Sequence	Length	Modifications	Modified sequence	Oxidation (M) Probabilities	Oxidation (M) Score Diffs	Acetyl (Protein N-term)	Oxidation (M)	Missed cleavages	Proteins	Leading proteins	Leading razor protein	Gene names	Protein names	Type	Raw file	Fraction	MS/MS m/z	Charge	m/z	Mass	Uncalibrated - Calibrated m/z [ppm]	Uncalibrated - Calibrated m/z [Da]	Mass error [ppm]	Mass error [Da]	Uncalibrated mass error [ppm]	Uncalibrated mass error [Da]	Max intensity m/z 0	Retention time	Retention length	Calibrated retention time	Calibrated retention time start	Calibrated retention time finish	Retention time calibration	Match time difference	Match m/z difference	Match q-value	Match score	Number of data points	Number of scans	Number of isotopic peaks	PIF	Fraction of total spectrum	Base peak fraction	PEP	MS/MS count	MS/MS scan number	MS/MS scan numbers	MS3 scan numbers	Score	Delta score	Combinatorics	Intensity	Reverse	Potential contaminant	id	Protein group IDs	Peptide ID	Mod. peptide ID	MS/MS IDs	Best MS/MS	Oxidation (M) site IDs	Taxonomy IDs
AAAAAATAAAAASIR	15	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AAAAAATAAAAASIR_			1	0	0	Q8WVM8	Q8WVM8	Q8WVM8	SCFD1	Sec1 family domain-containing protein 1	MSMS	DP1141_8	3	650.355712890625	2	650.354408	1298.69426	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.4	1	21.4	20.9	21.9	0								0	0	0	0.021893	1	15902	15902		118.9	89.354	1				0	485	0	0	0	0		9606
AAAAASAPQQLSDEELFSQLR	21	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AAAAASAPQQLSDEELFSQLR_			1	0	0	Q9Y2U8	Q9Y2U8	Q9Y2U8	LEMD3	Inner nuclear membrane protein Man1	MULTI-MSMS	DP1141_7	2	749.382568359375	3	749.041356	2244.10224	0.76041	0.00056958	-0.61705	-0.00046219	0.14336	0.00010738	749.3747269814435	22.858	0.17739	22.858	22.728	22.906	0					4	2	2	0	0	0	0.00056186	1	18247	18247		83.213	61.162	1	2377300			1	611	1	1	1	1		9606
AAAAGGGGPGTAVGATGSGIAAAAAGLAVYR	31	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AAAAGGGGPGTAVGATGSGIAAAAAGLAVYR_			1	0	0	Q92922	Q92922	Q92922	SMARCC1	SWI/SNF complex subunit SMARCC1	MULTI-MSMS	DP1141_7	2	853.4461669921875	3	852.777014	2555.30921	0.47231	0.00040278	0.3523	0.00030044	0.82461	0.00070321	853.1112949077158	22.856	0.26205	22.856	22.728	22.99	0					10	3	4	0	0	0	7.815799999999999E-21	1	18289	18289		142.4	121.96	1	12920000			2	499	2	2	2	2		9606
AAAAGGGGPGTAVGATGSGIAAAAAGLAVYR	31	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AAAAGGGGPGTAVGATGSGIAAAAAGLAVYR_			1	0	0	Q92922	Q92922	Q92922	SMARCC1	SWI/SNF complex subunit SMARCC1	MSMS	DP1141_8	3	853.1043701171875	3	852.777014	2555.30921	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.945	1	22.945	22.445	23.445	0								0	0	0	0.0081058	1	18210	18210		50.593	27.146	1				3	499	2	2	3	3		9606
AAAAVVVPAEWIK	13	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AAAAVVVPAEWIK_			1	0	0	Q8NI27	Q8NI27	Q8NI27	THOC2	THO complex subunit 2	MULTI-MSMS	DP1141_7	2	683.891357421875	2	683.890095	1365.76564	0.62144	0.000425	-0.23265	-0.00015911	0.38879	0.00026589	683.8897756552276	23.393	0.28279	23.393	23.132	23.414	0					6	3	2	0	0	0	0.011353	1	19056	19056		87.298	50.713	1	7593800			4	478	3	3	4	4		9606
AAAEQAISVR	10	Unmodified	_AAAEQAISVR_			0	0	0	Q01780	Q01780	Q01780	EXOSC10	Exosome component 10	MULTI-MSMS	DP1141_7	2	508.27972412109375	2	508.28018	1014.54581	-0.38848	-0.00019746	0.58193	0.00029578	0.19345	9.8325E-05	508.28070763027165	15.26	0.50049	15.26	14.909	15.409	0					10	4	4	0	0	0	0.0030016	1	6432	6432		140.11	51.935	1	32746000			5	340	4	4	5	5		9606
AAETQTLNFGPEWLR	15	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AAETQTLNFGPEWLR_			1	0	0	Q6Y7W6	Q6Y7W6	Q6Y7W6	GIGYF2	PERQ amino acid-rich with GYF domain-containing protein 2	MULTI-MSMS	DP1141_7	2	888.50634765625	2	887.941576	1773.8686	0.41622	0.00036957	-1.2322	-0.0010942	-0.81602	-0.00072458	887.9395432147699	23.797	0.23553	23.797	23.642	23.878	0					4	2	2	0	0	0	0.0010291	1	19679	19679		138.24	75.828	1	1278900			6	439	5	5	6	6		9606
AAGLATMISTMRPDIDNMDEYVR	23	2 Oxidation (M)	_AAGLATMISTM(Oxidation (M))RPDIDNM(Oxidation (M))DEYVR_	AAGLATM(0.007)ISTM(0.993)RPDIDNM(1)DEYVR	AAGLATM(-21)ISTM(21)RPDIDNM(37)DEYVR	0	2	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	868.4046020507812	3	868.069713	2601.18731	0.28733	0.00024942	-0.34849	-0.00030251	-0.061161	-5.3092E-05	868.404009324636	19.501	0.50051	19.501	19.05	19.551	0					18	4	6	0	0	0	8.3903E-05	3	13131	13048;13131;13162		95.5	73.652	3	163790000			7	78	6	6	7;8;9	8	60;61;62	9606
AAGLATMISTMRPDIDNMDEYVR	23	2 Oxidation (M)	_AAGLATM(Oxidation (M))ISTM(Oxidation (M))RPDIDNMDEYVR_	AAGLATM(0.999)ISTM(0.987)RPDIDNM(0.014)DEYVR	AAGLATM(30)ISTM(19)RPDIDNM(-19)DEYVR	0	2	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	868.4052734375	3	868.069713	2601.18731	0.71641	0.0006219	-0.67654	-0.00058729	0.039872	3.4612E-05	868.4032672074248	19.526	0.40061	19.526	19.175	19.576	0					8	3	3	0	0	0	0.001654	1	13088	13088		65.374	35.131	3	20312000			8	78	6	6	10	10	60;61;62	9606
AAGTAAALAFLSQESR	16	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AAGTAAALAFLSQESR_			1	0	0	O75607	O75607	O75607	NPM3	Nucleoplasmin-3	MULTI-MSMS	DP1141_10	5	803.4140014648438	2	803.415194	1604.81583	0.64018	0.00051433	-0.37815	-0.00030381	0.26203	0.00021052	803.9164900036122	24.173	0.24456	24.173	23.974	24.218	0					6	2	3	0	0	0	8.2071E-06	1	20672	20672		149.23	107.03	1	7608200			9	79	7	7	11	11		9606
AAGVEAAAEVAATEIK	16	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AAGVEAAAEVAATEIK_			1	0	0	P52272	P52272	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	MULTI-MSMS	DP1141_8	3	771.9049682617188	2	771.904128	1541.7937	0.49221	0.00037994	0.98343	0.00075911	1.4756	0.0011391	772.4065363096254	23.199	0.27975	23.199	23.045	23.325	0					9	3	4	0	0	0	1.4978E-09	1	18622	18622		157.03	120.71	1	20444000			10	263	8	8	12	12		9606
AAGVEAAAEVAATEIK	16	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AAGVEAAAEVAATEIK_			1	0	0	P52272	P52272	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	MULTI-MSMS	DP1141_9	4	771.416259765625	2	771.904128	1541.7937	1.0764	0.00083088	-0.12044	-9.297E-05	0.95596	0.00073791	772.4054092674339	23.156	0.24065	23.156	23.018	23.259	0					5	3	2	0	0	0	2.8668E-31	2	18666	18666;18712		176.78	133.97	1	8576200			11	263	8	8	13;14	13		9606
AAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPK	36	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))AAGVEAAAEVAATEIKM(Oxidation (M))EEESGAPGVPSGNGAPGPK_	AAGVEAAAEVAATEIKM(1)EEESGAPGVPSGNGAPGPK	AAGVEAAAEVAATEIKM(80)EEESGAPGVPSGNGAPGPK	1	1	1	P52272	P52272	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	MULTI-MSMS	DP1141_10	5	1136.880859375	3	1136.54722	3406.61984	0.44426	0.00050492	-3.2494	-0.0036931	-2.8051	-0.0031881	1137.2120265699607	23.443	0.47829	23.443	23.151	23.629	0					11	6	2	0	0	0	3.3492E-15	2	19444	19444;19534		80.496	64.354	1	4990700			12	263	9	9	15;16	15	213	9606
AAGVNVEPFWPGLFAK	16	Unmodified	_AAGVNVEPFWPGLFAK_			0	0	0	P05386	P05386	P05386	RPLP1	60S acidic ribosomal protein P1	MULTI-MSMS	DP1141_10	5	852.4534912109375	2	851.951215	1701.88788	0.45631	0.00038875	0.39387	0.00033555	0.85017	0.00072431	852.4531262294691	23.107	0.28833	23.107	22.942	23.23	0					10	3	4	0	0	0	0.0013875	2	19082	19082;19135		144.7	120.42	1	31410000			13	112	10	10	17;18	17		9606
AAIDWFDGK	9	Unmodified	_AAIDWFDGK_			0	0	0	P35637;Q92804	P35637	P35637	FUS;TAF15	RNA-binding protein FUS;TATA-binding protein-associated factor 2N	MULTI-MSMS	DP1141_8	3	511.2546691894531	2	511.750724	1021.4869	0.41058	0.00021012	0.024052	1.2309E-05	0.43463	0.00022242	511.7506568491024	20.31	0.40089	20.31	20.076	20.477	0					7	3	3	0	0	0	2.3902E-08	1	14353	14353		155	44.686	1	71472000			14	209	11	11	19	19		9606
AANATTNPSQLLPLELVDK	19	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AANATTNPSQLLPLELVDK_			1	0	0	Q9Y4Y9	Q9Y4Y9	Q9Y4Y9	LSM5	U6 snRNA-associated Sm-like protein LSm5	MULTI-MSMS	DP1141_10	5	1019.55126953125	2	1019.04677	2036.07899	0.43518	0.00044347	0.57288	0.00058379	1.0081	0.0010273	1019.046368597688	23.577	0.26005	23.577	23.369	23.629	0					9	3	4	0	0	0	9.0277E-06	2	19806	19806;19818		146.59	116.56	1	6896500			15	620	12	12	20;21	20		9606
AAPEEPQQRPPEAVAAAPAGTTSSR	25	Unmodified	_AAPEEPQQRPPEAVAAAPAGTTSSR_			0	0	1	Q96JP5	Q96JP5	Q96JP5	ZFP91	E3 ubiquitin-protein ligase ZFP91	MULTI-MSMS	DP1141_10	5	831.0863647460938	3	830.417486	2488.23063	0.23804	0.00019767	0.33424	0.00027756	0.57228	0.00047523	831.0861347573942	15.506	0.24092	15.506	15.368	15.609	0					6	2	3	0	0	0	0.018072	1	7297	7297		49.318	31.001	1	9771300			16	515	13	13	22	22		9606
AAPGAEFAPNK	11	Unmodified	_AAPGAEFAPNK_			0	0	0	Q15233	Q15233	Q15233	NONO	Non-POU domain-containing octamer-binding protein	MULTI-MSMS	DP1141_8	3	536.9439086914062	2	536.774731	1071.53491	0.46166	0.00024781	-0.086212	-4.6276E-05	0.37545	0.00020153	536.774634996585	15.554	1.0034	15.554	14.972	15.976	0					7	5	2	0	0	0	0.023196	1	6889	6889		78.264	31.27	1	25130000			17	401	14	14	23	23		9606
AAPGAEFAPNKR	12	Unmodified	_AAPGAEFAPNKR_			0	0	1	Q15233	Q15233	Q15233	NONO	Non-POU domain-containing octamer-binding protein	MULTI-MSMS	DP1141_10	5	410.89105224609375	3	410.219283	1227.63602	0.2781	0.00011408	1.4318	0.00058734	1.7099	0.00070142	410.2193414824766	14.627	0.60758	14.627	14.276	14.884	0					21	8	4	0	0	0	0.0030132	1	5767	5767		115.29	78.969	1	22378000			18	401	15	15	24	24		9606
AAPGAEFAPNKR	12	Unmodified	_AAPGAEFAPNKR_			0	0	1	Q15233	Q15233	Q15233	NONO	Non-POU domain-containing octamer-binding protein	MULTI-MSMS	DP1141_8	3	409.9066467285156	3	410.219283	1227.63602	0.33256	0.00013642	-0.10418	-4.2738E-05	0.22838	9.3685E-05	410.2192337389934	14.627	0.32765	14.627	14.445	14.772	0					9	3	3	0	0	0	8.9731E-22	1	5402	5402		173.64	154.4	1	90808000			19	401	15	15	25	25		9606
AAPGAEFAPNKR	12	Unmodified	_AAPGAEFAPNKR_			0	0	1	Q15233	Q15233	Q15233	NONO	Non-POU domain-containing octamer-binding protein	MULTI-MSMS	DP1141_9	4	410.85626220703125	3	410.219283	1227.63602	0.27109	0.00011121	-0.13063	-5.3586E-05	0.14046	5.7621E-05	410.2191432623685	14.678	0.41407	14.678	14.473	14.887	0					7	4	3	0	0	0	0.0041196	2	5225	5225;5345		90.434	68.562	1	10865000			20	401	15	15	26;27	26		9606
AAQAGPTQPGPPR	13	Unmodified	_AAQAGPTQPGPPR_			0	0	0	Q9BUL5	Q9BUL5	Q9BUL5	PHF23	PHD finger protein 23	MULTI-MSMS	DP1141_8	3	624.3286743164062	2	624.328193	1246.64183	0.14139	8.8273E-05	-0.00017658	-1.1024E-07	0.14121	8.8163E-05	624.3280051658543	14.013	0.69358	14.013	13.66	14.354	0					14	8	3	0	0	0	5.4747E-10	4	4469	4247;4425;4469;4538		164.97	121.89	1	6656000			21	541	16	16	28;29;30;31	30		9606
AAQAGPTQPGPPR	13	Unmodified	_AAQAGPTQPGPPR_			0	0	0	Q9BUL5	Q9BUL5	Q9BUL5	PHF23	PHD finger protein 23	MULTI-MSMS	DP1141_9	4	624.3284912109375	2	624.328193	1246.64183	0.25558	0.00015956	-0.043431	-2.7115E-05	0.21214	0.00013245	624.3277836897612	14.049	0.64002	14.049	13.538	14.178	0					11	9	2	0	0	0	0.000665	2	4362	4362;4441		130.98	77.208	1	2176900			22	541	16	16	32;33	32		9606
AAQQQEEQEEKEEEDDEQTLHR	22	Unmodified	_AAQQQEEQEEKEEEDDEQTLHR_			0	0	1	P78318	P78318	P78318	IGBP1	Immunoglobulin-binding protein 1	MULTI-MSMS	DP1141_9	4	675.82421875	4	675.547036	2698.15904	0.51541	0.00034818	-0.54698	-0.00036951	-0.031573	-2.1329E-05	675.7973949769129	15.324	0.39614	15.324	15.075	15.471	0					10	3	4	0	0	0	1.4565E-06	1	6268	6268		91.589	75.493	1	15185000			23	325	17	17	34	34		9606
AASAAAASAAAASAASGSPGPGEGSAGGEKR	31	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AASAAAASAAAASAASGSPGPGEGSAGGEKR_			1	0	1	Q13263	Q13263	Q13263	TRIM28	Transcription intermediary factor 1-beta	MULTI-MSMS	DP1141_7	2	862.4248657226562	3	862.41106	2584.21135	0.34832	0.00030039	0.52302	0.00045106	0.87134	0.00075145	862.7457996785423	18.199	0.30011	18.199	18.049	18.349	0					4	2	2	0	0	0	0	2	11268	11268;11353		286.7	251.66	1	176220000			24	372	18	18	35;36	35		9606
AASDIAMTELPPTHPIR	17	Oxidation (M)	_AASDIAM(Oxidation (M))TELPPTHPIR_	AASDIAM(1)TELPPTHPIR	AASDIAM(59)TELPPTHPIR	0	1	0	P62258	P62258	P62258	YWHAE	14-3-3 protein epsilon	MULTI-SECPEP	DP1141_10	5	612.8408813476562	3	612.648854	1834.92473	-0.52405	-0.00032106	0.57704	0.00035352	0.052988	3.2463E-05	612.9831400630202	16.973	0.33974	16.973	16.847	17.187	0					9	4	3	0	0	0	0.022152	1	9550	9550		58.814	30.002	1	17479000			25	290	19	19	37	37	233	9606
AASDIAMTELPPTHPIR	17	Oxidation (M)	_AASDIAM(Oxidation (M))TELPPTHPIR_	AASDIAM(1)TELPPTHPIR	AASDIAM(50)TELPPTHPIR	0	1	0	P62258	P62258	P62258	YWHAE	14-3-3 protein epsilon	MULTI-MSMS	DP1141_9	4	612.8408813476562	3	612.648854	1834.92473	-0.053565	-3.2817E-05	0.84721	0.00051904	0.79364	0.00048622	612.9833014128317	17.007	0.54091	17.007	16.896	17.437	0					7	5	2	0	0	0	0.028854	1	9084	9084		50.04	31.902	1	4750500			26	290	19	19	38	38	233	9606
AASVHTVGEDTEETPHR	17	Unmodified	_AASVHTVGEDTEETPHR_			0	0	0	Q99575	Q99575	Q99575	POP1	Ribonucleases P/MRP protein subunit POP1	MULTI-MSMS	DP1141_6	1	459.7185974121094	4	459.718419	1834.84457	0.51918	0.00023867	-0.050587	-2.3256E-05	0.46859	0.00021542	459.96913773719996	13.925	0.47967	13.925	13.736	14.215	0					11	5	3	0	0	0	0.00010665	1	3997	3997		110.84	88.453	1	1877100			27	528	20	20	39	39		9606
AASVHTVGEDTEETPHR	17	Unmodified	_AASVHTVGEDTEETPHR_			0	0	0	Q99575	Q99575	Q99575	POP1	Ribonucleases P/MRP protein subunit POP1	MULTI-MSMS	DP1141_6	1	612.990966796875	3	612.622133	1834.84457	0.6573	0.00040268	-0.21584	-0.00013223	0.44146	0.00027045	612.6216363367216	13.925	0.31884	13.925	13.736	14.054	0					5	3	2	0	0	0	0.00029969	1	4004	4004		119.96	94.095	1	758720			28	528	20	20	40	40		9606
AASVHTVGEDTEETPHR	17	Unmodified	_AASVHTVGEDTEETPHR_			0	0	0	Q99575	Q99575	Q99575	POP1	Ribonucleases P/MRP protein subunit POP1	MULTI-MSMS	DP1141_7	2	459.71868896484375	4	459.718419	1834.84457	0.82799	0.00038064	-0.367	-0.00016871	0.461	0.00021193	459.7182386455592	13.904	0.50953	13.904	13.701	14.21	0					12	5	4	0	0	0	0.00010325	2	4431	4431;4524		109.1	86.117	1	11689000			29	528	20	20	41;42	41		9606
AATASAGAGGIDGKPR	16	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AATASAGAGGIDGKPR_			1	0	1	Q02978	Q02978	Q02978	SLC25A11	Mitochondrial 2-oxoglutarate/malate carrier protein	MULTI-MSMS	DP1141_10	5	721.3735961914062	2	721.373329	1440.73211	0.93965	0.00067784	-0.63699	-0.00045951	0.30266	0.00021833	721.37294778995	15.32	0.42163	15.32	15.039	15.46	0					11	4	4	0	0	0	0	1	6880	6880		256.95	206.47	1	35519000			30	344	21	21	43	43		9606
AATASAGAGGIDGKPR	16	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AATASAGAGGIDGKPR_			1	0	1	Q02978	Q02978	Q02978	SLC25A11	Mitochondrial 2-oxoglutarate/malate carrier protein	MULTI-MSMS	DP1141_6	1	721.3737182617188	2	721.373329	1440.73211	0.21746	0.00015687	0.21013	0.00015158	0.42759	0.00030845	721.3735436503581	15.358	0.40211	15.358	15.108	15.51	0					9	3	3	0	0	0	0.0027811	1	6119	6119		137.16	102.36	1	19852000			31	344	21	21	44	44		9606
AATASAGAGGIDGKPR	16	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AATASAGAGGIDGKPR_			1	0	1	Q02978	Q02978	Q02978	SLC25A11	Mitochondrial 2-oxoglutarate/malate carrier protein	MULTI-MSMS	DP1141_9	4	721.373779296875	2	721.373329	1440.73211	0.78463	0.00056601	-0.39364	-0.00028396	0.39099	0.00028205	721.3728813782354	15.375	0.39614	15.375	15.075	15.471	0					5	3	2	0	0	0	0.0013116	1	6563	6563		122.33	81.444	1	4349500			32	344	21	21	45	45		9606
AATGEEVSAEDLGGADLHCR	20	Unmodified	_AATGEEVSAEDLGGADLHCR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	687.028076171875	3	686.644609	2056.912	0.59872	0.00041111	-0.44301	-0.00030419	0.15571	0.00010692	686.6448616341869	17.223	0.70111	17.223	17.073	17.774	0					19	6	5	0	0	0	0.0081142	3	9461	9461;9694;9713		83.891	44.869	1	2204600000			33	567	22	22	46;47;48	46		9606
AATGEEVSAEDLGGADLHCR	20	Unmodified	_AATGEEVSAEDLGGADLHCR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	1029.46337890625	2	1029.46327	2056.912	0.5786	0.00059565	-0.60126	-0.00061897	-0.022655	-2.3323E-05	1029.4627515962986	17.223	0.50121	17.223	17.073	17.574	0					9	4	3	0	0	0	0.00022743	2	9718	9718;9722		99.161	81.066	1	287870000			34	567	22	22	49;50	49		9606
AATGEEVSAEDLGGADLHCR	20	Unmodified	_AATGEEVSAEDLGGADLHCR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	687.3099975585938	3	686.644609	2056.912	0.095755	6.575E-05	0.071548	4.9128E-05	0.1673	0.00011488	686.9789307367446	17.288	0.44116	17.288	16.896	17.338	0					13	4	4	0	0	0	2.7645E-07	1	9457	9457		121.26	73.348	1	308100000			35	567	22	22	51	51		9606
