19032	22.47075	22.54556	22.53198	21.47359	21.55762	21.43269	19.64136	19.61359	19.58853
gi|937918295	Os05g0298900	VPASAVR	2.99000001	14.90472	14.57721	14.78272	14.85622	15.04135	14.97942	15.1546	15.39122	15.4298	15.89328	15.76971	15.38697
gi|937918535	Os05g0335500	AASATSTTTMASRLLHSPDAAVSNPSFR	10.89999962	17.75751	17.55093	0	18.63463	18.42247	18.42563	18.65038	18.66959	18.63824	16.17501	16.02231	15.46663
gi|937918556	 Os05g0342000	LGGGGGGK	1.889999986	17.80518	17.74678	17.68076	17.68118	17.50311	17.59352	17.6256	17.37705	17.40959	17.52289	17.27187	16.67255
gi|937918616	 Os05g0350700	SGRPSSSNAKGERKNK	12.32999992	18.0723	17.30247	18.86252	19.29092	18.80893	18.80936	18.18127	18.0968	0	0	16.87802	16.69353
gi|937919177	 Os05g0423200	MKAQDMVSR	14.43000031	0	16.88583	16.85472	17.10254	17.06656	17.14651	17.23487	17.21856	17.2665	16.89537	16.88802	16.87633
gi|937919207	 Os05g0427100	GGGGYVR	1.690000057	17.78665	17.96436	17.90666	17.85801	17.82489	17.91557	17.91702	17.6195	17.69166	17.71929	17.12913	16.74616
gi|937919641	Os05g0479025	RNSLNQSGSRSSPRK	8.420000076	17.21599	17.44365	17.32067	17.64148	0	18.23427	17.38792	16.88049	0	16.4651	16.07326	15.68696
gi|937920773	Os05g0597800	TMFDFSPQVSK	12.64999962	17.41132	17.68452	0	0	17.69547	17.63385	17.67226	17.37992	17.40028	17.32655	16.91766	16.84232
gi|937921574	Os06g0184000	VLSMSRLGGAAGMAPLVASMSSEGGGGGGGGGGGGTGGGMR	16.82999992	17.54675	17.59473	17.44206	19.1856	19.15231	19.14022	18.42345	18.45139	18.39939	16.8004	0	16.86937
gi|937921919	Os06g0222100	HGLHVRR	6.730000019	17.04431	17.05787	17.05719	17.10387	16.91538	17.1934	16.56473	16.41158	16.39563	16.14985	16.02404	14.59824
gi|937922213	Os06g0263050	SGSEGGGCEWSDLATSGWGAKEAWSSGRMQRR	16.60000038	17.86668	17.89691	17.84132	18.1636	18.11758	18.09352	18.2052	18.13858	18.14772	17.08489	17.37239	17.37308
gi|937922241	Os06g0267300	LEAGAGGDERK	27.29999924	15.77509	15.77245	16.94994	16.71288	16.72434	16.93909	15.78828	15.52077	15.82181	14.86349	14.69533	14.94531
gi|937923094	Os06g0521633	VSEEERDAR	14.43000031	17.78929	17.62897	17.59609	18.00587	18.10713	18.07213	15.89858	17.49487	17.52224	16.80611	16.9045	14.10711
gi|937923107	 Os06g0524300	LAPTVEK	1.899999976	16.33609	16.20424	15.2228	13.78469	15.696	15.75286	16.30336	13.75032	13.9094	13.7335	13.59632	13.65676
gi|937923257	Os06g0549525	QEPRVPDGRR	13.35000038	15.96326	15.82151	16.12128	17.12306	17.93843	18.10296	16.23293	16.48672	16.26223	0	15.09142	14.51031
gi|937923345	Os06g0563250	GGIASGR	12.47000027	17.8854	17.62571	17.70652	17.69713	17.77264	17.75422	17.6431	17.68611	17.69996	17.45112	17.25978	16.88585