AATGEEVSAEDLGGADLHCRK	21	Unmodified	_AATGEEVSAEDLGGADLHCRK_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-SECPEP	DP1141_8	3	547.7964477539062	4	547.259016	2185.00696	0.32698	0.00017894	-0.69834	-0.00038217	-0.37136	-0.00020323	547.5093886826082	16.326	0.39356	16.326	16.076	16.469	0					9	3	3	0	0	0	0.017423	1	7952	7952		48.376	38.765	1	16335000			36	567	23	23	52	52		9606
AAVENLPTFLVELSR	15	Unmodified	_AAVENLPTFLVELSR_			0	0	0	Q14974	Q14974	Q14974	KPNB1	Importin subunit beta-1	MULTI-MSMS	DP1141_7	2	830.4613037109375	2	829.959237	1657.90392	0.50358	0.00041795	0.31494	0.00026139	0.81852	0.00067934	829.9593691229246	23.436	0.28057	23.436	23.278	23.559	0					5	3	2	0	0	0	5.2361E-100	1	19167	19167		213.63	180.57	1	30855000			37	395	24	24	53	53		9606
AAVENLPTFLVELSR	15	Unmodified	_AAVENLPTFLVELSR_			0	0	0	Q14974	Q14974	Q14974	KPNB1	Importin subunit beta-1	MULTI-MSMS	DP1141_8	3	830.59765625	2	829.959237	1657.90392	0.83654	0.00069429	0.18342	0.00015223	1.02	0.00084652	829.9591481107348	23.466	0.22581	23.466	23.325	23.551	0					6	2	3	0	0	0	0.002682	1	18935	18935		100.09	62.389	1	4578400			38	395	24	24	54	54		9606
AAVLLEQER	9	Unmodified	_AAVLLEQER_			0	0	0	Q13435	Q13435	Q13435	SF3B2	Splicing factor 3B subunit 2	MSMS	DP1141_7	2	514.7392578125	2	514.790381	1027.56621	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.534	1	16.534	16.034	17.034	0								0	0	0	2.7365E-05	1	8517	8517		141.52	67.217	1				39	374	25	25	55	55		9606
AAVLQQVLER	10	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AAVLQQVLER_			1	0	0	P12270	P12270	P12270	TPR	Nucleoprotein TPR	MULTI-MSMS	DP1141_7	2	584.8379516601562	2	584.837862	1167.66117	0.65142	0.00038098	-0.14211	-8.3109E-05	0.50932	0.00029787	584.837650156799	24.042	0.20655	24.042	23.878	24.084	0					6	2	3	0	0	0	0.00086672	1	20049	20049		127.68	84.028	1	5159900			40	144	26	26	56	56		9606
AAVSAFPTDSLER	13	Unmodified	_AAVSAFPTDSLER_			0	0	0	O14654	O14654	O14654	IRS4	Insulin receptor substrate 4	MSMS	DP1141_6	1	682.28564453125	2	682.346249	1362.67794	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.442	1	18.442	17.942	18.942	0								0	0	0	0.023491	1	10978	10978		121.61	78.743	1				41	44	27	27	57	57		9606
AAYFGIYDTAK	11	Unmodified	_AAYFGIYDTAK_			0	0	0	P05141	P05141	P05141	SLC25A5	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed	MULTI-MSMS	DP1141_6	1	610.3334350585938	2	610.303321	1218.59209	0.729	0.00044491	-0.36218	-0.00022104	0.36682	0.00022387	610.3032216670166	19.355	0.5005	19.355	19.005	19.506	0					6	4	2	0	0	0	0.0030329	1	12352	12352		155.58	131.35	1	5788000			42	109	28	28	58	58		9606
ACTELGIR	8	Unmodified	_ACTELGIR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-SECPEP	DP1141_6	1	460.9130859375	2	460.236927	918.459301	0.26261	0.00012086	0.14169	6.521E-05	0.40429	0.00018607	460.2369649915712	16.055	0.50054	16.055	15.905	16.405	0					5	4	2	0	0	0	3.3355E-05	1	7044	7044		143.02	23.462	1	61787000			43	142	29	29	59	59		9606
ACTELGIR	8	Unmodified	_ACTELGIR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	460.7640380859375	2	460.236927	918.459301	0.66793	0.0003074	-0.66473	-0.00030594	0.0031923	1.4692E-06	460.23663834129445	16.064	0.50024	16.064	15.914	16.415	0					6	4	2	0	0	0	1.2644E-09	1	7661	7661		158.38	43.658	1	349240000			44	142	29	29	60	60		9606
ACTELGIR	8	Unmodified	_ACTELGIR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-SECPEP	DP1141_9	4	460.2646179199219	2	460.236927	918.459301	-0.34249	-0.00015763	-0.10169	-4.6803E-05	-0.44418	-0.00020443	460.2372664456018	16.065	0.28576	16.065	15.872	16.158	0					6	2	3	0	0	0	7.9885E-05	1	7577	7577		133.47	22.836	1	4843500			45	142	29	29	61	61		9606
ACTILLR	7	Unmodified	_ACTILLR_			0	0	0	P49368	P49368	P49368	CCT3	T-complex protein 1 subunit gamma	MULTI-MSMS	DP1141_8	3	424.2434997558594	2	423.746931	845.479308	0.15444	6.5443E-05	-0.3903	-0.00016539	-0.23586	-9.9945E-05	423.7468251731167	17.223	0.40095	17.223	16.973	17.374	0					5	3	2	0	0	0	0.03323	1	9486	9486		92.692	42.573	1	22024000			46	246	30	30	62	62		9606
ADEAYLIGR	9	Unmodified	_ADEAYLIGR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-SECPEP	DP1141_10	5	504.27435302734375	2	504.261456	1006.50836	-0.17485	-8.8171E-05	0.85279	0.00043003	0.67794	0.00034186	504.26186211225297	17.79	0.39977	17.79	17.588	17.987	0					6	3	2	0	0	0	2.8185E-26	1	10941	10941		198.07	122.96	1	6741200			47	142	31	31	63	63		9606
ADEAYLIGR	9	Unmodified	_ADEAYLIGR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	504.2742919921875	2	504.261456	1006.50836	0.77699	0.0003918	0.020756	1.0466E-05	0.79774	0.00040227	504.2614230232271	17.755	0.50021	17.755	17.605	18.105	0					10	4	3	0	0	0	2.2383E-51	2	9901	9901;10035		191.63	117.37	1	19848000			48	142	31	31	64;65	64		9606
ADEGISFR	8	Unmodified	_ADEGISFR_			0	0	0	Q06830	Q06830	Q06830	PRDX1	Peroxiredoxin-1	MULTI-MSMS	DP1141_10	5	447.7193298339844	2	447.719424	893.424296	-0.56115	-0.00025124	0.69784	0.00031244	0.13669	6.1198E-05	447.7196200018175	16.893	0.33974	16.893	16.847	17.187	0					9	4	3	0	0	0	0.029014	1	9636	9636		86.794	33.442	1	18088000			49	348	32	32	66	66		9606
ADFAQACQDAGVR	13	Unmodified	_ADFAQACQDAGVR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MSMS	DP1141_6	1	704.8179321289062	2	704.817332	1407.62011	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.75	1	16.75	16.25	17.25	0								0	0	0	1.6017999999999998E-32	1	8226	8226		165.63	123.29	1				50	142	33	33	67	67		9606
ADGELNVDSLITR	13	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ADGELNVDSLITR_			1	0	0	P62140	P62140	P62140	PPP1CB	Serine/threonine-protein phosphatase PP1-beta catalytic subunit	MULTI-MSMS	DP1141_9	4	723.8707885742188	2	722.867545	1443.72054	0.42661	0.00030838	1.0256	0.0007414	1.4523	0.0010498	722.8678952627903	22.236	0.76864	22.236	21.736	22.504	0					29	8	6	0	0	0	0.0046614	2	17333	17329;17333		107.34	62.704	1	121490000			51	287	34	34	68;69	69		9606
ADLDKLNIDSIIQR	14	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ADLDKLNIDSIIQR_			1	0	1	P36873	P36873	P36873	PPP1CC	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_9	4	828.4520263671875	2	828.451776	1654.889	-0.42565	-0.00035263	0.5586	0.00046277	0.13295	0.00011015	828.4522111029365	21.979	0.66697	21.979	21.538	22.205	0					15	6	5	0	0	0	0.0010603	3	16965	16949;16965;16967		145.81	108.48	1	97759000			52	212	35	35	70;71;72	71		9606
ADLEMQIESLTEELAYLKK	19	Oxidation (M)	_ADLEM(Oxidation (M))QIESLTEELAYLKK_	ADLEM(1)QIESLTEELAYLKK	ADLEM(120)QIESLTEELAYLKK	0	1	1	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_7	2	747.7186279296875	3	747.383732	2239.12937	0.67696	0.00050595	0.40608	0.0003035	1.083	0.00080944	747.7180586671589	23.692	0.46321	23.692	23.414	23.878	0					8	5	3	0	0	0	0.00010175	1	19665	19665		123.63	91.442	1	7564000		+	53	17	36	36	73	73	14	9606
ADLLGSILSSMEKPPSLGDQETR	23	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))ADLLGSILSSM(Oxidation (M))EKPPSLGDQETR_	ADLLGSILSSM(1)EKPPSLGDQETR	ADLLGSILSSM(170)EKPPSLGDQETR	1	1	1	O75391	O75391	O75391	SPAG7	Sperm-associated antigen 7	MULTI-MSMS	DP1141_10	5	835.0858154296875	3	834.751254	2501.23193	0.50603	0.00042241	0.41071	0.00034284	0.91674	0.00076525	835.0860586552237	23.581	0.43008	23.581	23.42	23.851	0					12	5	5	0	0	0	1.9535000000000003E-24	2	19797	19797;19851		166.34	137.99	1	12540000			54	73	37	37	74;75	74	57	9606
ADQSFTSPPPR	11	Unmodified	_ADQSFTSPPPR_			0	0	0	Q9HBM6;Q16594	Q9HBM6	Q9HBM6	TAF9B;TAF9	Transcription initiation factor TFIID subunit 9B;Transcription initiation factor TFIID subunit 9	MSMS	DP1141_10	5	601.794677734375	2	601.793652	1201.57275	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.291	1	15.291	14.791	15.791	0								0	0	0	0.014827	1	6804	6804		102.06	66.624	1				55	411	38	38	76	76		9606
ADRDESSPYAAMLAAQDVAQR	21	Oxidation (M)	_ADRDESSPYAAM(Oxidation (M))LAAQDVAQR_	ADRDESSPYAAM(1)LAAQDVAQR	ADRDESSPYAAM(110)LAAQDVAQR	0	1	1	P62263	P62263	P62263	RPS14	40S ribosomal protein S14	MULTI-MSMS	DP1141_10	5	761.3568725585938	3	761.021967	2280.04407	0.10123	7.7036E-05	0.42515	0.00032355	0.52638	0.00040058	761.3566761569575	17.735	0.2999	17.735	17.488	17.788	0					10	2	5	0	0	0	2.9031E-07	1	10921	10921		108.37	86.976	1	33886000			56	291	39	39	77	77	234	9606
ADVFHAYLSLLK	12	Unmodified	_ADVFHAYLSLLK_			0	0	0	Q86VP6	Q86VP6	Q86VP6	CAND1	Cullin-associated NEDD8-dissociated protein 1	MULTI-MSMS	DP1141_7	2	688.8828125	2	688.88227	1375.74999	0.84176	0.00057987	0.0010734	7.3946E-07	0.84283	0.00058061	688.8822632753498	22.288	0.34007	22.288	22.146	22.486	0					5	3	2	0	0	0	0.017753	1	17511	17511		82.831	54.749	1	26460000			57	458	40	40	78	78		9606
AEAEAQAEELSFPR	14	Unmodified	_AEAEAQAEELSFPR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	774.3711547851562	2	774.370452	1546.72635	0.51943	0.00040224	0.02938	2.2751E-05	0.54882	0.00042499	774.3704177413279	18.6	0.60037	18.6	18.249	18.85	0					12	5	4	0	0	0	0	3	11873	11830;11873;11887		369.42	325.98	1	584000000			58	142	41	41	79;80;81	80		9606
AEAEAQAEELSFPR	14	Unmodified	_AEAEAQAEELSFPR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	516.7824096679688	3	516.582727	1546.72635	-0.076727	-3.9636E-05	0.42612	0.00022012	0.34939	0.00018049	516.5829749383257	18.6	0.30053	18.6	18.349	18.65	0					6	2	3	0	0	0	1.1293E-115	1	11847	11847		182.37	152.82	1	33922000			59	142	41	41	82	82		9606
AEAEAQAEELSFPR	14	Unmodified	_AEAEAQAEELSFPR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	774.3710327148438	2	774.370452	1546.72635	0.56931	0.00044086	0.27206	0.00021067	0.84137	0.00065153	774.3706428377928	18.525	0.30008	18.525	18.375	18.675	0					4	2	2	0	0	0	0.0047052	1	11769	11769		95.273	55.489	1	208080000			60	142	41	41	83	83		9606
AEAEAQAEELSFPR	14	Unmodified	_AEAEAQAEELSFPR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_9	4	774.8719482421875	2	774.370452	1546.72635	0.87324	0.00067621	-0.00056328	-4.3619E-07	0.87268	0.00067578	774.3703022896887	18.587	0.39997	18.587	18.337	18.737	0					7	3	3	0	0	0	5.0767E-157	1	11723	11723		234.24	198.79	1	130080000			61	142	41	41	84	84		9606
AEAESWYQTK	10	Unmodified	_AEAESWYQTK_			0	0	0	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;O95678;CON__O95678;CON__Q8VED5;P04259	CON__P02538;P04259	CON__P02538	KRT6A;KRT6C;KRT75;KRT6B	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 75;Keratin, type II cytoskeletal 6B	MULTI-MSMS	DP1141_9	4	606.7806396484375	2	606.78021	1211.54587	-0.19639	-0.00011916	0.652	0.00039562	0.45561	0.00027646	606.7806343493072	16.907	0.35613	16.907	16.782	17.138	0					9	4	3	0	0	0	5.8859000000000006E-154	2	9024	9024;9047		239.66	186.88	1	32654000		+	62	10;101	42	42	85;86	85		9606
AEDGATPSPSNETPK	15	Unmodified	_AEDGATPSPSNETPK_			0	0	0	P29966	P29966	P29966	MARCKS	Myristoylated alanine-rich C-kinase substrate	MULTI-MSMS	DP1141_8	3	750.8442993164062	2	750.844267	1499.67398	0.42164	0.00031659	-0.19153	-0.00014381	0.23011	0.00017278	750.8441836002356	14.086	0.37395	14.086	13.805	14.179	0					8	4	3	0	0	0	0.021648	1	4648	4648		72.289	38.911	1	4589900			63	195	43	43	87	87		9606
AEDKEWMPVTK	11	Oxidation (M)	_AEDKEWM(Oxidation (M))PVTK_	AEDKEWM(1)PVTK	AEDKEWM(130)PVTK	0	1	1	P15880	P15880	P15880	RPS2	40S ribosomal protein S2	MULTI-MSMS	DP1141_9	4	450.9018859863281	3	450.551711	1348.6333	-0.11811	-5.3215E-05	0.25054	0.00011288	0.13243	5.9667E-05	450.5517839128137	15.224	0.39185	15.224	14.98	15.372	0					7	3	3	0	0	0	0.0056035	1	6119	6119		134.56	106.28	1	21397000			64	155	44	44	88	88	151	9606
AEDKEWMPVTK	11	Oxidation (M)	_AEDKEWM(Oxidation (M))PVTK_	AEDKEWM(1)PVTK	AEDKEWM(130)PVTK	0	1	1	P15880	P15880	P15880	RPS2	40S ribosomal protein S2	MULTI-MSMS	DP1141_9	4	674.9625244140625	2	675.323928	1348.6333	0.5393	0.0003642	0.14257	9.6283E-05	0.68188	0.00046049	675.8257519147625	15.204	0.29438	15.204	14.98	15.274	0					6	2	3	0	0	0	0.0218	1	6140	6140		134.3	74.202	1	4343400			65	155	44	44	89	89	151	9606
AEFVEVTK	8	Unmodified	_AEFVEVTK_			0	0	0	CON__P02769	CON__P02769	CON__P02769			MSMS	DP1141_10	5	461.7478942871094	2	461.74765	921.480748	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.288	1	16.288	15.788	16.788	0								0	0	0	2.234E-21	1	8468	8468		161.9	82.447	1			+	66	15	45	45	90	90		
AEFVEVTK	8	Unmodified	_AEFVEVTK_			0	0	0	CON__P02769	CON__P02769	CON__P02769			MSMS	DP1141_6	1	461.72491455078125	2	461.74765	921.480748	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.273	1	16.273	15.773	16.773	0								0	0	0	1.1651E-13	1	7421	7421		155	59.644	1			+	67	15	45	45	91	91		
AELDDTPMR	9	Unmodified	_AELDDTPMR_			0	0	0	P23246	P23246	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	MULTI-SECPEP	DP1141_8	3	524.9365844726562	2	524.242406	1046.47026	-0.090051	-4.7209E-05	-0.27392	-0.0001436	-0.36397	-0.00019081	524.2420259803329	16.072	0.30017	16.072	15.876	16.176	0					4	2	2	0	0	0	0.010561	1	7681	7681		119.27	75.467	1	2868100			68	181	46	46	92	92		9606
AEPGEGTRPATVGDSSAR	18	Unmodified	_AEPGEGTRPATVGDSSAR_			0	0	1	Q9BTC0	Q9BTC0	Q9BTC0	DIDO1	Death-inducer obliterator 1	MULTI-SECPEP	DP1141_7	2	587.02001953125	3	586.618611	1756.834	0.97609	0.00057259	-0.18683	-0.0001096	0.78926	0.000463	586.6185393886337	13.99	0.52892	13.99	13.78	14.309	0					11	5	3	0	0	0	0.0018128	1	4469	4469		84.195	54.019	1	14045000			69	539	47	47	93	93		9606
AEPYCSVLPGFTFIQHLPLSER	22	Unmodified	_AEPYCSVLPGFTFIQHLPLSER_			0	0	0	Q9BUJ2	Q9BUJ2	Q9BUJ2	HNRNPUL1	Heterogeneous nuclear ribonucleoprotein U-like protein 1	MULTI-MSMS	DP1141_7	2	854.7677001953125	3	854.43342	2560.27843	0.45915	0.00039231	-0.3398	-0.00029034	0.11934	0.00010197	854.4331129972056	22.953	0.26205	22.953	22.728	22.99	0					14	3	5	0	0	0	5.4112E-07	2	18422	18307;18422		127.1	107.7	1	28970000			70	540	48	48	94;95	95		9606
AFAVVASALGIPSLLPFLK	19	Unmodified	_AFAVVASALGIPSLLPFLK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	958.0776977539062	2	957.57678	1913.13901	0.4096	0.00039222	0.21084	0.0002019	0.62044	0.00059412	957.5766058798677	25.677	0.40071	25.677	25.459	25.859	0					8	4	3	0	0	0	4.0507E-125	2	22335	22335;22397		219.89	208.44	1	4064000			71	78	49	49	96;97	96		9606
AFENDVDALCNLR	13	Unmodified	_AFENDVDALCNLR_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	769.3510131835938	2	768.859197	1535.70384	0.48929	0.00037619	0.75635	0.00058153	1.2456	0.00095772	768.8594832994949	20.026	0.29985	20.026	19.877	20.176	0					6	2	3	0	0	0	2.2841999999999997E-66	2	13914	13914;13981		247.22	204.89	1	29898000			72	111	50	50	98;99	98		9606
AFHNEAQVNPER	12	Unmodified	_AFHNEAQVNPER_			0	0	0	P17987	P17987	P17987	TCP1	T-complex protein 1 subunit alpha	MULTI-SECPEP	DP1141_10	5	470.8839111328125	3	471.228618	1410.66403	0.14959	7.0492E-05	0.22073	0.00010402	0.37032	0.00017451	471.22878735210514	14.123	0.51517	14.123	13.824	14.339	0					14	8	3	0	0	0	0.010162	1	5247	5247		84.718	62.672	1	16710000			73	165	51	51	100	100		9606
AFHNEAQVNPER	12	Unmodified	_AFHNEAQVNPER_			0	0	0	P17987	P17987	P17987	TCP1	T-complex protein 1 subunit alpha	MULTI-MSMS	DP1141_6	1	471.2288513183594	3	471.228618	1410.66403	-0.0076931	-3.6252E-06	0.48542	0.00022875	0.47773	0.00022512	471.2288028237193	14.359	0.52275	14.359	13.886	14.409	0					14	5	4	0	0	0	0.0014285	3	4530	4385;4413;4530		111.94	102.19	1	7587600			74	165	51	51	101;102;103	103		9606
AFHNEAQVNPER	12	Unmodified	_AFHNEAQVNPER_			0	0	0	P17987	P17987	P17987	TCP1	T-complex protein 1 subunit alpha	MSMS	DP1141_6	1	706.3402099609375	2	706.339289	1410.66403	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.316	1	14.316	13.816	14.816	0								0	0	0	0.026216	1	4467	4467		119.53	88.455	1				75	165	51	51	104	104		9606
AFHNEAQVNPER	12	Unmodified	_AFHNEAQVNPER_			0	0	0	P17987	P17987	P17987	TCP1	T-complex protein 1 subunit alpha	MULTI-SECPEP	DP1141_8	3	471.602783203125	3	471.228618	1410.66403	0.098526	4.6428E-05	0.26765	0.00012612	0.36617	0.00017255	471.2287051768962	14.31	0.46947	14.31	13.884	14.354	0					8	5	2	0	0	0	0.0047702	1	4900	4900		107.53	66.365	1	29691000			76	165	51	51	105	105		9606
AFHNEAQVNPER	12	Unmodified	_AFHNEAQVNPER_			0	0	0	P17987	P17987	P17987	TCP1	T-complex protein 1 subunit alpha	MULTI-MSMS	DP1141_9	4	471.49072265625	3	471.228618	1410.66403	0.21257	0.00010017	-0.014208	-6.6951E-06	0.19837	9.3476E-05	471.2286804791478	14.142	0.44799	14.142	13.94	14.388	0					22	6	4	0	0	0	0.0069889	1	4747	4747		82.774	51.902	1	108700000			77	165	51	51	106	106		9606
AFLADPSAFVAAAPVAAATTAAPAAAAAPAK	31	Unmodified	_AFLADPSAFVAAAPVAAATTAAPAAAAAPAK_			0	0	0	P05388	P05388	P05388	RPLP0	60S acidic ribosomal protein P0	MULTI-MSMS	DP1141_9	4	918.4942626953125	3	918.160465	2751.45957	0.78332	0.00071921	-0.50999	-0.00046825	0.27332	0.00025096	918.4939846294222	21.782	0.39179	21.782	21.538	21.93	0					9	3	4	0	0	0	1.7911E-38	2	16624	16417;16624		165.01	142.31	1	29935000			78	114	52	52	107;108	108		9606
AFVDFLSDEIKEER	14	Unmodified	_AFVDFLSDEIKEER_			0	0	1	Q07021	Q07021	Q07021	C1QBP	Complement component 1 Q subcomponent-binding protein, mitochondrial	MULTI-MSMS	DP1141_10	5	566.9578247070312	3	566.617548	1696.83082	1.1839	0.00067081	-0.72791	-0.00041245	0.45596	0.00025836	566.617131068288	21.126	0.68371	21.126	20.975	21.659	0					8	6	2	0	0	0	2.7825999999999996E-52	2	16224	16224;16278		193	143.64	1	129050000			79	350	53	53	109;110	109		9606
AFYGDTLVTGFAR	13	Unmodified	_AFYGDTLVTGFAR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-SECPEP	DP1141_6	1	708.86181640625	2	709.359159	1416.70376	1.1602	0.00082302	-0.29407	-0.0002086	0.86616	0.00061442	709.35896292061	20.911	0.37241	20.911	20.582	20.954	0					7	3	3	0	0	0	5.1193E-140	1	14731	14731		242.12	189.4	1	12640000			80	567	54	54	111	111		9606
AFYGDTLVTGFAR	13	Unmodified	_AFYGDTLVTGFAR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	710.3781127929688	2	709.359159	1416.70376	0.48602	0.00034476	0.37065	0.00026292	0.85667	0.00060769	709.3595768641624	20.828	0.901	20.828	20.578	21.479	0					15	8	3	0	0	0	3.7321E-09	2	15028	15028;15209		156.16	110.79	1	1171300000			81	567	54	54	112;113	112		9606
AFYPEEISSMVLTK	14	Oxidation (M)	_AFYPEEISSM(Oxidation (M))VLTK_	AFYPEEISSM(1)VLTK	AFYPEEISSM(120)VLTK	0	1	0	P0DMV8;P0DMV9;P34931	P0DMV8	P0DMV8	HSPA1A;HSPA1B;HSPA1L	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like	MULTI-MSMS	DP1141_10	5	815.9060668945312	2	815.905282	1629.79601	0.89188	0.00072769	0.15318	0.00012498	1.0451	0.00085267	815.9055027743742	20.266	0.39996	20.266	19.976	20.376	0					9	3	3	0	0	0	0.010037	3	14955	14784;14905;14955		123.67	99.791	1	19239000			82	135	55	55	114;115;116	116	126	9606
AFYPEEISSMVLTK	14	Oxidation (M)	_AFYPEEISSM(Oxidation (M))VLTK_	AFYPEEISSM(1)VLTK	AFYPEEISSM(170)VLTK	0	1	0	P0DMV8;P0DMV9;P34931	P0DMV8	P0DMV8	HSPA1A;HSPA1B;HSPA1L	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like	MULTI-MSMS	DP1141_8	3	815.9056396484375	2	815.905282	1629.79601	0.843	0.00068781	-0.08775	-7.1595E-05	0.75525	0.00061622	815.9053065740154	20.236	0.60076	20.236	19.877	20.477	0					21	5	6	0	0	0	1.2012E-13	2	14198	14010;14198		166.29	133.23	1	244950000			83	135	55	55	117;118	118	126	9606
AFYPEEISSMVLTK	14	Oxidation (M)	_AFYPEEISSM(Oxidation (M))VLTK_	AFYPEEISSM(1)VLTK	AFYPEEISSM(130)VLTK	0	1	0	P0DMV8;P0DMV9;P34931	P0DMV8	P0DMV8	HSPA1A;HSPA1B;HSPA1L	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like	MULTI-MSMS	DP1141_8	3	544.6065673828125	3	544.272613	1629.79601	0.73097	0.00039785	-0.41609	-0.00022647	0.31487	0.00017138	544.2724721968732	20.278	0.50083	20.278	19.976	20.477	0					11	4	4	0	0	0	0.00038083	2	14307	14307;14357		139.86	118.04	1	27781000			84	135	55	55	119;120	119	126	9606
AFYPEEISSMVLTK	14	Unmodified	_AFYPEEISSMVLTK_			0	0	0	P0DMV8;P0DMV9;P34931	P0DMV8	P0DMV8	HSPA1A;HSPA1B;HSPA1L	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like	MULTI-MSMS	DP1141_8	3	807.90966796875	2	807.907824	1613.8011	0.81443	0.00065799	-0.070195	-5.6711E-05	0.74424	0.00060127	807.9079197169914	21.729	0.50047	21.729	21.379	21.879	0					15	4	5	0	0	0	6.4877E-09	2	16327	16327;16366		158.08	113.84	1	257080000			85	135	55	56	121;122	121		9606
AFYPEEISSMVLTK	14	Unmodified	_AFYPEEISSMVLTK_			0	0	0	P0DMV8;P0DMV9;P34931	P0DMV8	P0DMV8	HSPA1A;HSPA1B;HSPA1L	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like	MULTI-SECPEP	DP1141_9	4	807.9564819335938	2	807.907824	1613.8011	-0.16442	-0.00013284	0.31175	0.00025186	0.14732	0.00011902	807.9085146786772	21.689	0.59069	21.689	21.438	22.029	0					6	5	2	0	0	0	0.011146	1	16468	16468		111.63	76.406	1	12073000			86	135	55	56	123	123		9606
AGAAGGPEEEAEKPVK	16	Unmodified	_AGAAGGPEEEAEKPVK_			0	0	1	Q8WW12	Q8WW12	Q8WW12	PCNP	PEST proteolytic signal-containing nuclear protein	MULTI-MSMS	DP1141_10	5	513.9266967773438	3	513.926493	1538.75765	0.48824	0.00025092	-0.03567	-1.8332E-05	0.45257	0.00023259	513.9265607271586	13.904	0.97317	13.904	13.18	14.153	0					53	15	5	0	0	0	0.010275	1	4169	4169		150.9	121.6	1	235520000			87	486	56	57	124	124		9606
AGAAGGPEEEAEKPVK	16	Unmodified	_AGAAGGPEEEAEKPVK_			0	0	1	Q8WW12	Q8WW12	Q8WW12	PCNP	PEST proteolytic signal-containing nuclear protein	MULTI-MSMS	DP1141_10	5	770.3861694335938	2	770.386102	1538.75765	0.63771	0.00049128	0.20057	0.00015452	0.83828	0.0006458	770.386173015615	13.904	0.40406	13.904	13.624	14.028	0					18	7	3	0	0	0	4.1248E-08	2	4578	4512;4578		155.88	124.82	1	13351000			88	486	56	57	125;126	126		9606
AGAGSATLSMAYAGAR	16	Oxidation (M)	_AGAGSATLSM(Oxidation (M))AYAGAR_	AGAGSATLSM(1)AYAGAR	AGAGSATLSM(78)AYAGAR	0	1	0	P40926	P40926	P40926	MDH2	Malate dehydrogenase, mitochondrial	MULTI-SECPEP	DP1141_7	2	735.3287353515625	2	735.853915	1469.69328	0.61325	0.00045126	0.40661	0.0002992	1.0199	0.00075046	735.8546868907353	16.565	0.22961	16.565	16.415	16.644	0					4	2	2	0	0	0	0.022845	1	8583	8583		77.593	51.079	1	7755000			89	223	57	58	127	127	182	9606
AGGGGGKR	8	Unmodified	_AGGGGGKR_			0	0	1	P20648	P20648	P20648	ATP4A	Potassium-transporting ATPase alpha chain 1	MULTI-SECPEP	DP1141_7	2	658.98291015625	1	659.358348	658.351071	0.037576	2.4776E-05	0.4126	0.00027205	0.45017	0.00029683	659.3588724076898	31.129	0.20565	31.129	30.97	31.176	0					9	5	2	0	0	0	0.035861	1	29006	29006		18.805	0.95727	1	634160			90	172	58	59	128	128		9606
AGLELLSDQGYR	12	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AGLELLSDQGYR_			1	0	0	Q9NPD3	Q9NPD3	Q9NPD3	EXOSC4	Exosome complex component RRP41	MULTI-MSMS	DP1141_10	5	682.8443603515625	2	682.346249	1362.67794	0.70369	0.00048016	-0.53689	-0.00036635	0.1668	0.00011382	682.3458341928811	22.644	0.58901	22.644	22.259	22.848	0					14	6	3	0	0	0	1.0434999999999999E-66	2	18484	18484;18506		200.6	149.54	1	89778000			91	570	59	60	129;130	129		9606
AGLQFPVGR	9	Unmodified	_AGLQFPVGR_			0	0	0	Q99878;Q96KK5;Q9BTM1;Q16777;Q93077;Q7L7L0;Q6FI13;P20671;P0C0S8;P04908;Q96QV6;P16104;Q8IUE6;Q71UI9;P0C0S5	Q99878;Q71UI9	Q99878	HIST1H2AJ;HIST1H2AH;H2AFJ;HIST2H2AC;HIST1H2AC;HIST3H2A;HIST2H2AA3;HIST1H2AD;HIST1H2AG;HIST1H2AB;HIST1H2AA;H2AFX;HIST2H2AB;H2AFV;H2AFZ	Histone H2A type 1-J;Histone H2A type 1-H;Histone H2A.J;Histone H2A type 2-C;Histone H2A type 1-C;Histone H2A type 3;Histone H2A type 2-A;Histone H2A type 1-D;Histone H2A type 1;Histone H2A type 1-B/E;Histone H2A type 1-A;Histone H2AX;Histone H2A type 2-B;Histone H2A.V;Histone H2A.Z	MULTI-MSMS	DP1141_10	5	472.9247131347656	2	472.769252	943.52395	0.13273	6.2751E-05	0.18091	8.5528E-05	0.31364	0.00014828	472.7693305593058	18.437	0.5896	18.437	18.287	18.877	0					14	5	4	0	0	0	3.1037E-05	5	12170	11967;12055;12170;12184;12189		147.69	73.719	1	542920000			92	105;133	60	61	131;132;133;134;135	133		9606
AGLQFPVGR	9	Unmodified	_AGLQFPVGR_			0	0	0	Q99878;Q96KK5;Q9BTM1;Q16777;Q93077;Q7L7L0;Q6FI13;P20671;P0C0S8;P04908;Q96QV6;P16104;Q8IUE6;Q71UI9;P0C0S5	Q99878;Q71UI9	Q99878	HIST1H2AJ;HIST1H2AH;H2AFJ;HIST2H2AC;HIST1H2AC;HIST3H2A;HIST2H2AA3;HIST1H2AD;HIST1H2AG;HIST1H2AB;HIST1H2AA;H2AFX;HIST2H2AB;H2AFV;H2AFZ	Histone H2A type 1-J;Histone H2A type 1-H;Histone H2A.J;Histone H2A type 2-C;Histone H2A type 1-C;Histone H2A type 3;Histone H2A type 2-A;Histone H2A type 1-D;Histone H2A type 1;Histone H2A type 1-B/E;Histone H2A type 1-A;Histone H2AX;Histone H2A type 2-B;Histone H2A.V;Histone H2A.Z	MULTI-MSMS	DP1141_6	1	472.76934814453125	2	472.769252	943.52395	0.67354	0.00031843	-0.42778	-0.00020224	0.24577	0.00011619	472.7689431365415	18.53	0.39972	18.53	18.305	18.705	0					8	3	3	0	0	0	0.0060993	1	11169	11169		120.65	70.606	1	22573000			93	105;133	60	61	136	136		9606
AGLQFPVGR	9	Unmodified	_AGLQFPVGR_			0	0	0	Q99878;Q96KK5;Q9BTM1;Q16777;Q93077;Q7L7L0;Q6FI13;P20671;P0C0S8;P04908;Q96QV6;P16104;Q8IUE6;Q71UI9;P0C0S5	Q99878;Q71UI9	Q99878	HIST1H2AJ;HIST1H2AH;H2AFJ;HIST2H2AC;HIST1H2AC;HIST3H2A;HIST2H2AA3;HIST1H2AD;HIST1H2AG;HIST1H2AB;HIST1H2AA;H2AFX;HIST2H2AB;H2AFV;H2AFZ	Histone H2A type 1-J;Histone H2A type 1-H;Histone H2A.J;Histone H2A type 2-C;Histone H2A type 1-C;Histone H2A type 3;Histone H2A type 2-A;Histone H2A type 1-D;Histone H2A type 1;Histone H2A type 1-B/E;Histone H2A type 1-A;Histone H2AX;Histone H2A type 2-B;Histone H2A.V;Histone H2A.Z	MULTI-SECPEP	DP1141_9	4	472.9149169921875	2	472.769252	943.52395	0.25647	0.00012125	-0.06512	-3.0787E-05	0.19135	9.0463E-05	472.7693141433852	18.487	0.59998	18.487	18.337	18.937	0					6	5	2	0	0	0	0.026058	1	11493	11493		124.59	64.953	1	11906000			94	105;133	60	61	137	137		9606
AGNFYVPAEPK	11	Unmodified	_AGNFYVPAEPK_			0	0	0	P18124	P18124	P18124	RPL7	60S ribosomal protein L7	MULTI-SECPEP	DP1141_10	5	596.328857421875	2	596.803488	1191.59242	0.28291	0.00016884	0.37213	0.00022209	0.65503	0.00039093	596.8036641856373	17.637	0.3001	17.637	17.387	17.688	0					4	2	2	0	0	0	0.0064476	1	10715	10715		107.45	52.844	1	23099000			95	167	61	62	138	138		9606
AGNGQWASVIR	11	Unmodified	_AGNGQWASVIR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-SECPEP	DP1141_8	3	579.3096923828125	2	579.804354	1157.59415	0.25653	0.00014874	1.1815	0.00068507	1.4381	0.0008338	579.8049952604786	18.225	0.30041	18.225	17.975	18.275	0					4	2	2	0	0	0	0.0053286	1	11056	11056		97.565	63.769	1	7739300			96	402	62	63	139	139		9606
AGTHILCIK	9	Unmodified	_AGTHILCIK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-SECPEP	DP1141_6	1	506.2393493652344	2	506.784044	1011.55354	-0.039087	-1.9809E-05	0.38857	0.00019692	0.34949	0.00017711	506.7842778479307	15.855	0.29645	15.855	15.708	16.005	0					4	2	2	0	0	0	0.0051441	1	6781	6781		138.54	102.15	1	6098200			97	142	63	64	140	140		9606
AHEVGAQGGPPVAQVEQDLPISR	23	Unmodified	_AHEVGAQGGPPVAQVEQDLPISR_			0	0	0	Q14676	Q14676	Q14676	MDC1	Mediator of DNA damage checkpoint protein 1	MULTI-MSMS	DP1141_7	2	786.074951171875	3	785.7399	2354.19787	0.37454	0.00029429	0.52328	0.00041116	0.89782	0.00070545	786.0746097940307	18.9	0.50026	18.9	18.449	18.95	0					14	4	5	0	0	0	1.1839E-100	2	12282	12282;12367		205.53	190.49	1	72788000			98	388	64	65	141;142	141		9606
AHQVVEDGYEFFAK	14	Unmodified	_AHQVVEDGYEFFAK_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MSMS	DP1141_10	5	546.8055419921875	3	547.263217	1638.76782	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.924	1	18.924	18.424	19.424	0								0	0	0	1.7705000000000002E-24	1	12796	12796		134.61	94.884	1				99	286;212;287	65	66	143	143		9606
AHQVVEDGYEFFAK	14	Unmodified	_AHQVVEDGYEFFAK_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MSMS	DP1141_7	2	820.3866577148438	2	820.391187	1638.76782	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.898	1	18.898	18.398	19.398	0								0	0	0	6.3763E-87	1	12335	12335		194.06	147.21	1				100	286;212;287	65	66	144	144		9606
AHQVVEDGYEFFAK	14	Unmodified	_AHQVVEDGYEFFAK_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_9	4	821.7052612304688	2	820.391187	1638.76782	-0.44885	-0.00036823	0.89873	0.00073731	0.44988	0.00036907	820.391912989152	18.987	1.1013	18.987	18.337	19.438	0					27	10	5	0	0	0	0.0016769	1	11690	11690		124.39	108.01	1	204940000			101	286;212;287	65	66	145	145		9606
AHQVVEDGYEFFAKR	15	Unmodified	_AHQVVEDGYEFFAKR_			0	0	1	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_8	3	898.4104614257812	2	898.441743	1794.86893	0.55278	0.00049664	0.32508	0.00029207	0.87786	0.00078871	898.943551443518	18.425	0.29999	18.425	18.175	18.475	0					6	2	3	0	0	0	1.7789E-238	1	11451	11451		277.06	234.73	1	17080000			102	286;212;287	66	67	146	146		9606
AHQVVEDGYEFFAKR	15	Unmodified	_AHQVVEDGYEFFAKR_			0	0	1	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-SECPEP	DP1141_8	3	450.2999267578125	4	449.72451	1794.86893	0.23746	0.00010679	0.14808	6.6597E-05	0.38555	0.00017339	449.7246706783837	18.425	0.49998	18.425	18.175	18.675	0					10	4	4	0	0	0	0.0010279	1	11428	11428		101.39	76.857	1	31016000			103	286;212;287	66	67	147	147		9606
AHQVVEDGYEFFAKR	15	Unmodified	_AHQVVEDGYEFFAKR_			0	0	1	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-SECPEP	DP1141_8	3	598.8563232421875	3	599.296921	1794.86893	0.48919	0.00029317	-0.26199	-0.00015701	0.2272	0.00013616	599.6314365738205	17.824	0.501	17.824	17.574	18.075	0					8	4	3	0	0	0	0.0056008	1	10564	10564		90.476	66.25	1	15382000			104	286;212;287	66	67	148	148		9606
AHSSMVGVNLPQK	13	Oxidation (M)	_AHSSM(Oxidation (M))VGVNLPQK_	AHSSM(1)VGVNLPQK	AHSSM(55)VGVNLPQK	0	1	0	P00558	P00558	P00558	PGK1	Phosphoglycerate kinase 1	MULTI-SECPEP	DP1141_7	2	461.92620849609375	3	461.906488	1382.69763	0.18088	8.355E-05	-1.3644	-0.00063021	-1.1835	-0.00054666	462.23999255568407	14.874	0.70127	14.874	14.508	15.21	0					8	6	2	0	0	0	0.033078	1	5937	5937		54.65	17.966	1	16811000			105	97	67	68	149	149	80	9606
AIADTGANVVVTGGK	15	Unmodified	_AIADTGANVVVTGGK_			0	0	0	P50990	P50990	P50990	CCT8	T-complex protein 1 subunit theta	MULTI-MSMS	DP1141_8	3	686.8713989257812	2	686.875173	1371.73579	0.34782	0.00023891	-1.0364	-0.0007119	-0.68862	-0.00047299	686.8746331737435	16.612	0.45487	16.612	16.276	16.731	0					11	4	3	0	0	0	0.0070494	2	8499	8499;8509		109.39	70.635	1	95899000			106	257	68	69	150;151	150		9606
AIADTGANVVVTGGK	15	Unmodified	_AIADTGANVVVTGGK_			0	0	0	P50990	P50990	P50990	CCT8	T-complex protein 1 subunit theta	MULTI-MSMS	DP1141_9	4	686.8751220703125	2	686.875173	1371.73579	0.056424	3.8756E-05	0.37825	0.00025981	0.43467	0.00029857	686.8753108895194	16.643	0.23434	16.643	16.458	16.693	0					6	2	3	0	0	0	0.022872	1	8583	8583		69.451	28.569	1	27189000			107	257	68	69	152	152		9606
AIEAAPQEPEQK	12	Unmodified	_AIEAAPQEPEQK_			0	0	0	Q96CP2	Q96CP2	Q96CP2	FLYWCH2	FLYWCH family member 2	MULTI-SECPEP	DP1141_10	5	655.8672485351562	2	655.832974	1309.6514	-0.55633	-0.00036486	0.99855	0.00065488	0.44222	0.00029002	655.8339590328832	14.634	0.34494	14.634	14.539	14.884	0					10	4	4	0	0	0	0.0062471	1	5794	5794		99.788	75.799	1	10575000			108	504	69	70	153	153		9606
AIEALHGHELRPGR	14	Unmodified	_AIEALHGHELRPGR_			0	0	1	Q96PK6	Q96PK6	Q96PK6	RBM14	RNA-binding protein 14	MULTI-SECPEP	DP1141_8	3	519.7713012695312	3	519.286579	1554.83791	0.41728	0.00021669	-0.17102	-8.8807E-05	0.24626	0.00012788	519.2864682287778	14.923	0.29814	14.923	14.674	14.972	0					4	2	2	0	0	0	0.011211	1	5783	5783		113.24	79.239	1	10716000			109	519	70	71	154	154		9606
AIEPPPLDAVIEAEHTLR	18	Unmodified	_AIEPPPLDAVIEAEHTLR_			0	0	0	Q08211	Q08211	Q08211	DHX9	ATP-dependent RNA helicase A	MULTI-MSMS	DP1141_6	1	657.6902465820312	3	657.689707	1970.04729	0.81379	0.00053522	0.046776	3.0764E-05	0.86056	0.00056598	657.6897057155746	21.335	0.42058	21.335	21.126	21.546	0					9	4	3	0	0	0	0.024751	1	15641	15641		60.093	41.333	1	6171700			110	357	71	72	155	155		9606
AIEVLSDEHAR	11	Unmodified	_AIEVLSDEHAR_			0	0	0	Q9HCS7	Q9HCS7	Q9HCS7	XAB2	Pre-mRNA-splicing factor SYF1	MULTI-MSMS	DP1141_7	2	413.7428283691406	3	413.882448	1238.62551	0.17479	7.2344E-05	-0.0051683	-2.1391E-06	0.16963	7.0205E-05	413.8824421928534	15.765	0.303	15.765	15.512	15.815	0					4	2	2	0	0	0	0.0025717	1	7236	7236		100.88	69.12	1	15686000			111	569	72	73	156	156		9606
AIGIGAYLVR	10	Unmodified	_AIGIGAYLVR_			0	0	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	516.8139038085938	2	516.813659	1031.61277	0.39726	0.00020531	-0.21575	-0.0001115	0.1815	9.3804E-05	516.8136848633085	20.14	0.7735	20.14	19.998	20.772	0					16	7	4	0	0	0	0.025708	1	13785	13785		77.674	23.125	1	418430000			112	367;40	73	74	157	157		9606
AIGIGAYLVR	10	Unmodified	_AIGIGAYLVR_			0	0	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	516.813720703125	2	516.813659	1031.61277	0.25618	0.0001324	0.035016	1.8097E-05	0.2912	0.0001505	516.8136056894967	20.1	0.30053	20.1	19.95	20.251	0					6	2	3	0	0	0	0.024372	1	14339	14339		79.469	9.4701	1	28572000			113	367;40	73	74	158	158		9606
AIGPHDVLATLLNNLK	16	Unmodified	_AIGPHDVLATLLNNLK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_10	5	563.6614379882812	3	563.661311	1687.9621	1.13	0.00063694	-1.0502	-0.00059197	0.079796	4.4978E-05	563.6607159600802	23.439	0.2489	23.439	23.23	23.479	0					5	3	2	0	0	0	0.025156	1	19603	19603		59.864	35.306	1	8682000			114	78	74	75	159	159		9606
AIGPHDVLATLLNNLK	16	Unmodified	_AIGPHDVLATLLNNLK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_10	5	845.4896850585938	2	844.988329	1687.9621	0.46067	0.00038926	-0.55818	-0.00047166	-0.097514	-8.2398E-05	845.489288715413	23.418	0.2489	23.418	23.23	23.479	0					5	3	2	0	0	0	9.773200000000001E-70	1	19611	19611		201	146.51	1	2503300			115	78	74	75	160	160		9606