gi|937924343	 Os06g0693700	MGSGNLMMKK	6.349999905	11.14525	14.83704	10.20727	11.57918	11.80022	11.65563	11.79823	11.57361	11.46715	11.75362	15.49532	15.38332
gi|937924535	 Os06g0711000	PAASVGEGER	22.46999931	15.78778	15.75092	15.66213	16.35591	16.4201	16.33464	16.35426	16.17568	16.27241	15.66525	15.19178	15.05505
gi|937925643	Os07g0207301	LGGAARR	8.039999962	17.92392	17.99747	17.93396	18.14282	17.95408	17.83503	18.03636	18.07806	18.00236	17.86302	17.55954	17.72252
gi|937925940	 Os07g0253000	LAACMLR	4.909999847	16.55833	13.67859	12.80025	16.26463	15.15554	15.32578	12.6242	13.30859	16.59881	11.36216	11.14619	0
gi|937925943	Os07g0253400	AVVKEMQVR	6.170000076	16.55012	16.54645	16.54357	17.67577	17.72515	17.66193	17.4359	17.34084	17.38752	16.49577	16.51215	16.46668
gi|937926037	Os07g0273700	LSHVGRV	7.28000021	18.56802	18.4392	18.38688	18.58548	18.70825	18.69592	18.48045	18.46713	18.45094	17.98234	18.12167	17.98154
gi|937926474	Os07g0464400	VSSYTMDTRPR	13.75	12.20553	12.6757	12.67103	12.60634	12.85816	12.65505	16.78646	16.78155	12.52002	16.9873	16.06212	16.07385
gi|937926758	 Os07g0506900	AKVSTAQGGSAR	10.35999966	14.49044	14.50908	14.55745	14.75512	14.58042	14.87519	14.94132	14.69722	14.96281	15.33847	15.04512	14.77879
gi|937927238	Os07g0563500	MDRMMALMTR	8.350000381	18.25118	15.18338	18.19466	18.5607	18.62034	18.59459	15.89534	16.18587	16.30506	15.13486	15.22081	13.25599
gi|937927387	Os07g0577600	LRPPGSR	0.800000012	18.1135	18.11609	18.12938	18.52352	18.57397	18.53579	18.1457	18.17727	18.15668	17.89951	17.78734	17.73442
gi|937930534	Os08g0418800	REAKEELGGGGDGGGDALSK	14.57999992	15.17302	17.87276	17.87357	18.47933	18.29105	18.36716	17.96245	17.45307	16.75653	15.41932	15.46674	15.0003
gi|937930649	Os08g0432000	IQASKTLGR	35.47999954	17.21437	17.15628	17.15641	17.32699	17.4316	17.44485	17.3282	17.40187	17.46365	16.94106	16.89408	16.89087
gi|937931151	 Os08g0496600	RACALEALMDAARR	15.81999969	17.87307	16.41105	15.18027	18.43396	18.73928	16.81316	15.53623	18.30375	19.35581	14.47361	13.77933	13.12958
gi|937931638	Os08g0547401	IGVLGGVVGPPHR	9.960000038	17.37466	17.30052	17.09538	17.56145	17.40076	17.37883	17.03767	17.2942	0	17.08712	16.9146	16.48778
gi|937932133	Os09g0250950	VASSLIPR	18.55999947	16.61152	16.62044	16.68457	16.34912	16.44828	16.4449	16.50286	16.76351	16.68611	16.77031	16.72868	16.7655
gi|937932606	Os09g0331100	QNILSYSGPSGQNALHVAVLR	15.96000004	18.14542	18.16781	18.17196	18.22625	18.24195	18.28031	18.28019	18.22325	18.21073	17.93395	17.99304	17.94047
gi|937932690	 Os09g0345500	SAGKPAAALALQRKSPR	10.72000027	18.24392	18.24119	18.19115	19.27691	19.29116	19.27593	18.5831	18.61296	18.45827	17.20073	17.07736	16.94478