AIGPHDVLATLLNNLK	16	Unmodified	_AIGPHDVLATLLNNLK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	845.489990234375	2	844.988329	1687.9621	0.46041	0.00038904	-0.024119	-2.0381E-05	0.43629	0.00036866	844.988291409904	23.42	0.49395	23.42	23.065	23.559	0					17	6	3	0	0	0	8.505100000000001E-162	3	18874	18817;18874;18986		239.48	210.9	1	140630000			116	78	74	75	161;162;163	162		9606
AIGPHDVLATLLNNLK	16	Unmodified	_AIGPHDVLATLLNNLK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	563.6615600585938	3	563.661311	1687.9621	0.28003	0.00015784	-0.14959	-8.432E-05	0.13043	7.3521E-05	563.6613885370689	23.429	0.65199	23.429	22.99	23.642	0					30	8	6	0	0	0	3.6611E-42	3	18857	18857;18956;19227		185.66	160.33	1	301570000			117	78	74	75	164;165;166	164		9606
AIGPHDVLATLLNNLK	16	Unmodified	_AIGPHDVLATLLNNLK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	846.0877075195312	2	844.988329	1687.9621	0.75209	0.0006355	-0.19864	-0.00016785	0.55345	0.00046766	845.4895336780112	23.466	0.39404	23.466	23.157	23.551	0					9	4	3	0	0	0	1.5711E-14	2	18960	18960;19064		167.84	141.83	1	11254000			118	78	74	75	167;168	167		9606
AIGPHDVLATLLNNLK	16	Unmodified	_AIGPHDVLATLLNNLK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	563.9962158203125	3	563.661311	1687.9621	-0.092179	-5.1958E-05	0.27385	0.00015436	0.18167	0.0001024	563.661459314216	23.466	0.39404	23.466	23.157	23.551	0					14	4	4	0	0	0	4.9722E-84	3	18962	18962;19017;19054		204.35	172.69	1	26723000			119	78	74	75	169;170;171	169		9606
AIGPHDVLATLLNNLK	16	Unmodified	_AIGPHDVLATLLNNLK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_9	4	563.9953002929688	3	563.661311	1687.9621	0.58833	0.00033162	-0.28026	-0.00015797	0.30807	0.00017365	563.9955793590027	23.437	0.33152	23.437	23.186	23.518	0					8	4	2	0	0	0	0.019388	1	19044	19044		62.377	27.933	1	4619200			120	78	74	75	172	172		9606
AIGPHDVLATLLNNLK	16	Unmodified	_AIGPHDVLATLLNNLK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MSMS	DP1141_9	4	844.9280395507812	2	844.988329	1687.9621	NaN	NaN	NaN	NaN	NaN	NaN	NaN	23.453	1	23.453	22.953	23.953	0								0	0	0	9.8186E-76	1	19051	19051		213.38	165.53	1				121	78	74	75	173	173		9606
AIGYLIPLMDAEYANYYTR	19	Unmodified	_AIGYLIPLMDAEYANYYTR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	1119.552734375	2	1119.051	2236.08744	0.39596	0.0004431	-0.56394	-0.00063107	-0.16798	-0.00018798	1119.552317322855	23.914	0.27697	23.914	23.733	24.01	0					9	3	4	0	0	0	6.527E-07	1	19955	19955		166.7	123.41	1	8890000			122	78	75	76	174	174		9606
AIIIFVPVPQLK	12	Unmodified	_AIIIFVPVPQLK_			0	0	0	P62081	P62081	P62081	RPS7	40S ribosomal protein S7	MULTI-MSMS	DP1141_10	5	669.9337768554688	2	669.431399	1336.84824	0.33728	0.00022579	0.24429	0.00016354	0.58157	0.00038932	669.4314838229087	22.644	0.41532	22.644	22.349	22.764	0					9	4	3	0	0	0	0.0025761	2	18402	18353;18402		123.98	123.98	1	63288000			123	285	76	77	175;176	176		9606
AIIRHSDLVTK	11	Unmodified	_AIIRHSDLVTK_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	418.875244140625	3	418.250583	1251.72992	-0.14232	-5.9526E-05	0.21232	8.8801E-05	0.069995	2.9275E-05	418.250689375868	14.559	0.29943	14.559	14.409	14.708	0					4	2	2	0	0	0	0.010474	1	4813	4813		99.343	73.869	1	22501000			124	367	77	78	177	177		9606
AILVDLEPGTMDSVR	15	Oxidation (M)	_AILVDLEPGTM(Oxidation (M))DSVR_	AILVDLEPGTM(1)DSVR	AILVDLEPGTM(200)DSVR	0	1	0	P07437;Q13885;Q9BVA1;Q13509	P07437;Q13885;Q13509	P07437	TUBB;TUBB2A;TUBB2B;TUBB3	Tubulin beta chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain	MULTI-MSMS	DP1141_10	5	816.414794921875	2	816.419088	1630.82362	0.98864	0.00080714	-0.9965	-0.00081356	-0.007867	-6.4228E-06	816.4183201445775	19.626	0.39977	19.626	19.376	19.776	0					9	3	3	0	0	0	1.5273E-68	1	13937	13937		203.03	138.61	1	69209000			125	122;381;376	78	79	178	178	106	9606
AILVDLEPGTMDSVR	15	Oxidation (M)	_AILVDLEPGTM(Oxidation (M))DSVR_	AILVDLEPGTM(1)DSVR	AILVDLEPGTM(120)DSVR	0	1	0	P07437;Q13885;Q9BVA1;Q13509	P07437;Q13885;Q13509	P07437	TUBB;TUBB2A;TUBB2B;TUBB3	Tubulin beta chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain	MULTI-MSMS	DP1141_7	2	817.3947143554688	2	816.419088	1630.82362	0.506	0.00041311	0.3385	0.00027636	0.8445	0.00068947	816.4195590636976	19.67	0.29948	19.67	19.451	19.75	0					8	2	4	0	0	0	0.024038	1	13548	13548		116.84	74.119	1	23775000			126	122;381;376	78	79	179	179	106	9606
AILVDLEPGTMDSVR	15	Oxidation (M)	_AILVDLEPGTM(Oxidation (M))DSVR_	AILVDLEPGTM(1)DSVR	AILVDLEPGTM(99)DSVR	0	1	0	P07437;Q13885;Q9BVA1;Q13509	P07437;Q13885;Q13509	P07437	TUBB;TUBB2A;TUBB2B;TUBB3	Tubulin beta chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain	MULTI-MSMS	DP1141_8	3	816.4200439453125	2	816.419088	1630.82362	0.96982	0.00079178	-0.16336	-0.00013337	0.80646	0.00065841	816.4191099940978	19.626	0.70112	19.626	19.375	20.076	0					13	6	4	0	0	0	0.011068	1	13430	13430		99.215	63.801	1	227100000			127	122;381;376	78	79	180	180	106	9606
AILVDLEPGTMDSVR	15	Oxidation (M)	_AILVDLEPGTM(Oxidation (M))DSVR_	AILVDLEPGTM(1)DSVR	AILVDLEPGTM(230)DSVR	0	1	0	P07437;Q13885;Q9BVA1;Q13509	P07437;Q13885;Q13509	P07437	TUBB;TUBB2A;TUBB2B;TUBB3	Tubulin beta chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain	MULTI-MSMS	DP1141_9	4	816.4098510742188	2	816.419088	1630.82362	-0.33758	-0.00027561	0.71534	0.00058401	0.37776	0.00030841	816.4199119025224	19.689	0.59877	19.689	19.438	20.037	0					18	5	6	0	0	0	7.1229E-140	2	13359	13359;13410		232.56	162.3	1	187870000			128	122;381;376	78	79	181;182	181	106	9606
AILVDLEPGTMDSVR	15	Unmodified	_AILVDLEPGTMDSVR_			0	0	0	P07437;Q13885;Q9BVA1;Q13509	P07437;Q13885;Q13509	P07437	TUBB;TUBB2A;TUBB2B;TUBB3	Tubulin beta chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain	MULTI-MSMS	DP1141_8	3	808.4228515625	2	808.42163	1614.82871	0.74416	0.00060159	0.15818	0.00012787	0.90233	0.00072947	808.4217172149948	20.628	0.50158	20.628	20.176	20.678	0					6	4	2	0	0	0	3.6722E-100	1	14842	14842		215.08	137.35	1	224040000			129	122;381;376	78	80	183	183		9606
AILVDLEPGTMDSVR	15	Unmodified	_AILVDLEPGTMDSVR_			0	0	0	P07437;Q13885;Q9BVA1;Q13509	P07437;Q13885;Q13509	P07437	TUBB;TUBB2A;TUBB2B;TUBB3	Tubulin beta chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain	MULTI-MSMS	DP1141_9	4	808.421875	2	808.42163	1614.82871	-0.10597	-8.5669E-05	0.52317	0.00042294	0.4172	0.00033727	808.4219530904169	20.586	0.39984	20.586	20.337	20.737	0					7	3	3	0	0	0	4.9353E-15	1	14909	14909		168.22	124.71	1	24155000			130	122;381;376	78	80	184	184		9606
AIQGGTSHHLGQNFSK	16	Unmodified	_AIQGGTSHHLGQNFSK_			0	0	0	P07814	P07814	P07814	EPRS	Bifunctional glutamate/proline--tRNA ligase;Glutamate--tRNA ligase;Proline--tRNA ligase	MULTI-SECPEP	DP1141_7	2	561.9133911132812	3	561.285015	1680.83322	0.29368	0.00016484	0.38546	0.00021635	0.67913	0.00038119	561.2852614264525	14.358	0.29793	14.358	14.21	14.508	0					4	2	2	0	0	0	0.0011022	1	5075	5075		101.75	101.75	1	33487000			131	123	79	81	185	185		9606
AITFLQSATR	10	Unmodified	_AITFLQSATR_			0	0	0	P35249	P35249	P35249	RFC4	Replication factor C subunit 4	MULTI-SECPEP	DP1141_9	4	554.2755126953125	2	554.31148	1106.60841	0.49543	0.00027462	2.9298	0.001624	3.4253	0.0018987	554.313476493149	18.687	0.39987	18.687	18.437	18.837	0					5	3	2	0	0	0	0.0055692	1	11847	11847		112.11	30.811	1	10024000			132	207	80	82	186	186		9606
AIVNVIGMHK	10	Oxidation (M)	_AIVNVIGM(Oxidation (M))HK_	AIVNVIGM(1)HK	AIVNVIGM(99)HK	0	1	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-SECPEP	DP1141_7	2	549.9528198242188	2	549.310426	1096.6063	0.27728	0.00015231	0.35078	0.00019269	0.62806	0.000345	549.3105830417749	15.964	0.80301	15.964	15.512	16.315	0					12	7	3	0	0	0	0.0119	1	7497	7497		98.629	98.629	1	125800000			133	78	81	83	187	187	63	9606
ALAAAGYDVEKNNSR	15	Unmodified	_ALAAAGYDVEKNNSR_			0	0	1	P16403;P10412;P16402;P22492;Q02539	P16403	P16403	HIST1H1C;HIST1H1E;HIST1H1D;HIST1H1T;HIST1H1A	Histone H1.2;Histone H1.4;Histone H1.3;Histone H1t;Histone H1.1	MULTI-MSMS	DP1141_9	4	527.2556762695312	3	526.933871	1577.77978	0.50258	0.00026483	-2.7851	-0.0014676	-2.2825	-0.0012027	527.2655348087541	15.324	0.49853	15.324	15.174	15.673	0					6	4	2	0	0	0	0.018997	1	6368	6368		115.37	71.575	1	23924000			134	157	82	84	188	188		9606
ALAVSDLNR	9	Unmodified	_ALAVSDLNR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-SECPEP	DP1141_10	5	479.29962158203125	2	479.769448	957.524344	0.35132	0.00016855	-0.0028865	-1.3848E-06	0.34844	0.00016717	479.769413748199	16.606	0.3365	16.606	16.46	16.797	0					9	4	3	0	0	0	0.0074117	1	9010	9010		133.12	63.118	1	62017000			135	142	83	85	189	189		9606
ALAVSDLNR	9	Unmodified	_ALAVSDLNR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	479.76959228515625	2	479.769448	957.524344	-0.053971	-2.5893E-05	0.35737	0.00017145	0.3034	0.00014556	479.76963096004624	16.635	0.3863	16.635	16.505	16.891	0					10	4	4	0	0	0	7.081E-14	2	8110	8110;8118		166.78	65.061	1	218990000			136	142	83	85	190;191	190		9606
ALAVSDLNR	9	Unmodified	_ALAVSDLNR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	479.76959228515625	2	479.769448	957.524344	0.74348	0.0003567	-0.5792	-0.00027788	0.16428	7.8817E-05	479.7692113967831	16.594	0.47753	16.594	16.415	16.892	0					13	5	4	0	0	0	3.4677000000000004E-29	2	8622	8622;8781		178.6	64.898	1	861690000			137	142	83	85	192;193	192		9606
ALAVSDLNR	9	Unmodified	_ALAVSDLNR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	479.76953125	2	479.769448	957.524344	0.17691	8.4877E-05	0.040462	1.9412E-05	0.21737	0.00010429	479.76945758035845	16.612	0.35826	16.612	16.469	16.828	0					7	3	3	0	0	0	0.0093086	1	8663	8663		99.375	33.024	1	359100000			138	142	83	85	194	194		9606
ALAVSDLNR	9	Unmodified	_ALAVSDLNR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-SECPEP	DP1141_9	4	479.2562561035156	2	479.769448	957.524344	0.34378	0.00016493	-0.10559	-5.0659E-05	0.23819	0.00011427	479.7694137224545	16.643	0.32355	16.643	16.458	16.782	0					9	3	4	0	0	0	7.3129E-18	1	8466	8466		192.31	92.293	1	282710000			139	142	83	85	195	195		9606
ALAVVYGPHEIR	12	Unmodified	_ALAVVYGPHEIR_			0	0	0	Q9NPD3	Q9NPD3	Q9NPD3	EXOSC4	Exosome complex component RRP41	MULTI-SECPEP	DP1141_10	5	442.7637634277344	3	442.250583	1323.72992	-0.54315	-0.00024021	1.154	0.00051034	0.61082	0.00027013	442.2510369678095	17.137	0.35402	17.137	16.933	17.287	0					5	3	2	0	0	0	0.0043607	1	9969	9969		111.27	85.374	1	23771000			140	570	84	86	196	196		9606
ALDEYYDK	8	Unmodified	_ALDEYYDK_			0	0	0	P38606	P38606	P38606	ATP6V1A	V-type proton ATPase catalytic subunit A	MULTI-MSMS	DP1141_10	5	509.2290344238281	2	508.732197	1015.44984	0.33441	0.00017013	0.34205	0.00017401	0.67647	0.00034414	508.73231574356794	16.576	0.26657	16.576	16.46	16.727	0					5	3	2	0	0	0	0.017017	1	8956	8956		89.752	74.12	1	5802100			141	216	85	87	197	197		9606
ALEEANADLEVK	12	Unmodified	_ALEEANADLEVK_			0	0	0	CON__P02533;P02533;CON__Q6IFX2;CON__P19012;P19012;CON__P08779;P08779	CON__P02533;CON__P08779	CON__P08779	KRT14;KRT15;KRT16	Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 15;Keratin, type I cytoskeletal 16	MSMS	DP1141_9	4	651.33251953125	2	651.332807	1300.65106	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.979	1	16.979	16.479	17.479	0								0	0	0	3.3578E-05	1	9081	9081		137.46	83.966	1			+	142	16;9	86	88	198	198		9606
ALEESNYELEGK	12	Unmodified	_ALEESNYELEGK_			0	0	0	CON__P13645;P13645;CON__P02535-1	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MSMS	DP1141_10	5	691.3277587890625	2	691.327721	1380.64089	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.903	1	16.903	16.403	17.403	0								0	0	0	3.3366E-70	1	9502	9502		188.04	100.56	1			+	143	17	87	89	199	199		9606
ALEESNYELEGK	12	Unmodified	_ALEESNYELEGK_			0	0	0	CON__P13645;P13645;CON__P02535-1	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_6	1	691.3274536132812	2	691.327721	1380.64089	0.61567	0.00042563	-0.10589	-7.3205E-05	0.50978	0.00035243	691.3276980942285	16.914	0.37374	16.914	16.729	17.103	0					7	4	2	0	0	0	5.9345E-31	1	8506	8506		182.64	147.37	1	439390000		+	144	17	87	89	200	200		9606
ALEESNYELEGK	12	Unmodified	_ALEESNYELEGK_			0	0	0	CON__P13645;P13645;CON__P02535-1	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_7	2	691.3280029296875	2	691.327721	1380.64089	1.0191	0.00070452	-0.4092	-0.00028289	0.60989	0.00042163	691.3273559095243	16.903	0.51118	16.903	16.738	17.249	0					15	5	6	0	0	0	4.1342E-81	3	9129	9118;9129;9136		210.27	176.35	1	656910000		+	145	17	87	89	201;202;203	202		9606
ALEESNYELEGK	12	Unmodified	_ALEESNYELEGK_			0	0	0	CON__P13645;P13645;CON__P02535-1	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_8	3	691.3280029296875	2	691.327721	1380.64089	0.51089	0.00035319	0.035119	2.4278E-05	0.54601	0.00037747	691.3277090658287	16.878	0.24172	16.878	16.731	16.973	0					4	2	2	0	0	0	4.441E-05	1	9061	9061		147.4	147.4	1	277850000		+	146	17	87	89	204	204		9606
ALEESNYELEGK	12	Unmodified	_ALEESNYELEGK_			0	0	0	CON__P13645;P13645;CON__P02535-1	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_9	4	691.3282470703125	2	691.327721	1380.64089	0.29898	0.00020669	0.75215	0.00051998	1.0511	0.00072667	691.3278864756658	16.907	0.54523	16.907	16.693	17.238	0					19	6	7	0	0	0	9.5027E-22	3	8959	8948;8959;8963		174.41	90.467	1	485420000		+	147	17	87	89	205;206;207	206		9606
ALELSGTAVPPDLEK	15	Unmodified	_ALELSGTAVPPDLEK_			0	0	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-MSMS	DP1141_6	1	770.4176635742188	2	770.416871	1538.81919	-0.025237	-1.9443E-05	1.0424	0.00080311	1.0172	0.00078366	770.4175592891991	19.055	0.30019	19.055	18.905	19.205	0					6	2	3	0	0	0	0.020125	1	12138	12138		75.819	37.825	1	6939900			148	445	88	90	208	208		9606
ALEPTGQSGEAVK	13	Unmodified	_ALEPTGQSGEAVK_			0	0	0	Q8WX92	Q8WX92	Q8WX92	NELFB	Negative elongation factor B	MSMS	DP1141_9	4	643.884033203125	2	643.832974	1285.6514	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.706	1	14.706	14.206	15.206	0								0	0	0	4.1223E-05	1	5365	5365		138.25	65.762	1				149	488	89	91	209	209		9606
ALFPEPR	7	Unmodified	_ALFPEPR_			0	0	0	Q96JM3	Q96JM3	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	MULTI-MSMS	DP1141_7	2	415.2319641113281	2	415.231971	828.449388	0.35509	0.00014744	-0.065747	-2.73E-05	0.28934	0.00012014	415.23187543448995	17.799	0.59968	17.799	17.349	17.949	0					12	5	3	0	0	0	0.021023	2	10597	10556;10597		101.21	58.438	1	33468000			150	514	90	92	210;211	211		9606
ALFPGDSEIDQLFR	14	Unmodified	_ALFPGDSEIDQLFR_			0	0	0	P24941;Q00526	P24941	P24941	CDK2;CDK3	Cyclin-dependent kinase 2;Cyclin-dependent kinase 3	MULTI-MSMS	DP1141_9	4	804.90869140625	2	804.406837	1606.79912	0.23617	0.00018998	0.071748	5.7715E-05	0.30792	0.00024769	804.9083139484959	23.085	0.47982	23.085	22.779	23.259	0					8	6	3	0	0	0	0.0069285	1	18532	18532		91.469	63.456	1	3395100			151	186	91	93	212	212		9606
ALGEPITLFGEGPAER	16	Unmodified	_ALGEPITLFGEGPAER_			0	0	0	O43172	O43172	O43172	PRPF4	U4/U6 small nuclear ribonucleoprotein Prp4	MULTI-MSMS	DP1141_8	3	829.9359741210938	2	828.933219	1655.85189	0.80252	0.00066524	-0.24836	-0.00020587	0.55416	0.00045936	828.9330183925234	20.987	0.40011	20.987	20.778	21.178	0					10	3	4	0	0	0	0.0016687	1	15381	15381		152.67	137.57	1	22267000			152	56	92	94	213	213		9606
ALMDMMGGVLEVK	13	3 Oxidation (M)	_ALM(Oxidation (M))DM(Oxidation (M))M(Oxidation (M))GGVLEVK_	ALM(1)DM(1)M(1)GGVLEVK	ALM(50)DM(50)M(50)GGVLEVK	0	3	0	Q8NDM7	Q8NDM7	Q8NDM7	CFAP43	Cilia- and flagella-associated protein 43	MSMS	DP1141_10	5	721.32763671875	2	721.340406	1440.66626	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.824	1	19.824	19.324	20.324	0								0	0	0	0.033877	1	14179	14179		50.353	12.077	1				153	473	93	95	214	214	349;350;351	9606
ALPNNTSSSPQPK	13	Unmodified	_ALPNNTSSSPQPK_			0	0	0	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MULTI-MSMS	DP1141_10	5	670.8441162109375	2	670.843873	1339.67319	0.16712	0.00011211	0.53296	0.00035754	0.70009	0.00046965	670.8443281091919	13.904	0.25618	13.904	13.772	14.028	0					11	4	3	0	0	0	0.0048791	2	4660	4660;4700		112.36	68.008	1	5876700			154	104	94	96	215;216	215		9606
ALPNNTSSSPQPK	13	Unmodified	_ALPNNTSSSPQPK_			0	0	0	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MULTI-MSMS	DP1141_6	1	670.84423828125	2	670.843873	1339.67319	0.8873	0.00059524	-0.44763	-0.00030029	0.43967	0.00029495	670.8436269602978	13.847	0.31884	13.847	13.736	14.054	0					7	3	3	0	0	0	0.0045307	1	3972	3972		115.7	84.902	1	1024200			155	104	94	96	217	217		9606
ALPNNTSSSPQPK	13	Unmodified	_ALPNNTSSSPQPK_			0	0	0	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MSMS	DP1141_8	3	670.8440551757812	2	670.843873	1339.67319	NaN	NaN	NaN	NaN	NaN	NaN	NaN	13.924	1	13.924	13.424	14.424	0								0	0	0	0.022952	1	4320	4320		121.36	75.68	1				156	104	94	96	218	218		9606
ALPNNTSSSPQPK	13	Unmodified	_ALPNNTSSSPQPK_			0	0	0	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MULTI-MSMS	DP1141_9	4	670.8441772460938	2	670.843873	1339.67319	0.62046	0.00041623	-0.13314	-8.9313E-05	0.48733	0.00032692	670.8437483921144	13.912	0.57499	13.912	13.672	14.247	0					19	8	4	0	0	0	0.0016031	2	4175	4113;4175		123.86	85.11	1	12267000			157	104	94	96	219;220	220		9606
ALQDEWDAVMLHSFTLR	17	Oxidation (M)	_ALQDEWDAVM(Oxidation (M))LHSFTLR_	ALQDEWDAVM(1)LHSFTLR	ALQDEWDAVM(48)LHSFTLR	0	1	0	Q9UMS4	Q9UMS4	Q9UMS4	PRPF19	Pre-mRNA-processing factor 19	MULTI-MSMS	DP1141_8	3	683.3353881835938	3	683.335047	2046.98331	0.66877	0.00045699	-0.1203	-8.2204E-05	0.54847	0.00037479	683.3348795999908	21.445	0.30042	21.445	21.279	21.579	0					6	2	3	0	0	0	0.032707	1	16117	16117		47.64	36.265	1	13058000			158	603	95	97	221	221	419	9606
ALTSFLPAPTQLSQDQLEAEEK	22	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ALTSFLPAPTQLSQDQLEAEEK_			1	0	0	Q13573	Q13573	Q13573	SNW1	SNW domain-containing protein 1	MULTI-MSMS	DP1141_10	5	820.4183349609375	3	820.08311	2457.2275	0.55692	0.00045672	0.22662	0.00018584	0.78353	0.00064256	820.4174908636231	24.085	0.2788	24.085	23.851	24.129	0					9	3	4	0	0	0	2.8349E-56	2	20534	20508;20534		162.92	129.36	1	9003900			159	377	96	98	222;223	223		9606
ALTSFLPAPTQLSQDQLEAEEK	22	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ALTSFLPAPTQLSQDQLEAEEK_			1	0	0	Q13573	Q13573	Q13573	SNW1	SNW domain-containing protein 1	MULTI-MSMS	DP1141_8	3	1229.62158203125	2	1229.62103	2457.2275	1.5798	0.0019426	-0.83634	-0.0010284	0.74351	0.00091423	1230.1210160153587	24.05	0.24117	24.05	23.857	24.098	0					8	2	4	0	0	0	3.94E-139	2	19878	19875;19878		221.85	184.5	1	12847000			160	377	96	98	224;225	225		9606
ALTVPELTQQMFDAK	15	Oxidation (M)	_ALTVPELTQQM(Oxidation (M))FDAK_	ALTVPELTQQM(1)FDAK	ALTVPELTQQM(110)FDAK	0	1	0	P68371;P04350;Q13509	P68371;Q13509	P68371	TUBB4B;TUBB4A;TUBB3	Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-3 chain	MULTI-MSMS	DP1141_6	1	854.4318237304688	2	854.434738	1706.85492	0.9069	0.00077489	-3.7974	-0.0032447	-2.8905	-0.0024698	854.431322277287	19.658	0.50046	19.658	19.406	19.906	0					8	4	2	0	0	0	0.033768	1	13184	13184		108.56	19.207	1	9594700			161	323;376	97	99	226	226	249	9606
ALTVPELTQQMFDAK	15	Unmodified	_ALTVPELTQQMFDAK_			0	0	0	P68371;P04350;Q13509	P68371;Q13509	P68371	TUBB4B;TUBB4A;TUBB3	Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-3 chain	MULTI-MSMS	DP1141_8	3	846.43896484375	2	846.43728	1690.86001	0.76334	0.00064612	-0.022135	-1.8736E-05	0.7412	0.00062738	846.4373181780707	21.929	0.90032	21.929	21.479	22.379	0					14	8	4	0	0	0	3.5276E-10	2	16608	16608;16710		163.45	103.19	1	27947000			162	323;376	97	100	227;228	227		9606
ALTVPELTQQMFDAK	15	Unmodified	_ALTVPELTQQMFDAK_			0	0	0	P68371;P04350;Q13509	P68371;Q13509	P68371	TUBB4B;TUBB4A;TUBB3	Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-3 chain	MULTI-MSMS	DP1141_9	4	846.9393310546875	2	846.43728	1690.86001	-0.062922	-5.3259E-05	1.7092	0.0014467	1.6463	0.0013935	846.4385026970818	21.882	0.4922	21.882	21.438	21.93	0					9	4	3	0	0	0	0.010545	1	16650	16650		101.89	68.889	1	5289700			163	323;376	97	100	229	229		9606
ALTVPELTQQMFDSK	15	Unmodified	_ALTVPELTQQMFDSK_			0	0	0	Q13885;Q9BVA1	Q13885	Q13885	TUBB2A;TUBB2B	Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_7	2	854.4285888671875	2	854.434738	1706.85492	0.43939	0.00037543	-0.73314	-0.00062642	-0.29375	-0.00025099	854.4331883927986	19.8	0.49965	19.8	19.35	19.85	0					6	4	2	0	0	0	0.005174	1	13688	13688		93.959	3.0337	1	25516000			164	381	98	101	230	230		9606
ALTVPELTQQVFDAK	15	Unmodified	_ALTVPELTQQVFDAK_			0	0	0	P07437	P07437	P07437	TUBB	Tubulin beta chain	MULTI-MSMS	DP1141_10	5	830.4510498046875	2	830.451245	1658.88794	0.63358	0.00052616	0.14343	0.00011911	0.77701	0.00064527	830.451151753059	21.609	0.98263	21.609	21.076	22.058	0					14	9	3	0	0	0	6.3968E-09	2	16877	16815;16877		158.56	110.67	1	57639000			165	122	99	102	231;232	232		9606
ALTVPELTQQVFDAK	15	Unmodified	_ALTVPELTQQVFDAK_			0	0	0	P07437	P07437	P07437	TUBB	Tubulin beta chain	MULTI-MSMS	DP1141_8	3	830.9531860351562	2	830.451245	1658.88794	0.83402	0.00069261	-0.23011	-0.00019109	0.60391	0.00050152	830.4510813083526	21.629	0.90163	21.629	20.878	21.779	0					16	8	2	0	0	0	2.6315E-21	1	16248	16248		170.4	147.84	1	536130000			166	122	99	102	233	233		9606
ALTVPELTQQVFDAK	15	Unmodified	_ALTVPELTQQVFDAK_			0	0	0	P07437	P07437	P07437	TUBB	Tubulin beta chain	MULTI-MSMS	DP1141_9	4	830.451171875	2	830.451245	1658.88794	-0.35838	-0.00029762	1.0937	0.00090825	0.7353	0.00061063	830.4520893574618	21.589	0.79837	21.589	20.937	21.736	0					17	7	3	0	0	0	1.6871E-32	3	16262	16004;16262;16287		182.92	122.75	1	56952000			167	122	99	102	234;235;236	235		9606
ALVLDCHYPEDEVGQEDEAESDIFSIR	27	Unmodified	_ALVLDCHYPEDEVGQEDEAESDIFSIR_			0	0	0	Q07021	Q07021	Q07021	C1QBP	Complement component 1 Q subcomponent-binding protein, mitochondrial	MULTI-MSMS	DP1141_10	5	1046.474853515625	3	1046.13991	3135.39789	0.54209	0.0005671	-0.076918	-8.0467E-05	0.46517	0.00048664	1046.4743757191884	21.409	0.88292	21.409	21.076	21.959	0					42	8	6	0	0	0	9.3796E-12	2	16694	16694;16706		126.29	115.77	1	89753000			168	350	100	103	237;238	237		9606
ALVNQLHER	9	Unmodified	_ALVNQLHER_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-SECPEP	DP1141_8	3	539.6210327148438	2	540.301447	1078.58834	0.79906	0.00043173	0.56061	0.0003029	1.3597	0.00073463	540.3017505678138	15.022	0.59804	15.022	14.772	15.37	0					15	5	4	0	0	0	8.6415E-92	1	5913	5913		235.15	174.39	1	262160000			169	567	101	104	239	239		9606
AMGEQAVALAR	11	Oxidation (M)	_AM(Oxidation (M))GEQAVALAR_	AM(1)GEQAVALAR	AM(150)GEQAVALAR	0	1	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_8	3	567.3253784179688	2	566.792598	1131.57064	-0.088885	-5.038E-05	0.66503	0.00037693	0.57614	0.00032655	566.7929653325251	15.524	0.60507	15.524	15.271	15.876	0					8	5	2	0	0	0	0.00020594	1	6690	6690		148.94	96.541	1	74302000			170	110	102	105	240	240	92	9606
AMGIMNSFVNDIFER	15	2 Oxidation (M)	_AM(Oxidation (M))GIM(Oxidation (M))NSFVNDIFER_	AM(1)GIM(1)NSFVNDIFER	AM(100)GIM(100)NSFVNDIFER	0	2	0	Q99880;Q99879;Q99877;Q93079;Q5QNW6;P62807;P58876;P57053;O60814;Q8N257;Q16778;P33778;P23527;P06899	Q99880	Q99880	HIST1H2BL;HIST1H2BM;HIST1H2BN;HIST1H2BH;HIST2H2BF;HIST1H2BC;HIST1H2BD;H2BFS;HIST1H2BK;HIST3H2BB;HIST2H2BE;HIST1H2BB;HIST1H2BO;HIST1H2BJ	Histone H2B type 1-L;Histone H2B type 1-M;Histone H2B type 1-N;Histone H2B type 1-H;Histone H2B type 2-F;Histone H2B type 1-C/E/F/G/I;Histone H2B type 1-D;Histone H2B type F-S;Histone H2B type 1-K;Histone H2B type 3-B;Histone H2B type 2-E;Histone H2B type 1-B;Histone H2B type 1-O;Histone H2B type 1-J	MULTI-MSMS	DP1141_10	5	888.4086303710938	2	888.408197	1774.80184	0.541	0.00048063	-0.52074	-0.00046263	0.020262	1.8E-05	888.4081045857249	21.509	0.59128	21.509	21.368	21.959	0					9	5	3	0	0	0	0.0040533	2	16838	16838;16839		100.93	66.158	1	376360000			171	65	103	106	241;242	241	52;53	9606
AMGIMNSFVNDIFER	15	2 Oxidation (M)	_AM(Oxidation (M))GIM(Oxidation (M))NSFVNDIFER_	AM(1)GIM(1)NSFVNDIFER	AM(150)GIM(150)NSFVNDIFER	0	2	0	Q99880;Q99879;Q99877;Q93079;Q5QNW6;P62807;P58876;P57053;O60814;Q8N257;Q16778;P33778;P23527;P06899	Q99880	Q99880	HIST1H2BL;HIST1H2BM;HIST1H2BN;HIST1H2BH;HIST2H2BF;HIST1H2BC;HIST1H2BD;H2BFS;HIST1H2BK;HIST3H2BB;HIST2H2BE;HIST1H2BB;HIST1H2BO;HIST1H2BJ	Histone H2B type 1-L;Histone H2B type 1-M;Histone H2B type 1-N;Histone H2B type 1-H;Histone H2B type 2-F;Histone H2B type 1-C/E/F/G/I;Histone H2B type 1-D;Histone H2B type F-S;Histone H2B type 1-K;Histone H2B type 3-B;Histone H2B type 2-E;Histone H2B type 1-B;Histone H2B type 1-O;Histone H2B type 1-J	MULTI-MSMS	DP1141_6	1	888.4087524414062	2	888.408197	1774.80184	0.8142	0.00072334	-0.48835	-0.00043386	0.32585	0.00028949	888.4081624995632	21.51	0.40452	21.51	21.383	21.787	0					9	4	4	0	0	0	0.00070442	2	15868	15868;15876		146.16	113.12	1	14200000			172	65	103	106	243;244	243	52;53	9606
AMGIMNSFVNDIFER	15	2 Oxidation (M)	_AM(Oxidation (M))GIM(Oxidation (M))NSFVNDIFER_	AM(1)GIM(1)NSFVNDIFER	AM(170)GIM(170)NSFVNDIFER	0	2	0	Q99880;Q99879;Q99877;Q93079;Q5QNW6;P62807;P58876;P57053;O60814;Q8N257;Q16778;P33778;P23527;P06899	Q99880	Q99880	HIST1H2BL;HIST1H2BM;HIST1H2BN;HIST1H2BH;HIST2H2BF;HIST1H2BC;HIST1H2BD;H2BFS;HIST1H2BK;HIST3H2BB;HIST2H2BE;HIST1H2BB;HIST1H2BO;HIST1H2BJ	Histone H2B type 1-L;Histone H2B type 1-M;Histone H2B type 1-N;Histone H2B type 1-H;Histone H2B type 2-F;Histone H2B type 1-C/E/F/G/I;Histone H2B type 1-D;Histone H2B type F-S;Histone H2B type 1-K;Histone H2B type 3-B;Histone H2B type 2-E;Histone H2B type 1-B;Histone H2B type 1-O;Histone H2B type 1-J	MSMS	DP1141_9	4	887.9337158203125	2	888.408197	1774.80184	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.543	1	21.543	21.043	22.043	0								0	0	0	1.3613E-35	1	16180	16180		165.66	119.79	1				173	65	103	106	245	245	52;53	9606
AMGIMNSFVNDIFER	15	Oxidation (M)	_AMGIM(Oxidation (M))NSFVNDIFER_	AM(0.001)GIM(0.999)NSFVNDIFER	AM(-30)GIM(30)NSFVNDIFER	0	1	0	Q99880;Q99879;Q99877;Q93079;Q5QNW6;P62807;P58876;P57053;O60814;Q8N257;Q16778;P33778;P23527;P06899	Q99880	Q99880	HIST1H2BL;HIST1H2BM;HIST1H2BN;HIST1H2BH;HIST2H2BF;HIST1H2BC;HIST1H2BD;H2BFS;HIST1H2BK;HIST3H2BB;HIST2H2BE;HIST1H2BB;HIST1H2BO;HIST1H2BJ	Histone H2B type 1-L;Histone H2B type 1-M;Histone H2B type 1-N;Histone H2B type 1-H;Histone H2B type 2-F;Histone H2B type 1-C/E/F/G/I;Histone H2B type 1-D;Histone H2B type F-S;Histone H2B type 1-K;Histone H2B type 3-B;Histone H2B type 2-E;Histone H2B type 1-B;Histone H2B type 1-O;Histone H2B type 1-J	MULTI-MSMS	DP1141_10	5	880.4112548828125	2	880.41074	1758.80693	0.5017	0.0004417	-0.27604	-0.00024303	0.22566	0.00019868	880.4106304945681	22.209	0.45965	22.209	22.058	22.518	0					9	4	4	0	0	0	0.01121	1	17873	17873		123.67	92.603	2	12750000			174	65	103	107	246	246	52;53	9606
AMKPPGGESSNLFGSPEEATPSSRPNR	27	Oxidation (M)	_AM(Oxidation (M))KPPGGESSNLFGSPEEATPSSRPNR_	AM(1)KPPGGESSNLFGSPEEATPSSRPNR	AM(80)KPPGGESSNLFGSPEEATPSSRPNR	0	1	2	Q9H910	Q9H910	Q9H910	HN1L	Hematological and neurological expressed 1-like protein	MULTI-MSMS	DP1141_10	5	705.9523315429688	4	704.837156	2815.31952	1.1403	0.00080371	-0.51714	-0.0003645	0.62314	0.00043921	705.0872729648319	16.316	0.49219	16.316	15.968	16.46	0					12	4	4	0	0	0	7.7159E-06	2	8483	8483;8563		79.69	58.799	1	42900000			175	563	104	108	247;248	247	401	9606
AMPVTKPITVTK	12	Oxidation (M)	_AM(Oxidation (M))PVTKPITVTK_	AM(1)PVTKPITVTK	AM(83)PVTKPITVTK	0	1	1	Q96KM6	Q96KM6	Q96KM6	ZNF512B	Zinc finger protein 512B	MULTI-SECPEP	DP1141_7	2	435.2369384765625	3	434.588096	1300.74246	0.57614	0.00025038	0.39564	0.00017194	0.97177	0.00042232	434.58802821700596	14.259	0.4876	14.259	14.121	14.608	0					5	4	2	0	0	0	0.0066145	1	4982	4982		83.182	38.57	1	2162400			176	516	105	109	249	249	364	9606
AMTGVEQWPYR	11	Oxidation (M)	_AM(Oxidation (M))TGVEQWPYR_	AM(1)TGVEQWPYR	AM(120)TGVEQWPYR	0	1	0	P49368	P49368	P49368	CCT3	T-complex protein 1 subunit gamma	MULTI-SECPEP	DP1141_8	3	677.8828125	2	677.316437	1352.61832	0.69191	0.00046864	-0.27242	-0.00018452	0.41948	0.00028412	677.3158391268131	18.16	0.30041	18.16	17.975	18.275	0					4	2	2	0	0	0	0.01499	1	11062	11062		120.87	77.234	1	6226900			177	246	106	110	250	250	197	9606
ANSANTNTVPK	11	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ANSANTNTVPK_			1	0	0	P52655	P52655	P52655	GTF2A1	Transcription initiation factor IIA subunit 1;Transcription initiation factor IIA alpha chain;Transcription initiation factor IIA beta chain	MULTI-SECPEP	DP1141_9	4	579.2623291015625	2	579.791109	1157.56767	0.56221	0.00032597	-0.16408	-9.5133E-05	0.39813	0.00023083	579.7909677313119	15.224	0.57645	15.224	14.795	15.372	0					11	5	3	0	0	0	0.0014063	1	5866	5866		104.05	37.749	1	34270000			178	267	107	111	251	251		9606
ANTFVAELK	9	Unmodified	_ANTFVAELK_			0	0	0	P40926	P40926	P40926	MDH2	Malate dehydrogenase, mitochondrial	MULTI-MSMS	DP1141_9	4	496.3134460449219	2	496.7742	991.533846	-0.090043	-4.4731E-05	-1.5185	-0.00075435	-1.6085	-0.00079908	496.7735477792261	17.887	0.39922	17.887	17.638	18.037	0					5	3	2	0	0	0	0.00091503	1	10538	10538		140.14	87.737	1	19277000			179	223	108	112	252	252		9606
APAMFNIR	8	Oxidation (M)	_APAM(Oxidation (M))FNIR_	APAM(1)FNIR	APAM(110)FNIR	0	1	0	P61247	P61247	P61247	RPS3A	40S ribosomal protein S3a	MULTI-MSMS	DP1141_10	5	467.75323486328125	2	468.242012	934.469472	-0.13962	-6.5376E-05	0.87329	0.00040891	0.73367	0.00034354	468.2421643920806	16.778	0.7267	16.778	16.46	17.187	0					17	10	3	0	0	0	0.035492	1	9258	9258		113.08	70.365	1	28100000			180	280	109	113	253	253	229	9606
APAMFNIR	8	Oxidation (M)	_APAM(Oxidation (M))FNIR_	APAM(1)FNIR	APAM(110)FNIR	0	1	0	P61247	P61247	P61247	RPS3A	40S ribosomal protein S3a	MULTI-MSMS	DP1141_9	4	468.2423095703125	2	468.242012	934.469472	0.071034	3.3261E-05	0.23765	0.00011128	0.30869	0.00014454	468.24211411747564	16.742	0.51765	16.742	16.62	17.138	0					10	6	2	0	0	0	0.035492	1	8818	8818		113.08	78.191	1	65001000			181	280	109	113	254	254	229	9606
APIRPDIVNFVHTNLR	16	Unmodified	_APIRPDIVNFVHTNLR_			0	0	1	P36578	P36578	P36578	RPL4	60S ribosomal protein L4	MULTI-MSMS	DP1141_9	4	621.6707153320312	3	621.35136	1861.03225	0.22327	0.00013873	0.039973	2.4837E-05	0.26325	0.00016357	621.6857946498016	19.288	0.50146	19.288	19.037	19.539	0					12	4	5	0	0	0	0.0095581	1	12872	12872		134.88	103.91	1	86174000			182	211	110	114	255	255		9606
APKPDGPGGGPGGSHMGGNYGDDR	24	Oxidation (M)	_APKPDGPGGGPGGSHM(Oxidation (M))GGNYGDDR_	APKPDGPGGGPGGSHM(1)GGNYGDDR	APKPDGPGGGPGGSHM(53)GGNYGDDR	0	1	1	P35637	P35637	P35637	FUS	RNA-binding protein FUS	MULTI-MSMS	DP1141_10	5	568.2487182617188	4	567.997628	2267.96141	1.0473	0.00059488	-0.66838	-0.00037964	0.37894	0.00021524	567.9973975829089	13.489	1.1322	13.489	12.692	13.824	0					63	14	6	0	0	0	0.0017498	2	3622	3385;3622		52.79	52.79	1	28340000			183	209	111	115	256;257	257	175	9606
APKPDGPGGGPGGSHMGGNYGDDR	24	Oxidation (M)	_APKPDGPGGGPGGSHM(Oxidation (M))GGNYGDDR_	APKPDGPGGGPGGSHM(1)GGNYGDDR	APKPDGPGGGPGGSHM(62)GGNYGDDR	0	1	1	P35637	P35637	P35637	FUS	RNA-binding protein FUS	MULTI-MSMS	DP1141_10	5	757.6621704101562	3	756.994412	2267.96141	0.88646	0.00067104	-0.38401	-0.0002907	0.50244	0.00038035	757.3285870683616	13.475	1.0286	13.475	12.692	13.72	0					37	12	5	0	0	0	0.0032171	4	3783	3783;3843;3896;3976		62.064	49.217	1	3767800			184	209	111	115	258;259;260;261	258	175	9606
APKPDGPGGGPGGSHMGGNYGDDR	24	Oxidation (M)	_APKPDGPGGGPGGSHM(Oxidation (M))GGNYGDDR_	APKPDGPGGGPGGSHM(1)GGNYGDDR	APKPDGPGGGPGGSHM(75)GGNYGDDR	0	1	1	P35637	P35637	P35637	FUS	RNA-binding protein FUS	MULTI-MSMS	DP1141_8	3	568.24853515625	4	567.997628	2267.96141	-0.35655	-0.00020252	0.29359	0.00016676	-0.062957	-3.5759E-05	568.2485919624675	13.493	1.4633	13.493	12.505	13.968	0					83	16	7	0	0	0	0.0002067	5	3089	3019;3089;3412;3868;3973		75.225	68.705	1	96665000			185	209	111	115	262;263;264;265;266	263	175	9606
APKPDGPGGGPGGSHMGGNYGDDR	24	Oxidation (M)	_APKPDGPGGGPGGSHM(Oxidation (M))GGNYGDDR_	APKPDGPGGGPGGSHM(1)GGNYGDDR	APKPDGPGGGPGGSHM(66)GGNYGDDR	0	1	1	P35637	P35637	P35637	FUS	RNA-binding protein FUS	MULTI-MSMS	DP1141_8	3	756.8140869140625	3	756.994412	2267.96141	0.45692	0.00034589	-0.32012	-0.00024233	0.1368	0.00010356	757.3285351703538	13.493	1.2621	13.493	12.706	13.968	0					57	14	6	0	0	0	0.0024188	2	3508	3209;3508		65.854	58.529	1	22318000			186	209	111	115	267;268	268	175	9606
APKPDGPGGGPGGSHMGGNYGDDR	24	Oxidation (M)	_APKPDGPGGGPGGSHM(Oxidation (M))GGNYGDDR_	APKPDGPGGGPGGSHM(1)GGNYGDDR	APKPDGPGGGPGGSHM(64)GGNYGDDR	0	1	1	P35637	P35637	P35637	FUS	RNA-binding protein FUS	MULTI-MSMS	DP1141_9	4	567.9976196289062	4	567.997628	2267.96141	0.022957	1.3039E-05	0.33122	0.00018813	0.35418	0.00020117	568.2485699102159	13.272	1.2089	13.272	12.602	13.81	0					48	13	5	0	0	0	0.00047715	2	2968	2968;3088		63.536	54.021	1	2498800			187	209	111	115	269;270	269	175	9606
APKPDGPGGGPGGSHMGGNYGDDR	24	Oxidation (M)	_APKPDGPGGGPGGSHM(Oxidation (M))GGNYGDDR_	APKPDGPGGGPGGSHM(1)GGNYGDDR	APKPDGPGGGPGGSHM(54)GGNYGDDR	0	1	1	P35637	P35637	P35637	FUS	RNA-binding protein FUS	MULTI-MSMS	DP1141_9	4	757.3021850585938	3	756.994412	2267.96141	0.53974	0.00040858	0.18898	0.00014305	0.72872	0.00055164	757.329199777393	13.356	0.83608	13.356	12.702	13.538	0					14	8	2	0	0	0	0.0080854	1	3533	3533		53.998	30.315	1	880420			188	209	111	115	271	271	175	9606