gi|937933668	Os09g0473502	LQGSSGR	2.059999943	17.67295	17.74431	17.52057	17.78889	17.56634	17.43153	17.67164	17.39159	17.59888	17.58271	17.35871	17.08091
gi|937934890	Os10g0135700	IPFPHTSPLLPFWARCRHR	8.789999962	16.52034	16.55599	16.53066	18.11701	18.1436	18.13498	17.44477	17.44696	17.38445	15.08501	14.84817	14.89997
gi|937935092	Os10g0162846	TLRVWDAPNLR	15.01000023	15.92628	15.77105	15.86998	16.07229	16.10694	16.26883	15.98284	16.0633	16.00936	15.90138	15.78118	15.59485
gi|937935601	 Os10g0362900	KGEKRPGGTLIACGSR	13.77000046	18.03713	18.11923	18.11076	18.48639	18.61012	18.55503	18.25421	18.25068	18.27163	17.6846	17.63791	17.67913
gi|937935605	Os10g0363400	WGGVGTHAGRGGGAGDAR	15.01000023	17.52442	17.35445	17.43054	18.02015	17.98475	18.04235	17.52631	17.69413	17.45674	0	16.84006	16.45345
gi|937939119	Os11g0481000	DVAVFIASR	19.06999969	17.33118	0	17.35445	0	17.51733	17.48468	17.58973	17.71046	17.50819	17.44567	17.15438	16.86243
gi|937939752	Os11g0589800	IRHKIANDIKDVK	10.17000008	18.99387	19.03089	18.99647	19.78164	19.79239	19.81336	19.09812	19.12454	19.10646	17.51242	17.49768	17.50254
gi|937939821	Os11g0598700	SQQGAGKEYGCVAR	15.09000015	18.77373	18.78601	18.75574	18.70827	18.70245	18.68841	19.346	19.37424	19.35533	18.16741	18.13122	18.12478
gi|937942018	Os12g0428401	WPVLFSHVSR	5.829999924	15.00495	15.35761	15.23789	0	0	0	15.62548	14.56462	15.56752	13.761	14.14054	13.5293
gi|937942832	Os12g0571600	TTTIMLGSDR	12.31000042	17.31485	17.76206	17.7281	17.60468	17.81328	17.79172	17.68294	17.2036	17.15235	17.13889	16.99553	16.75028
gi|937942935	Os12g0584700	QSHLDLR	9.210000038	17.45386	9.758074	8.117827	12.94516	12.7929	12.70858	18.34583	8.735485	17.56609	6.191391	6.742082	5.076986
gi|937942969	 Os12g0590900	RGGGGGSNGHR	15.27000046	15.02809	15.0082	0	0	15.27609	15.54208	15.65704	15.0974	15.56458	15.67595	15.84245	15.62893
gi|937943081	Os12g0606400	EGAGGGRGDEIYVKKPVAAAATQDETLVAMLMSFMTR	12.55000019	18.18193	18.23804	18.21314	18.87342	0	18.81371	18.82124	18.82712	18.81822	17.33413	17.29607	17.25852
gi|94730381	Glutelin type-A 1	SQNIFSGFSTELLSEALGVSSQVAR	90.23999786	16.60182	16.5737	16.42882	19.27594	19.13054	19.09109	18.36754	18.31751	18.26745	15.89526	15.8632	15.7256
gi|94730382	Glutelin type-A 3	GLLLPHYSNGATLVYVIQGR	57.58000183	19.38525	19.4057	19.39668	20.2324	20.1605	20.16702	19.59778	19.6622	19.687	17.96854	17.95674	17.91662
gi|94730384	Glutelin type-B 2	SEAGVTEYFDEKNELFQCTGTFVIR	75.44999695	18.7408	18.72695	18.7214	21.07647	21.00575	21.03209	19.88402	19.92991	19.87445	17.25222	17.12023	17.13137