APKPDGPGGGPGGSHMGGNYGDDR	24	Unmodified	_APKPDGPGGGPGGSHMGGNYGDDR_			0	0	1	P35637	P35637	P35637	FUS	RNA-binding protein FUS	MULTI-MSMS	DP1141_10	5	564.2496337890625	4	563.998899	2251.96649	0.68965	0.00038896	-0.62593	-0.00035303	0.063715	3.5935E-05	564.2493510349841	14.45	0.32369	14.45	14.276	14.6	0					11	4	4	0	0	0	1.0859E-05	2	5564	5542;5564		100.85	93.11	1	20377000			189	209	111	116	272;273	273		9606
APKPDGPGGGPGGSHMGGNYGDDR	24	Unmodified	_APKPDGPGGGPGGSHMGGNYGDDR_			0	0	1	P35637	P35637	P35637	FUS	RNA-binding protein FUS	MULTI-MSMS	DP1141_10	5	751.6629638671875	3	751.662774	2251.96649	0.43713	0.00032857	-0.082949	-6.2349E-05	0.35418	0.00026622	751.6626913018309	14.436	0.19999	14.436	14.339	14.539	0					6	2	3	0	0	0	0.01336	1	5578	5578		57.432	44.718	1	5684600			190	209	111	116	274	274		9606
APKPDGPGGGPGGSHMGGNYGDDR	24	Unmodified	_APKPDGPGGGPGGSHMGGNYGDDR_			0	0	1	P35637	P35637	P35637	FUS	RNA-binding protein FUS	MULTI-MSMS	DP1141_8	3	752.3651123046875	3	751.662774	2251.96649	0.61829	0.00046475	-0.71028	-0.00053389	-0.09199	-6.9146E-05	751.9965069917612	14.492	0.22305	14.492	14.354	14.577	0					8	2	4	0	0	0	1.4522E-05	2	5198	5198;5232		99.454	87.091	1	31349000			191	209	111	116	275;276	275		9606
APPYQEPPWGGPATAPYSLETLK	23	Unmodified	_APPYQEPPWGGPATAPYSLETLK_			0	0	0	Q9BWU0	Q9BWU0	Q9BWU0	SLC4A1AP	Kanadaptin	MULTI-MSMS	DP1141_7	2	1236.1187744140625	2	1235.61809	2469.22163	0.57693	0.00071287	-0.27386	-0.00033839	0.30307	0.00037448	1236.6209311362074	21.5	0.29947	21.5	21.35	21.65	0					6	2	3	0	0	0	0.0017202	1	16458	16458		78.326	56.465	1	7675400			192	544	112	117	277	277		9606
APSSLSDAVPQR	12	Unmodified	_APSSLSDAVPQR_			0	0	0	Q8IX01	Q8IX01	Q8IX01	SUGP2	SURP and G-patch domain-containing protein 2	MULTI-SECPEP	DP1141_7	2	614.8561401367188	2	614.320034	1226.62551	0.67764	0.00041629	-0.60352	-0.00037075	0.074122	4.5535E-05	614.3197483062296	16.165	0.40018	16.165	15.914	16.315	0					7	3	3	0	0	0	1.1336E-14	1	7972	7972		172.98	96.699	1	88014000			193	464	113	118	278	278		9606
APSTYGGGLSVSSR	14	Unmodified	_APSTYGGGLSVSSR_			0	0	0	CON__P08779;P08779	CON__P08779	CON__P08779	KRT16	Keratin, type I cytoskeletal 16	MULTI-MSMS	DP1141_9	4	669.83642578125	2	669.836048	1337.65754	0.63135	0.0004229	-0.33822	-0.00022655	0.29313	0.00019635	669.8358564500783	16.508	0.36229	16.508	16.258	16.62	0					6	3	2	0	0	0	1.3522E-97	1	8299	8299		215.04	121.9	1	86673000		+	194	16	114	119	279	279		9606
AQAAAPASVPAQAPK	15	Unmodified	_AQAAAPASVPAQAPK_			0	0	0	P47914	P47914	P47914	RPL29	60S ribosomal protein L29	MULTI-MSMS	DP1141_10	5	689.3779907226562	2	689.377883	1376.74121	0.44881	0.0003094	-0.070706	-4.8743E-05	0.3781	0.00026066	689.3778434856808	14.843	0.22396	14.843	14.736	14.96	0					4	2	2	0	0	0	0.014213	1	6232	6232		94.767	67.286	1	13447000			195	239	115	120	280	280		9606
AQAVHPGYGFLSENK	15	Unmodified	_AQAVHPGYGFLSENK_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-SECPEP	DP1141_8	3	539.8206176757812	3	539.938845	1616.79471	0.52532	0.00028364	0.019149	1.0339E-05	0.54447	0.00029398	539.9392117079879	17.323	0.40098	17.323	17.173	17.574	0					7	3	3	0	0	0	0.0080423	1	9737	9737		83.869	58.634	1	85691000			196	110	116	121	281	281		9606
AQAVHPGYGFLSENKEFAR	19	Unmodified	_AQAVHPGYGFLSENKEFAR_			0	0	1	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-SECPEP	DP1141_6	1	530.7783203125	4	531.018261	2120.04394	1.2599	0.00066904	-0.8028	-0.0004263	0.45712	0.00024274	531.2685423616402	18.055	0.40005	18.055	17.705	18.105	0					5	3	2	0	0	0	0.014258	1	10339	10339		66.289	37.35	1	61180000			197	110	117	122	282	282		9606
AQAVHPGYGFLSENKEFAR	19	Unmodified	_AQAVHPGYGFLSENKEFAR_			0	0	1	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_8	3	708.3385620117188	3	707.688589	2120.04394	0.65749	0.0004653	0.2293	0.00016227	0.88679	0.00062757	707.6886684931703	18.025	0.40087	18.025	17.674	18.075	0					9	3	4	0	0	0	0.0010807	2	10822	10822;10883		147.49	119.56	1	40657000			198	110	117	122	283;284	283		9606
AQAVHPGYGFLSENKEFAR	19	Unmodified	_AQAVHPGYGFLSENKEFAR_			0	0	1	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_8	3	531.269287109375	4	531.018261	2120.04394	0.23005	0.00012216	0.38639	0.00020518	0.61644	0.00032734	531.2691178588196	18.025	0.50115	18.025	17.774	18.275	0					9	4	4	0	0	0	0.0008619	1	10854	10854		112.91	104.38	1	89008000			199	110	117	122	285	285		9606
AQAVTQPVPLANKPVPAQSTFPSK	24	Unmodified	_AQAVTQPVPLANKPVPAQSTFPSK_			0	0	1	P49750	P49750	P49750	YLPM1	YLP motif-containing protein 1	MULTI-MSMS	DP1141_7	2	826.4578857421875	3	826.123463	2475.34856	0.65975	0.00054504	-0.50764	-0.00041937	0.15212	0.00012567	826.4574419362262	17.4	0.30014	17.4	17.249	17.549	0					6	2	3	0	0	0	0.0012184	1	10130	10130		90.978	74.932	1	30257000			200	250	118	123	286	286		9606
AQDQGEKENPMR	12	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AQDQGEKENPMR_			1	0	1	P62913	P62913	P62913	RPL11	60S ribosomal protein L11	MULTI-MSMS	DP1141_10	5	722.8287353515625	2	722.827897	1443.64124	0.85095	0.00061509	-0.6654	-0.00048097	0.18556	0.00013413	722.8274897045642	14.843	0.48727	14.843	14.472	14.96	0					15	6	4	0	0	0	4.8985E-22	3	6006	5780;6006;6044		174.77	137.7	1	56639000			201	313	119	124	287;288;289	288		9606
AQELGHSQSALASAQR	16	Unmodified	_AQELGHSQSALASAQR_			0	0	0	Q14980	Q14980	Q14980	NUMA1	Nuclear mitotic apparatus protein 1	MSMS	DP1141_7	2	551.7763061523438	3	551.948292	1652.82305	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.741	1	14.741	14.241	15.241	0								0	0	0	0.019277	1	5642	5642		81.428	58.542	1				202	396	120	125	290	290		9606
AQEPESGLSEETQVK	15	Unmodified	_AQEPESGLSEETQVK_			0	0	0	P78527	P78527	P78527	PRKDC	DNA-dependent protein kinase catalytic subunit	MULTI-MSMS	DP1141_6	1	816.392333984375	2	816.391581	1630.76861	0.22932	0.00018722	0.49923	0.00040756	0.72855	0.00059478	816.3921477293641	15.955	0.30117	15.955	15.804	16.105	0					6	2	3	0	0	0	0.0058351	1	7136	7136		106.26	74.91	1	3143800			203	329	121	126	291	291		9606
AQIHDLVLVGGSTR	14	Unmodified	_AQIHDLVLVGGSTR_			0	0	0	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-SECPEP	DP1141_7	2	732.8570556640625	2	733.409714	1464.80488	0.38507	0.00028241	-1.1624	-0.00085249	-0.7773	-0.00057008	733.4087993236225	17.762	0.2996	17.762	17.549	17.849	0					4	2	2	0	0	0	0.035175	1	10555	10555		89.301	46.557	1	8219500			204	135	122	127	292	292		9606
AQIHDLVLVGGSTR	14	Unmodified	_AQIHDLVLVGGSTR_			0	0	0	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-MSMS	DP1141_8	3	734.3522338867188	2	733.409714	1464.80488	0.57527	0.00042191	-0.086527	-6.346E-05	0.48874	0.00035845	733.4096819304822	17.724	0.30014	17.724	17.574	17.874	0					4	2	2	0	0	0	0.0010428	1	10348	10348		139.19	104.01	1	879980000			205	135	122	127	293	293		9606
AQIHDLVLVGGSTR	14	Unmodified	_AQIHDLVLVGGSTR_			0	0	0	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-MSMS	DP1141_9	4	733.3599243164062	2	733.409714	1464.80488	0.39138	0.00028704	0.10714	7.8581E-05	0.49852	0.00036562	733.4097646163843	17.787	0.30007	17.787	17.537	17.837	0					6	2	3	0	0	0	4.4662E-14	2	10381	10262;10381		172.76	145.78	1	9470500			206	135	122	127	294;295	295		9606
AQIHDLVLVGGSTR	14	Unmodified	_AQIHDLVLVGGSTR_			0	0	0	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-MSMS	DP1141_9	4	489.7706298828125	3	489.275568	1464.80488	0.10345	5.0615E-05	-0.032987	-1.614E-05	0.070462	3.4475E-05	489.27559852714165	17.787	0.30007	17.787	17.537	17.837	0					8	2	4	0	0	0	0.005539	1	10390	10390		87.363	65.042	1	32694000			207	135	122	127	296	296		9606
AQNSELASTANMLR	14	Oxidation (M)	_AQNSELASTANM(Oxidation (M))LR_	AQNSELASTANM(1)LR	AQNSELASTANM(100)LR	0	1	0	P05412	P05412	P05412	JUN	Transcription factor AP-1	MULTI-MSMS	DP1141_9	4	761.3692016601562	2	761.369929	1520.72531	0.75466	0.00057458	-2.1425	-0.0016313	-1.3879	-0.0010567	761.368433165922	16.892	0.35613	16.892	16.782	17.138	0					8	4	3	0	0	0	0.027202	1	8989	8989		103.21	65.613	1	13295000			208	115	123	128	297	297	102	9606
AQVVHLLSTMDSPAST	16	Oxidation (M)	_AQVVHLLSTM(Oxidation (M))DSPAST_	AQVVHLLSTM(1)DSPAST	AQVVHLLSTM(110)DSPAST	0	1	0	O00763	O00763	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	837.8547973632812	2	836.914169	1671.81379	1.661	0.0013901	-1.0605	-0.00088757	0.6005	0.00050256	836.9132495185115	18.097	0.3	18.097	17.905	18.205	0					4	2	2	0	0	0	0.013509	1	10461	10461		114.71	81.168	1	3963000			209	40	124	129	298	298	32	9606
AQYEDIAQK	9	Unmodified	_AQYEDIAQK_			0	0	0	P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_9	4	533.240478515625	2	533.264196	1064.51384	0.6595	0.00035169	-0.22306	-0.00011895	0.43644	0.00023274	533.264047970448	15.124	0.56021	15.124	14.714	15.274	0					7	5	2	0	0	0	0.0017001	2	6016	6010;6016		125.81	64.842	1	93478000		+	210	102	125	130	299;300	300		9606
ASAVSELSPR	10	Unmodified	_ASAVSELSPR_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_6	1	509.27191162109375	2	508.772188	1015.52982	-0.085945	-4.3727E-05	-0.060081	-3.0568E-05	-0.14603	-7.4294E-05	508.7725112005964	15.955	0.79655	15.955	15.309	16.105	0					10	7	2	0	0	0	0.00059962	2	6966	6853;6966		146.23	87.449	1	9121400			211	612	126	131	301;302	302		9606
ASAVSELSPR	10	Unmodified	_ASAVSELSPR_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_7	2	509.27288818359375	2	508.772188	1015.52982	0.14412	7.3327E-05	0.38466	0.0001957	0.52878	0.00026903	508.7723794229498	15.965	0.70303	15.965	15.512	16.215	0					16	6	4	0	0	0	2.206E-40	2	7553	7553;7581		182.98	118.78	1	121750000			212	612	126	131	303;304	303		9606
ASAVSELSPR	10	Unmodified	_ASAVSELSPR_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_8	3	508.9063720703125	2	508.772188	1015.52982	0.34955	0.00017784	-1.4987	-0.00076248	-1.1491	-0.00058464	509.27253966897206	15.913	0.5013	15.913	15.575	16.076	0					9	4	3	0	0	0	0.0061497	2	7498	7345;7498		120.99	73.922	1	11552000			213	612	126	131	305;306	306		9606
ASAVSPANLPAVLLQPR	17	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ASAVSPANLPAVLLQPR_			1	0	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-MSMS	DP1141_10	5	874.0009765625	2	873.499061	1744.98357	0.43602	0.00038086	0.020516	1.7921E-05	0.45653	0.00039878	873.4989064958722	23.496	0.32847	23.496	23.301	23.629	0					9	4	3	0	0	0	9.1514E-45	2	19700	19620;19700		184.34	145.08	1	7129800			214	259	127	132	307;308	308		9606
ASAVSPANLPAVLLQPR	17	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ASAVSPANLPAVLLQPR_			1	0	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-MSMS	DP1141_6	1	873.49951171875	2	873.499061	1744.98357	0.95064	0.00083039	-0.139	-0.00012142	0.81164	0.00070897	873.4988233524834	23.514	0.26461	23.514	23.287	23.552	0					13	4	4	0	0	0	1.1195999999999999E-44	2	18621	18565;18621		183.06	164.1	1	12138000			215	259	127	132	309;310	310		9606
ASAVSPANLPAVLLQPR	17	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ASAVSPANLPAVLLQPR_			1	0	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-MSMS	DP1141_6	1	583.0033569335938	3	582.668466	1744.98357	1.2281	0.00071558	-0.33526	-0.00019535	0.89284	0.00052023	583.0026614736491	23.485	0.26461	23.485	23.287	23.552	0					6	4	2	0	0	0	0.0052078	1	18710	18710		65.943	49.761	1	2462300			216	259	127	132	311	311		9606
ASAVSPANLPAVLLQPR	17	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ASAVSPANLPAVLLQPR_			1	0	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-MSMS	DP1141_7	2	874.0013427734375	2	873.499061	1744.98357	0.41424	0.00036184	-0.085206	-7.4427E-05	0.32904	0.00028741	873.4989140668107	23.522	0.36376	23.522	23.278	23.642	0					17	4	5	0	0	0	2.1866E-16	2	19171	19171;19213		166.6	133.55	1	28736000			217	259	127	132	312;313	312		9606
ASAVSPANLPAVLLQPR	17	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ASAVSPANLPAVLLQPR_			1	0	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-SECPEP	DP1141_7	2	583.3566284179688	3	582.668466	1744.98357	0.64846	0.00037784	-0.013701	-7.9831E-06	0.63476	0.00036985	583.0027166286743	23.526	0.28057	23.526	23.278	23.559	0					6	3	2	0	0	0	0.026462	1	19152	19152		44.005	36.935	1	8678300			218	259	127	132	314	314		9606
ASAVSPANLPAVLLQPR	17	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ASAVSPANLPAVLLQPR_			1	0	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-MSMS	DP1141_8	3	873.4977416992188	2	873.499061	1744.98357	0.59022	0.00051556	-0.036309	-3.1716E-05	0.55391	0.00048384	873.4989404875006	23.505	0.22581	23.505	23.325	23.551	0					4	2	2	0	0	0	6.9793E-24	1	19090	19090		171.62	125.85	1	6661500			219	259	127	132	315	315		9606
ASAVSPANLPAVLLQPR	17	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ASAVSPANLPAVLLQPR_			1	0	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-MSMS	DP1141_9	4	873.5025634765625	2	873.499061	1744.98357	0.93138	0.00081356	0.058882	5.1433E-05	0.99026	0.00086499	873.4995371437153	23.483	0.2563	23.483	23.335	23.591	0					5	3	2	0	0	0	0.0011889	1	19134	19134		126.83	103.6	1	2408200			220	259	127	132	316	316		9606
ASESSKPWPDATYGTGSASR	20	Unmodified	_ASESSKPWPDATYGTGSASR_			0	0	1	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_7	2	685.9866943359375	3	685.65198	2053.93411	0.89874	0.00061622	-0.33373	-0.00022882	0.56501	0.0003874	685.9860885685139	16.565	0.53835	16.565	16.415	16.953	0					11	6	3	0	0	0	6.846800000000001E-130	1	8617	8617		221.81	202.52	1	319460000			221	612	128	133	317	317		9606
ASESSKPWPDATYGTGSASR	20	Unmodified	_ASESSKPWPDATYGTGSASR_			0	0	1	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_7	2	1028.47607421875	2	1027.97433	2053.93411	0.64638	0.00066446	-0.2465	-0.0002534	0.39987	0.00041106	1028.475461562982	16.565	0.22961	16.565	16.415	16.644	0					8	2	4	0	0	0	1.9253E-12	1	8628	8628		174.59	145.25	1	68604000			222	612	128	133	318	318		9606
ASGNYATVISHNPETK	16	Unmodified	_ASGNYATVISHNPETK_			0	0	0	P62917	P62917	P62917	RPL8	60S ribosomal protein L8	MULTI-MSMS	DP1141_10	5	563.6128540039062	3	563.612797	1687.81656	0.88994	0.00050158	-0.70613	-0.00039799	0.18381	0.0001036	563.6123721722907	15.736	0.34059	15.736	15.533	15.873	0					9	3	3	0	0	0	0.0013521	3	7623	7462;7623;7700		184	157.89	1	42110000			223	314	129	134	319;320;321	320		9606
ASGNYATVISHNPETKK	17	Unmodified	_ASGNYATVISHNPETKK_			0	0	1	P62917	P62917	P62917	RPL8	60S ribosomal protein L8	MULTI-SECPEP	DP1141_10	5	454.4705810546875	4	454.985158	1815.91153	-0.3211	-0.0001461	0.63826	0.0002904	0.31716	0.0001443	455.2364758541649	14.924	0.45357	14.924	14.667	15.12	0					11	5	4	0	0	0	0.019813	1	6107	6107		50.827	23.178	1	14903000			224	314	130	135	322	322		9606
ASGPPVSELITK	12	Unmodified	_ASGPPVSELITK_			0	0	0	P16403;P10412;P16402	P16403	P16403	HIST1H1C;HIST1H1E;HIST1H1D	Histone H1.2;Histone H1.4;Histone H1.3	MULTI-MSMS	DP1141_9	4	599.8565673828125	2	599.837528	1197.6605	-0.050534	-3.0312E-05	0.62335	0.00037391	0.57282	0.0003436	599.8377420452169	17.987	0.59947	17.987	17.537	18.137	0					14	5	4	0	0	0	0.0050838	1	10591	10591		108.31	79.143	1	38909000			225	157	131	136	323	323		9606
ASGQAFELILSPR	13	Unmodified	_ASGQAFELILSPR_			0	0	0	P16949	P16949	P16949	STMN1	Stathmin	MULTI-MSMS	DP1141_10	5	695.412841796875	2	694.880259	1387.74596	1.1673	0.0008111	-0.33593	-0.00023343	0.83133	0.00057768	694.8796837647226	20.825	0.29988	20.825	20.676	20.975	0					6	2	3	0	0	0	0.0077379	1	15797	15797		89.301	49.364	1	19802000			226	159	132	137	324	324		9606
ASIGQSPGLPSTTFK	15	Unmodified	_ASIGQSPGLPSTTFK_			0	0	0	Q5VT52	Q5VT52	Q5VT52	RPRD2	Regulation of nuclear pre-mRNA domain-containing protein 2	MULTI-SECPEP	DP1141_7	2	745.3738403320312	2	745.896106	1489.77766	0.56181	0.00041905	0.81862	0.00061061	1.3804	0.0010297	746.398061256119	18.259	0.30011	18.259	18.049	18.349	0					6	2	3	0	0	0	8.6701E-11	1	11337	11337		161.48	138.9	1	19129000			227	424	133	138	325	325		9606
ASKCLKASFSSGSLK	15	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ASKCLKASFSSGSLK_			1	0	2	CON__Q497I4	CON__Q497I4	CON__Q497I4			MULTI-SECPEP	DP1141_6	1	538.61572265625	3	538.283624	1611.82904	0.82169	0.0004423	-3.5573	-0.0019148	-2.7356	-0.0014725	538.6155371023631	17.455	0.50142	17.455	17.204	17.705	0					5	4	2	0	0	0	0.023637	1	9557	9557		48.608	13.571	1	25208000		+	228	26	134	139	326	326		
ASKGAGMSFSRK	12	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))ASKGAGM(Oxidation (M))SFSRK_	ASKGAGM(1)SFSRK	ASKGAGM(65)SFSRK	1	1	2	Q5XPI4	Q5XPI4	Q5XPI4	RNF123	E3 ubiquitin-protein ligase RNF123	MSMS	DP1141_10	5	642.8204956054688	2	642.821886	1283.62922	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.651	1	20.651	20.151	21.151	0								0	0	0	0.027592	1	15423	15423		64.82	19.739	1				229	428	135	140	327	327	323	9606
ASKPLPPAPAPDEYLVSPITGEK	23	Unmodified	_ASKPLPPAPAPDEYLVSPITGEK_			0	0	1	Q15459	Q15459	Q15459	SF3A1	Splicing factor 3A subunit 1	MULTI-MSMS	DP1141_7	2	793.9036865234375	3	793.093169	2376.25768	0.39302	0.0003117	-0.1821	-0.00014443	0.21091	0.00016727	793.427389549116	19.2	0.60082	19.2	18.95	19.551	0					10	5	3	0	0	0	0.0021252	2	12790	12790;12812		86.825	57.514	1	36812000			230	405	136	141	328;329	328		9606
ASLENSLEETKGR	13	Unmodified	_ASLENSLEETKGR_			0	0	1	CON__P02533;P02533;CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8	CON__P02533;CON__P08779	CON__P08779	KRT14;KRT16	Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 16	MULTI-SECPEP	DP1141_9	4	478.2823181152344	3	478.579205	1432.71579	0.41755	0.00019983	0.66391	0.00031773	1.0815	0.00051757	478.57900845762833	15.964	1.0867	15.964	15.372	16.458	0					15	10	3	0	0	0	0.011972	1	7267	7267		128.08	67.44	1	9601400		+	231	16;9	137	142	330	330		9606
ASLSLAPVNIFK	12	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ASLSLAPVNIFK_			1	0	0	P78371	P78371	P78371	CCT2	T-complex protein 1 subunit beta	MULTI-MSMS	DP1141_8	3	651.3766479492188	2	651.37682	1300.73909	1.0611	0.00069119	-0.89847	-0.00058524	0.16265	0.00010595	651.376115036835	23.903	0.31455	23.903	23.783	24.098	0					7	3	3	0	0	0	0.00072203	1	19780	19780		124.92	94.604	1	10249000			232	328	138	143	331	331		9606
ASPGAGRAPPELPER	15	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ASPGAGRAPPELPER_			1	0	1	P0DPD7;P0DPD8	P0DPD7	P0DPD7			MULTI-MSMS	DP1141_8	3	516.2720947265625	3	516.270595	1545.78995	0.57915	0.000299	2.3549	0.0012158	2.934	0.0015148	516.272275871304	19.026	0.49963	19.026	18.775	19.275	0					13	4	5	0	0	0	0.009029	1	12469	12469		58.595	11.556	1	2159400000			233	136	139	144	332	332		9606
ASPSPTDPVVPAVPIGPPPAGFR	23	Unmodified	_ASPSPTDPVVPAVPIGPPPAGFR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	1114.1009521484375	2	1113.5995	2225.18445	0.23228	0.00025867	0.52541	0.0005851	0.75769	0.00084376	1114.1013545801252	20.636	0.65671	20.636	20.39	21.046	0					23	6	5	0	0	0	9.0856E-238	3	14493	14493;14550;14558		247.73	227.07	1	45213000			234	142	140	145	333;334;335	333		9606
ASPSPTDPVVPAVPIGPPPAGFR	23	Unmodified	_ASPSPTDPVVPAVPIGPPPAGFR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	743.0703735351562	3	742.735428	2225.18445	0.82713	0.00061434	0.078941	5.8633E-05	0.90607	0.00067297	743.0697634997963	20.7	0.69939	20.7	20.351	21.05	0					16	6	3	0	0	0	1.8614E-08	3	15082	14746;15082;15222		109.77	87.336	1	108340000			235	142	140	145	336;337;338	337		9606
ASPSPTDPVVPAVPIGPPPAGFR	23	Unmodified	_ASPSPTDPVVPAVPIGPPPAGFR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	1114.1025390625	2	1113.5995	2225.18445	0.668	0.00074389	-0.079269	-8.8274E-05	0.58873	0.00065561	1114.1007916338913	20.7	0.79917	20.7	20.351	21.15	0					31	7	6	0	0	0	4.6011E-238	2	15009	15009;15075		250.81	231.49	1	281920000			236	142	140	145	339;340	339		9606
ASPSPTDPVVPAVPIGPPPAGFR	23	Unmodified	_ASPSPTDPVVPAVPIGPPPAGFR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	743.4306640625	3	742.735428	2225.18445	0.80165	0.00059541	-0.19686	-0.00014622	0.60478	0.00044919	743.0695468744864	20.628	0.70139	20.628	20.176	20.878	0					13	6	4	0	0	0	0.0013744	2	14766	14766;14936		66.76	48.829	1	26414000			237	142	140	145	341;342	341		9606
ASPSPTDPVVPAVPIGPPPAGFR	23	Unmodified	_ASPSPTDPVVPAVPIGPPPAGFR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	1114.1019287109375	2	1113.5995	2225.18445	1.0172	0.0011327	-0.22825	-0.00025418	0.78894	0.00087856	1114.1007305252704	20.628	0.60064	20.628	20.377	20.978	0					15	5	4	0	0	0	1.827E-32	2	14924	14924;14940		172.58	152.74	1	72270000			238	142	140	145	343;344	343		9606
ASPSPTDPVVPAVPIGPPPAGFR	23	Unmodified	_ASPSPTDPVVPAVPIGPPPAGFR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_9	4	1114.1007080078125	2	1113.5995	2225.18445	-0.65914	-0.00073402	0.98049	0.0010919	0.32135	0.00035785	1114.1014598584138	20.687	0.40087	20.687	20.536	20.937	0					5	3	2	0	0	0	0.0031185	1	15121	15121		69.045	27.818	1	7104600			239	142	140	145	345	345		9606
ASTEGANNMPK	11	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ASTEGANNMPK_			1	0	0	P43004	P43004	P43004	SLC1A2	Excitatory amino acid transporter 2	MSMS	DP1141_6	1	581.291015625	2	581.26387	1160.51319	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.699	1	15.699	15.199	16.199	0								0	0	0	0.0075753	1	6476	6476		96.665	65.591	1				240	228	141	146	346	346		9606
ASVVLALR	8	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ASVVLALR_			1	0	0	Q9P0M9	Q9P0M9	Q9P0M9	MRPL27	39S ribosomal protein L27, mitochondrial	MULTI-SECPEP	DP1141_10	5	435.3008117675781	2	435.774003	869.533452	-0.1758	-7.6609E-05	-0.12035	-5.2446E-05	-0.29615	-0.00012906	435.7741018665992	16.832	1.6215	16.832	16.166	17.788	0					61	19	5	0	0	0	0.020135	1	9310	9310		79.939	11.455	1	10980000000			241	582	142	147	347	347		9606
ASVVLALR	8	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ASVVLALR_			1	0	0	Q9P0M9	Q9P0M9	Q9P0M9	MRPL27	39S ribosomal protein L27, mitochondrial	MULTI-MSMS	DP1141_6	1	436.2224426269531	2	435.774003	869.533452	0.61262	0.00026696	-0.99335	-0.00043288	-0.38073	-0.00016591	435.77370762361915	16.869	1.5996	16.869	16.205	17.805	0					51	17	5	0	0	0	0.023031	1	8242	8242		71.378	6.6205	1	3591899999.9999995			242	582	142	147	348	348		9606
ASVVLALR	8	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ASVVLALR_			1	0	0	Q9P0M9	Q9P0M9	Q9P0M9	MRPL27	39S ribosomal protein L27, mitochondrial	MULTI-MSMS	DP1141_8	3	436.3016052246094	2	435.774003	869.533452	-0.13054	-5.6885E-05	0.060958	2.6564E-05	-0.06958	-3.0321E-05	435.7741633032418	16.778	1.3979	16.778	16.176	17.574	0					44	14	5	0	0	0	0.014665	1	8825	8825		77.374	14.068	1	7459199999.999999			243	582	142	147	349	349		9606
ASVVLALR	8	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ASVVLALR_			1	0	0	Q9P0M9	Q9P0M9	Q9P0M9	MRPL27	39S ribosomal protein L27, mitochondrial	MULTI-MSMS	DP1141_9	4	436.73388671875	2	435.774003	869.533452	0.089666	3.9074E-05	-0.24434	-0.00010648	-0.15468	-6.7404E-05	435.7740281506634	16.821	1.5794	16.821	16.158	17.738	0					54	17	5	0	0	0	0.028834	1	8439	8439		68.398	17.432	1	11790000000			244	582	142	147	350	350		9606
ATAEVLNIGK	10	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ATAEVLNIGK_			1	0	0	P22234	P22234	P22234	PAICS	Multifunctional protein ADE2;Phosphoribosylaminoimidazole-succinocarboxamide synthase;Phosphoribosylaminoimidazole carboxylase	MULTI-MSMS	DP1141_9	4	529.2509765625	2	529.298039	1056.58152	0.33773	0.00017876	-0.24141	-0.00012778	0.096316	5.098E-05	529.2978804040865	20.387	0.40014	20.387	20.136	20.536	0					6	3	2	0	0	0	0.0044954	1	14171	14171		90.601	55.245	1	2720900			245	178	143	148	351	351		9606
ATAGDTHLGGEDFDNR	16	Unmodified	_ATAGDTHLGGEDFDNR_			0	0	0	P0DMV8;P0DMV9;P34931;P17066;P48741	P0DMV8;P17066	P0DMV8	HSPA1A;HSPA1B;HSPA1L;HSPA6;HSPA7	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like;Heat shock 70 kDa protein 6;Putative heat shock 70 kDa protein 7	MULTI-SECPEP	DP1141_7	2	559.961669921875	3	559.248407	1674.72339	0.24617	0.00013767	0.67354	0.00037667	0.91971	0.00051434	559.2488926396659	15.964	0.40007	15.964	15.714	16.114	0					5	3	2	0	0	0	1.2786E-06	1	7529	7529		128.73	109.45	1	13560000			246	135;161	144	149	352	352		9606
ATAGDTHLGGEDFDNR	16	Unmodified	_ATAGDTHLGGEDFDNR_			0	0	0	P0DMV8;P0DMV9;P34931;P17066;P48741	P0DMV8;P17066	P0DMV8	HSPA1A;HSPA1B;HSPA1L;HSPA6;HSPA7	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like;Heat shock 70 kDa protein 6;Putative heat shock 70 kDa protein 7	MULTI-MSMS	DP1141_8	3	559.248779296875	3	559.248407	1674.72339	-0.060399	-3.3778E-05	0.40566	0.00022686	0.34526	0.00019309	559.2492322089373	15.926	0.50083	15.926	15.675	16.176	0					9	4	3	0	0	0	0.0018643	1	7460	7460		152.11	126.15	1	2667600000			247	135;161	144	149	353	353		9606
ATAGDTHLGGEDFDNR	16	Unmodified	_ATAGDTHLGGEDFDNR_			0	0	0	P0DMV8;P0DMV9;P34931;P17066;P48741	P0DMV8;P17066	P0DMV8	HSPA1A;HSPA1B;HSPA1L;HSPA6;HSPA7	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like;Heat shock 70 kDa protein 6;Putative heat shock 70 kDa protein 7	MULTI-SECPEP	DP1141_9	4	558.7450561523438	3	559.248407	1674.72339	0.35916	0.00020086	-0.0094804	-5.3019E-06	0.34968	0.00019556	559.2484931053692	15.922	0.48549	15.922	15.673	16.158	0					8	4	3	0	0	0	1.1539E-06	1	7339	7339		127.57	119.59	1	338210000			248	135;161	144	149	354	354		9606
ATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAK	34	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))ATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAK_			1	0	1	Q13435	Q13435	Q13435	SF3B2	Splicing factor 3B subunit 2	MULTI-MSMS	DP1141_8	3	924.9707641601562	4	924.471772	3693.85798	0.27561	0.0002548	-1.6473	-0.0015229	-1.3717	-0.0012681	924.9710192642879	19.989	0.39985	19.989	19.777	20.176	0					9	3	4	0	0	0	8.2321E-18	1	13949	13949		95.152	78.784	1	13492000			249	374	145	150	355	355		9606
ATENDIYNFFSPLNPMR	17	Oxidation (M)	_ATENDIYNFFSPLNPM(Oxidation (M))R_	ATENDIYNFFSPLNPM(1)R	ATENDIYNFFSPLNPM(110)R	0	1	0	P55795	P55795	P55795	HNRNPH2	Heterogeneous nuclear ribonucleoprotein H2	MULTI-MSMS	DP1141_8	3	1023.1461791992188	2	1022.97529	2043.93603	0.70516	0.00072137	-0.39695	-0.00040607	0.30822	0.0003153	1023.477162411724	22.738	0.40857	22.738	22.379	22.788	0					7	4	3	0	0	0	0.0015497	1	17967	17967		114.87	102.7	1	4116700			250	272	146	151	356	356	224	9606
ATENDIYNFFSPLNPVR	17	Unmodified	_ATENDIYNFFSPLNPVR_			0	0	0	P52597;P31943	P52597;P31943	P52597	HNRNPF;HNRNPH1	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed	MULTI-MSMS	DP1141_10	5	999.4939575195312	2	998.991797	1995.96904	0.45344	0.00045298	-0.082283	-8.22E-05	0.37116	0.00037078	999.4933693151734	23.195	0.34091	23.195	23.028	23.369	0					11	4	4	0	0	0	0.00054595	1	19308	19308		121.28	90.716	1	32298000			251	266;200	147	152	357	357		9606
ATENDIYNFFSPLNPVR	17	Unmodified	_ATENDIYNFFSPLNPVR_			0	0	0	P52597;P31943	P52597;P31943	P52597	HNRNPF;HNRNPH1	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed	MULTI-MSMS	DP1141_9	4	999.498046875	2	998.991797	1995.96904	0.49916	0.00049866	0.38531	0.00038492	0.88447	0.00088358	999.4935924989884	23.217	0.24065	23.217	23.018	23.259	0					14	3	6	0	0	0	0	3	18681	18681;18703;18713		364.46	307.29	1	46194000			252	266;200	147	152	358;359;360	358		9606
ATENDIYNFFSPLNPVR	17	Unmodified	_ATENDIYNFFSPLNPVR_			0	0	0	P52597;P31943	P52597;P31943	P52597	HNRNPF;HNRNPH1	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed	MULTI-MSMS	DP1141_9	4	666.3309326171875	3	666.33029	1995.96904	1.2418	0.00082748	-0.37167	-0.00024766	0.87017	0.00057982	666.6643311051744	23.201	0.19188	23.201	23.067	23.259	0					8	2	4	0	0	0	0.0031157	1	18719	18719		134.76	106.59	1	8077400			253	266;200	147	152	361	361		9606
ATIAGGGVIPHIHK	14	Unmodified	_ATIAGGGVIPHIHK_			0	0	0	Q71UI9;P0C0S5	Q71UI9	Q71UI9	H2AFV;H2AFZ	Histone H2A.V;Histone H2A.Z	MULTI-SECPEP	DP1141_10	5	457.27154541015625	3	457.601616	1369.78302	-0.0033884	-1.5505E-06	0.28563	0.0001307	0.28224	0.00012915	457.60182990362745	16.216	0.8535	16.216	15.873	16.727	0					13	9	3	0	0	0	0.013481	1	8286	8286		80.318	44.724	1	60592000			254	133	148	153	362	362		9606
ATISNDGATILK	12	Unmodified	_ATISNDGATILK_			0	0	0	Q99832	Q99832	Q99832	CCT7	T-complex protein 1 subunit eta	MULTI-MSMS	DP1141_8	3	602.8436889648438	2	602.33261	1202.65067	0.23798	0.00014334	-1.9845	-0.0011953	-1.7465	-0.001052	602.3309935994946	16.923	0.24507	16.923	16.828	17.073	0					6	2	3	0	0	0	3.6747E-09	1	9109	9109		155.53	90.068	1	36186000			255	533	149	154	363	363		9606
ATKVDARR	8	Unmodified	_ATKVDARR_			0	0	2	Q86U10	Q86U10	Q86U10	ASPG	60 kDa lysophospholipase;L-asparaginase;Platelet-activating factor acetylhydrolase	MULTI-SECPEP	DP1141_10	5	458.7717590332031	2	458.769783	915.525013	-0.55413	-0.00025422	-2.5086	-0.0011509	-3.0627	-0.0014051	458.7686299111114	17.037	0.3902	17.037	16.797	17.187	0					9	5	3	0	0	0	0.00026504	1	9688	9688		115.46	14.247	1	124240000			256	456	150	155	364	364		9606
ATLEVILRPK	10	Unmodified	_ATLEVILRPK_			0	0	1	Q9NQT4	Q9NQT4	Q9NQT4	EXOSC5	Exosome complex component RRP46	MULTI-MSMS	DP1141_10	5	570.314208984375	2	570.360973	1138.70739	0.20347	0.00011605	0.35665	0.00020342	0.56012	0.00031947	570.3610840799562	17.637	0.40013	17.637	17.387	17.788	0					5	3	2	0	0	0	5.2203E-21	2	10744	10679;10744		175.51	154.54	1	78684000			257	571	151	156	365;366	366		9606
ATLVDHGIR	9	Unmodified	_ATLVDHGIR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	492.0158996582031	2	491.277441	980.540328	-0.28031	-0.00013771	-0.21521	-0.00010573	-0.49552	-0.00024344	491.2773415389487	14.758	0.79982	14.758	14.609	15.408	0					11	7	3	0	0	0	0.0011407	1	5102	5102		157.33	88.131	1	19717000			258	367	152	157	367	367		9606
ATNLCFAER	9	Unmodified	_ATNLCFAER_			0	0	0	Q92797	Q92797	Q92797	SYMPK	Symplekin	MULTI-MSMS	DP1141_7	2	541.2589111328125	2	541.258391	1080.50223	0.4767	0.00025802	-0.091267	-4.9399E-05	0.38543	0.00020862	541.2583898860029	16.903	0.37354	16.903	16.58	16.953	0					6	4	2	0	0	0	0.022396	1	9177	9177		82.75	52.138	1	16853000			259	494	153	158	368	368		9606
ATQQQHDFTLTQTADGR	17	Unmodified	_ATQQQHDFTLTQTADGR_			0	0	0	P78527	P78527	P78527	PRKDC	DNA-dependent protein kinase catalytic subunit	MULTI-MSMS	DP1141_6	1	639.8397827148438	3	639.973165	1916.89767	0.34332	0.00021972	0.16343	0.00010459	0.50675	0.00032431	639.9732709345773	16.155	0.30057	16.155	16.005	16.305	0					4	2	2	0	0	0	1.1212E-15	1	7194	7194		130.87	105.42	1	21577000			260	329	154	159	369	369		9606
ATSVLPR	7	Unmodified	_ATSVLPR_			0	0	0	Q9P0W8	Q9P0W8	Q9P0W8	SPATA7	Spermatogenesis-associated protein 7	MULTI-MSMS	DP1141_10	5	743.3670043945312	1	743.441015	742.433738	0.52088	0.00038725	-0.16929	-0.00012585	0.3516	0.00026139	743.4408646988625	16.813	0.92104	16.813	16.166	17.087	0					26	12	3	0	0	0	0.011753	1	9397	9397		103.29	13.612	1	84402000			261	584	155	160	370	370		9606
AVAFFLESIAMHDIIAAEK	19	Oxidation (M)	_AVAFFLESIAM(Oxidation (M))HDIIAAEK_	AVAFFLESIAM(1)HDIIAAEK	AVAFFLESIAM(78)HDIIAAEK	0	1	0	P78527	P78527	P78527	PRKDC	DNA-dependent protein kinase catalytic subunit	MULTI-MSMS	DP1141_7	2	698.0316772460938	3	698.030964	2091.07106	0.94614	0.00066043	0.43796	0.00030571	1.3841	0.00096614	698.0311945526098	23.103	0.3971	23.103	22.801	23.198	0					9	5	3	0	0	0	0.0029925	1	18682	18682		78.166	65.802	1	5716400			262	329	156	161	371	371	251	9606
AVCMLSNTTAIAEAWAR	17	Unmodified	_AVCMLSNTTAIAEAWAR_			0	0	0	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_8	3	933.4578247070312	2	932.955846	1863.89714	0.26197	0.0002444	0.39865	0.00037192	0.66062	0.00061633	933.4575561142965	21.729	0.30029	21.729	21.579	21.879	0					6	2	3	0	0	0	0.0068173	1	16544	16544		92.856	36.306	1	57965000			263	321;442;322	157	162	372	372		9606
AVDTDMIDYEK	11	Oxidation (M)	_AVDTDM(Oxidation (M))IDYEK_	AVDTDM(1)IDYEK	AVDTDM(59)IDYEK	0	1	0	O75356	O75356	O75356	ENTPD5	Ectonucleoside triphosphate diphosphohydrolase 5	MSMS	DP1141_6	1	439.0042419433594	3	439.195592	1314.56495	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.149	1	19.149	18.649	19.649	0								0	0	0	0.033382	1	12100	12100		59.067	40.395	1				264	72	158	163	373	373	56	9606
AVFPSIVGR	9	Unmodified	_AVFPSIVGR_			0	0	0	P60709;Q6S8J3;P68133;P68032;A5A3E0;P63267;P62736;P0CG38;P63261	P60709;P63261	P60709	ACTB;POTEE;ACTA1;ACTC1;POTEF;ACTG2;ACTA2;POTEI;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;POTE ankyrin domain family member E;Actin, alpha skeletal muscle;Actin, alpha cardiac muscle 1;POTE ankyrin domain family member F;Actin, gamma-enteric smooth muscle;Actin, aortic smooth muscle;POTE ankyrin domain family member I;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	MULTI-MSMS	DP1141_10	5	473.2796630859375	2	473.279452	944.544351	0.60652	0.00028706	0.03594	1.7009E-05	0.64246	0.00030406	473.27941306255786	19.027	0.69	19.027	18.487	19.177	0					13	6	3	0	0	0	0.0067275	1	12976	12976		116.9	65.568	1	65142000			265	277;318	159	164	374	374		9606
AVFPSIVGR	9	Unmodified	_AVFPSIVGR_			0	0	0	P60709;Q6S8J3;P68133;P68032;A5A3E0;P63267;P62736;P0CG38;P63261	P60709;P63261	P60709	ACTB;POTEE;ACTA1;ACTC1;POTEF;ACTG2;ACTA2;POTEI;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;POTE ankyrin domain family member E;Actin, alpha skeletal muscle;Actin, alpha cardiac muscle 1;POTE ankyrin domain family member F;Actin, gamma-enteric smooth muscle;Actin, aortic smooth muscle;POTE ankyrin domain family member I;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	MULTI-MSMS	DP1141_6	1	473.2799377441406	2	473.279452	944.544351	0.43753	0.00020708	0.54187	0.00025645	0.9794	0.00046353	473.2795509382527	19.055	0.60078	19.055	18.705	19.305	0					9	5	2	0	0	0	0.0067275	1	11970	11970		116.9	73.989	1	43908000			266	277;318	159	164	375	375		9606
AVFPSIVGR	9	Unmodified	_AVFPSIVGR_			0	0	0	P60709;Q6S8J3;P68133;P68032;A5A3E0;P63267;P62736;P0CG38;P63261	P60709;P63261	P60709	ACTB;POTEE;ACTA1;ACTC1;POTEF;ACTG2;ACTA2;POTEI;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;POTE ankyrin domain family member E;Actin, alpha skeletal muscle;Actin, alpha cardiac muscle 1;POTE ankyrin domain family member F;Actin, gamma-enteric smooth muscle;Actin, aortic smooth muscle;POTE ankyrin domain family member I;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	MULTI-MSMS	DP1141_7	2	473.2797546386719	2	473.279452	944.544351	0.27973	0.00013239	0.29597	0.00014008	0.5757	0.00027247	473.2795359344309	19	0.50041	19	18.65	19.15	0					7	4	2	0	0	0	0.0017001	1	12655	12655		125.81	67.21	1	81828000			267	277;318	159	164	376	376		9606
AVFPSIVGR	9	Unmodified	_AVFPSIVGR_			0	0	0	P60709;Q6S8J3;P68133;P68032;A5A3E0;P63267;P62736;P0CG38;P63261	P60709;P63261	P60709	ACTB;POTEE;ACTA1;ACTC1;POTEF;ACTG2;ACTA2;POTEI;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;POTE ankyrin domain family member E;Actin, alpha skeletal muscle;Actin, alpha cardiac muscle 1;POTE ankyrin domain family member F;Actin, gamma-enteric smooth muscle;Actin, aortic smooth muscle;POTE ankyrin domain family member I;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	MULTI-MSMS	DP1141_8	3	473.2796325683594	2	473.279452	944.544351	0.59228	0.00028032	-0.1749	-8.2777E-05	0.41738	0.00019754	473.27933791580546	19.026	0.50012	19.026	18.675	19.175	0					11	4	4	0	0	0	0.0027382	1	12421	12421		124.59	81.471	1	38568000			268	277;318	159	164	377	377		9606
AVFVDLEPTVIDEIR	15	Unmodified	_AVFVDLEPTVIDEIR_			0	0	0	P68366	P68366	P68366	TUBA4A	Tubulin alpha-4A chain	MULTI-MSMS	DP1141_6	1	858.4653930664062	2	858.464352	1714.91415	1.1858	0.0010179	-0.38108	-0.00032714	0.80468	0.00069079	858.4642243643154	22.394	0.1719	22.394	22.254	22.426	0					4	2	2	0	0	0	0.0092522	1	17097	17097		106.26	58.07	1	6293700			269	322	160	165	378	378		9606
AVFVDLEPTVIDEVR	15	Unmodified	_AVFVDLEPTVIDEVR_			0	0	0	P68363;Q71U36	P68363;Q71U36	P68363	TUBA1B;TUBA1A	Tubulin alpha-1B chain;Tubulin alpha-1A chain	MULTI-MSMS	DP1141_10	5	851.4571533203125	2	851.456527	1700.8985	0.52509	0.00044709	-0.15831	-0.00013479	0.36678	0.0003123	851.4565192486621	21.809	0.39969	21.809	21.559	21.959	0					7	3	3	0	0	0	0.027434	1	17176	17176		65.232	19.324	1	77431000			270	321;442	161	166	379	379		9606
AVIGIGIEEEDRK	13	Unmodified	_AVIGIGIEEEDRK_			0	0	1	O94906	O94906	O94906	PRPF6	Pre-mRNA-processing factor 6	MSMS	DP1141_7	2	476.6243591308594	3	476.927946	1427.76201	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.211	1	17.211	16.711	17.711	0								0	0	0	0.0030808	1	9619	9619		131.12	101.81	1				271	86	162	167	380	380		9606
AVLCPPPVK	9	Unmodified	_AVLCPPPVK_			0	0	0	P63000;P60763	P63000	P63000	RAC1;RAC3	Ras-related C3 botulinum toxin substrate 1;Ras-related C3 botulinum toxin substrate 3	MULTI-SECPEP	DP1141_10	5	490.24273681640625	2	490.783513	979.552473	0.47852	0.00023485	-0.69574	-0.00034146	-0.21722	-0.00010661	490.78316783998065	16.316	0.29744	16.316	16.066	16.363	0					4	2	2	0	0	0	0.01306	1	8507	8507		105.2	28.723	1	5722400			272	278	163	168	381	381		9606
AVLNNVIFCHQEDSNWPLSEGK	22	Unmodified	_AVLNNVIFCHQEDSNWPLSEGK_			0	0	0	Q92878	Q92878	Q92878	RAD50	DNA repair protein RAD50	MULTI-MSMS	DP1141_7	2	853.0767822265625	3	853.076184	2556.20672	0.70385	0.00060044	-0.49387	-0.00042131	0.20998	0.00017913	853.4099409872878	20.728	0.3996	20.728	20.451	20.85	0					12	3	4	0	0	0	0.0029522	1	15132	15132		67.655	43.244	1	18710000			273	497	164	169	382	382		9606
AVLQPSINEEIQTVFNK	17	Unmodified	_AVLQPSINEEIQTVFNK_			0	0	0	Q9H147	Q9H147	Q9H147	DNTTIP1	Deoxynucleotidyltransferase terminal-interacting protein 1	MULTI-MSMS	DP1141_9	4	966.020751953125	2	965.517647	1929.02074	0.4132	0.00039896	1.7178	0.0016586	2.131	0.0020576	966.021153544581	21.762	0.58066	21.762	21.538	22.119	0					13	5	4	0	0	0	7.8394E-10	1	16575	16575		158.04	87.1	1	5650600			274	555	165	170	383	383		9606
AVNYVGAGTVEFIMDSK	17	Oxidation (M)	_AVNYVGAGTVEFIM(Oxidation (M))DSK_	AVNYVGAGTVEFIM(1)DSK	AVNYVGAGTVEFIM(130)DSK	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	909.4444580078125	2	908.942927	1815.8713	0.23173	0.00021063	-0.017602	-1.5999E-05	0.21413	0.00019463	909.4445414988617	20.14	0.48367	20.14	19.906	20.39	0					15	4	6	0	0	0	0.030309	1	13789	13789		132.31	101.42	1	39147000			275	521	166	171	384	384	369	9606
AVNYVGAGTVEFIMDSK	17	Oxidation (M)	_AVNYVGAGTVEFIM(Oxidation (M))DSK_	AVNYVGAGTVEFIM(1)DSK	AVNYVGAGTVEFIM(140)DSK	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_7	2	909.798828125	2	908.942927	1815.8713	0.60251	0.00054764	-0.37687	-0.00034256	0.22563	0.00020509	908.942771759284	20.2	0.30053	20.2	19.95	20.251	0					8	2	4	0	0	0	0.026854	1	14284	14284		135.91	87.797	1	53455000			276	521	166	171	385	385	369	9606
AVNYVGAGTVEFIMDSK	17	Oxidation (M)	_AVNYVGAGTVEFIM(Oxidation (M))DSK_	AVNYVGAGTVEFIM(1)DSK	AVNYVGAGTVEFIM(170)DSK	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	908.9431762695312	2	908.942927	1815.8713	0.32703	0.00029725	-0.13506	-0.00012276	0.19197	0.00017449	908.9431344124512	20.226	0.80105	20.226	19.676	20.477	0					19	7	5	0	0	0	1.1188999999999999E-22	3	14182	14056;14182;14194		171.36	111.06	1	343580000			277	521	166	171	386;387;388	387	369	9606
AVNYVGAGTVEFIMDSK	17	Oxidation (M)	_AVNYVGAGTVEFIM(Oxidation (M))DSK_	AVNYVGAGTVEFIM(1)DSK	AVNYVGAGTVEFIM(83)DSK	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	606.2977294921875	3	606.29771	1815.8713	0.40872	0.0002478	0.061001	3.6985E-05	0.46972	0.00028479	606.2979036305013	20.226	0.50017	20.226	19.777	20.277	0					9	4	4	0	0	0	0.0037289	1	14206	14206		82.877	57.059	1	90970000			278	521	166	171	389	389	369	9606
AVNYVGAGTVEFIMDSK	17	Oxidation (M)	_AVNYVGAGTVEFIM(Oxidation (M))DSK_	AVNYVGAGTVEFIM(1)DSK	AVNYVGAGTVEFIM(140)DSK	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MSMS	DP1141_9	4	908.7962646484375	2	908.942927	1815.8713	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.128	1	20.128	19.628	20.628	0								0	0	0	1.8754E-07	1	14057	14057		137.81	97.23	1				279	521	166	171	390	390	369	9606
AVPKEDIYSGGGGGGSR	17	Unmodified	_AVPKEDIYSGGGGGGSR_			0	0	1	Q13151	Q13151	Q13151	HNRNPA0	Heterogeneous nuclear ribonucleoprotein A0	MULTI-SECPEP	DP1141_9	4	535.7816162109375	3	536.265509	1605.7747	0.66987	0.00035923	-0.46012	-0.00024675	0.20975	0.00011248	536.2652064909669	14.933	0.37902	14.933	14.795	15.174	0					5	3	2	0	0	0	0.017125	1	5689	5689		80.361	59.112	1	39980000			280	369	167	172	391	391		9606
AVSILPLLGHGVPR	14	Unmodified	_AVSILPLLGHGVPR_			0	0	0	Q9Y2W2	Q9Y2W2	Q9Y2W2	WBP11	WW domain-binding protein 11	MULTI-MSMS	DP1141_7	2	477.27691650390625	3	476.961033	1427.86127	0.77983	0.00037195	2.6057	0.0012428	3.3855	0.0016148	476.96251269901967	20.301	0.60064	20.301	19.75	20.351	0					6	5	2	0	0	0	0.0098966	1	14290	14290		78.903	46.287	1	10098000			281	613	168	173	392	392		9606
AVSILPLLGHGVPR	14	Unmodified	_AVSILPLLGHGVPR_			0	0	0	Q9Y2W2	Q9Y2W2	Q9Y2W2	WBP11	WW domain-binding protein 11	MULTI-MSMS	DP1141_9	4	477.2582092285156	3	476.961033	1427.86127	0.45695	0.00021795	-0.44908	-0.0002142	0.0078623	3.75E-06	476.9606390537634	20.193	0.3993	20.193	20.037	20.437	0					9	3	4	0	0	0	0.014379	1	14148	14148		69.864	43.205	1	11189000			282	613	168	173	393	393		9606
AVSKPSRPDMNPIR	14	Oxidation (M)	_AVSKPSRPDM(Oxidation (M))NPIR_	AVSKPSRPDM(1)NPIR	AVSKPSRPDM(81)NPIR	0	1	2	Q8N1G2	Q8N1G2	Q8N1G2	CMTR1	Cap-specific mRNA (nucleoside-2-O-)-methyltransferase 1	MULTI-MSMS	DP1141_6	1	528.6158447265625	3	528.615596	1582.82496	0.77792	0.00041122	-0.39844	-0.00021062	0.37947	0.0002006	528.9496051548256	13.696	0.62386	13.696	13.112	13.736	0					10	6	2	0	0	0	0.020055	1	3593	3593		80.69	55.369	1	769360			283	468	169	174	394	394	347	9606
AVTEQGHELSNEER	14	Unmodified	_AVTEQGHELSNEER_			0	0	0	P31946	P31946	P31946	YWHAB	14-3-3 protein beta/alpha;14-3-3 protein beta/alpha, N-terminally processed	MULTI-MSMS	DP1141_10	5	533.5853881835938	3	533.585019	1597.73323	0.015034	8.0218E-06	0.39746	0.00021208	0.41249	0.0002201	533.585212035499	14.056	0.2869	14.056	13.928	14.215	0					6	4	2	0	0	0	0.003447	1	4955	4955		107.37	81.007	1	29763000			284	201	170	175	395	395		9606
AVVGDAQYHHFR	12	Unmodified	_AVVGDAQYHHFR_			0	0	0	P47929	P47929	P47929	LGALS7	Galectin-7	MULTI-SECPEP	DP1141_10	5	466.9047546386719	3	467.233704	1398.67928	-0.022138	-1.0344E-05	0.8335	0.00038944	0.81137	0.0003791	467.2342115351582	14.995	0.31391	14.995	14.806	15.12	0					7	3	3	0	0	0	0.0030995	1	6293	6293		113.69	83.683	1	12156000			285	240	171	176	396	396		9606
AVVGVVAGGGR	11	Unmodified	_AVVGVVAGGGR_			0	0	0	P62917	P62917	P62917	RPL8	60S ribosomal protein L8	MULTI-MSMS	DP1141_10	5	471.9827575683594	2	471.279983	940.545414	0.1183	5.5755E-05	0.15615	7.359E-05	0.27445	0.00012934	471.280155461502	15.415	0.48859	15.415	15.12	15.609	0					7	5	2	0	0	0	0.0038278	1	6998	6998		129.68	79.556	1	53076000			286	314	172	177	397	397		9606
AVVIVDDR	8	Unmodified	_AVVIVDDR_			0	0	0	Q15233;P23246	Q15233;P23246	P23246	NONO;SFPQ	Non-POU domain-containing octamer-binding protein;Splicing factor, proline- and glutamine-rich	MSMS	DP1141_10	5	443.7627868652344	2	443.753267	885.491981	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.919	1	15.919	15.419	16.419	0								0	0	0	0.033002	1	7848	7848		127.12	69.665	1				287	181;401	173	178	398	398		9606
AVVIVDDR	8	Unmodified	_AVVIVDDR_			0	0	0	Q15233;P23246	Q15233;P23246	P23246	NONO;SFPQ	Non-POU domain-containing octamer-binding protein;Splicing factor, proline- and glutamine-rich	MULTI-MSMS	DP1141_7	2	443.75341796875	2	443.753267	885.491981	0.54925	0.00024373	-0.002506	-1.112E-06	0.54674	0.00024262	443.75328795580646	15.953	0.60023	15.953	15.714	16.315	0					11	5	3	0	0	0	0.0049658	1	7618	7618		116.88	52.107	1	134200000			288	181;401	173	178	399	399		9606
AVVIVDDR	8	Unmodified	_AVVIVDDR_			0	0	0	Q15233;P23246	Q15233;P23246	P23246	NONO;SFPQ	Non-POU domain-containing octamer-binding protein;Splicing factor, proline- and glutamine-rich	MULTI-MSMS	DP1141_9	4	443.7710876464844	2	443.753267	885.491981	-0.17277	-7.6665E-05	0.29905	0.0001327	0.12628	5.6037E-05	443.7534158755535	15.922	0.68543	15.922	15.673	16.358	0					10	6	2	0	0	0	5.7085E-06	1	7391	7391		133.81	82.24	1	99652000			289	181;401	173	178	400	400		9606
AVVKTPSR	8	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))AVVKTPSR_			1	0	1	Q4G0U5	Q4G0U5	Q4G0U5	CFAP221	Cilia- and flagella-associated protein 221	MULTI-SECPEP	DP1141_10	5	450.28729248046875	2	450.269084	898.523616	-0.70203	-0.0003161	-1.7912	-0.00080653	-2.4933	-0.0011226	450.26829478657686	17.738	0.89967	17.738	17.387	18.287	0					12	8	2	0	0	0	0.016671	1	10557	10557		88.643	28.349	1	109670000			290	416	174	179	401	401		9606
AVVMDLLR	8	Unmodified	_AVVMDLLR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	916.9700317382812	1	916.528449	915.521173	0.16407	0.00015038	0.3171	0.00029063	0.48117	0.00044101	916.5288609515278	20.035	0.28456	20.035	19.806	20.09	0					6	2	3	0	0	0	3.8841E-30	1	13399	13399		182.13	68.103	1	6517200			291	367	175	180	402	402		9606
AVVMDLLR	8	Unmodified	_AVVMDLLR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MSMS	DP1141_6	1	458.7680358886719	2	458.767863	915.521173	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.042	1	20.042	19.542	20.542	0								0	0	0	0.027111	1	13478	13478		130.04	67.324	1				292	367	175	180	403	403		9606
AVVVCPKDEDYK	12	Unmodified	_AVVVCPKDEDYK_			0	0	1	Q00839	Q00839	Q00839	HNRNPU	Heterogeneous nuclear ribonucleoprotein U	MSMS	DP1141_6	1	474.90057373046875	3	474.902632	1421.68607	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.117	1	15.117	14.617	15.617	0								0	0	0	0.029564	1	5588	5588		91.313	57.443	1				293	337	176	181	404	404		9606
AVVVCPKDEDYKQR	14	Unmodified	_AVVVCPKDEDYKQR_			0	0	2	Q00839	Q00839	Q00839	HNRNPU	Heterogeneous nuclear ribonucleoprotein U	MULTI-SECPEP	DP1141_7	2	427.1877746582031	4	427.468715	1705.84575	0.46291	0.00019788	-0.39808	-0.00017017	0.064826	2.7711E-05	427.719357782477	14.458	0.3979	14.458	14.21	14.608	0					7	3	3	0	0	0	0.003805	1	5202	5202		101.72	79.226	1	8993000			294	337	177	182	405	405		9606
AWEDWAIYPEPFLIK	15	Unmodified	_AWEDWAIYPEPFLIK_			0	0	0	O15042	O15042	O15042	U2SURP	U2 snRNP-associated SURP motif-containing protein	MULTI-MSMS	DP1141_7	2	939.9791259765625	2	939.477263	1876.93997	0.41741	0.00039215	-0.39331	-0.0003695	0.024107	2.2648E-05	939.9783304363906	24.285	0.23889	24.285	24.164	24.403	0					4	2	2	0	0	0	0.016798	1	20496	20496		99.215	61.194	1	5565800			295	49	178	183	406	406		9606
AYGGAYDVMSSK	12	Oxidation (M)	_AYGGAYDVM(Oxidation (M))SSK_	AYGGAYDVM(1)SSK	AYGGAYDVM(110)SSK	0	1	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_10	5	632.77978515625	2	632.779353	1263.54415	-0.58465	-0.00036996	1.1411	0.00072208	0.55648	0.00035213	632.7800755253018	15.506	0.24092	15.506	15.368	15.609	0					6	2	3	0	0	0	0.025485	1	7253	7253		110.38	88.531	1	23122000			296	111	179	184	407	407	100	9606
AYHEQLSVAEITNACFEPANQMVK	24	Oxidation (M)	_AYHEQLSVAEITNACFEPANQM(Oxidation (M))VK_	AYHEQLSVAEITNACFEPANQM(1)VK	AYHEQLSVAEITNACFEPANQM(200)VK	0	1	0	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_8	3	922.4244384765625	3	922.76691	2765.2789	0.3998	0.00036892	-0.17824	-0.00016447	0.22156	0.00020445	922.7667738984954	19.454	0.30078	19.454	19.275	19.576	0					8	2	4	0	0	0	7.6402E-85	2	13029	13029;13077		200.23	185.21	1	23059000			297	321;442;322	180	185	408;409	408	246	9606
AYIAYELNSVQHR	13	Unmodified	_AYIAYELNSVQHR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	522.5978393554688	3	521.935323	1562.78414	1.1165	0.00058274	-0.42113	-0.0002198	0.69537	0.00036294	521.9351993150926	17.955	0.49998	17.955	17.705	18.205	0					11	4	4	0	0	0	7.2292E-67	2	10050	9830;10050		202.31	152.88	1	213090000			298	367	181	186	410;411	411		9606
AYIAYELNSVQHR	13	Unmodified	_AYIAYELNSVQHR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	782.892333984375	2	782.399347	1562.78414	0.62939	0.00049244	0.52469	0.00041051	1.1541	0.00090295	782.3996851002173	17.955	0.3001	17.955	17.705	18.005	0					4	2	2	0	0	0	1.4143999999999999E-66	2	10095	10095;10235		200.71	151.65	1	53448000			299	367	181	186	412;413	412		9606
AYVEANQMLGDLIK	14	Oxidation (M)	_AYVEANQM(Oxidation (M))LGDLIK_	AYVEANQM(1)LGDLIK	AYVEANQM(100)LGDLIK	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	790.9036865234375	2	790.903073	1579.79159	0.0024882	1.9679E-06	0.58364	0.0004616	0.58613	0.00046357	790.9036690586245	19.456	0.30027	19.456	19.305	19.606	0					8	2	4	0	0	0	0.026943	1	12757	12757		103.08	75.219	1	24056000			300	142	182	187	414	414	136	9606
AYVEANQMLGDLIK	14	Oxidation (M)	_AYVEANQM(Oxidation (M))LGDLIK_	AYVEANQM(1)LGDLIK	AYVEANQM(92)LGDLIK	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	790.9036865234375	2	790.903073	1579.79159	0.64185	0.00050764	-0.22409	-0.00017724	0.41776	0.0003304	790.9031227344747	19.526	0.30078	19.526	19.275	19.576	0					6	2	3	0	0	0	0.033397	2	13170	12958;13170		91.936	59.203	1	36674000			301	142	182	187	415;416	416	136	9606
AYVWDNNK	8	Unmodified	_AYVWDNNK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	505.24114990234375	2	505.240524	1008.46649	-0.027911	-1.4102E-05	0.63311	0.00031987	0.6052	0.00030577	505.24076594089297	17.118	0.31236	17.118	16.891	17.204	0					5	3	2	0	0	0	0.011111	1	8865	8865		102.71	56.288	1	15728000			302	367	183	188	417	417		9606
AYVWDNNKDLAEWLEK	16	Unmodified	_AYVWDNNKDLAEWLEK_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MSMS	DP1141_10	5	665.1539306640625	3	665.326657	1992.95814	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.554	1	21.554	21.054	22.054	0								0	0	0	0.0083902	1	16753	16753		117.13	70.813	1				303	367	184	189	418	418		9606
CGGGTQSRK	9	Unmodified	_CGGGTQSRK_			0	0	1	Q9C0I4	Q9C0I4	Q9C0I4	THSD7B	Thrombospondin type-1 domain-containing protein 7B	MULTI-MSMS	DP1141_6	1	950.4097900390625	1	950.447239	949.439962	0.21888	0.00020804	3.4361	0.0032658	3.655	0.0034739	950.4502205147652	20.241	0.68343	20.241	19.998	20.682	0					9	6	2	0	0	0	0.019658	1	14007	14007		57.177	7.9667	1	6017000			304	549	185	190	419	419		9606
CGLPLFYQSQPK	12	Unmodified	_CGLPLFYQSQPK_			0	0	0	Q9H5V9	Q9H5V9	Q9H5V9	CXorf56	UPF0428 protein CXorf56	MULTI-MSMS	DP1141_10	5	720.3397827148438	2	719.363387	1436.71222	1.673	0.0012035	1.8287	0.0013155	3.5017	0.002519	719.3655731885465	19.841	0.7001	19.841	19.476	20.176	0					10	6	3	0	0	0	0.020435	1	14294	14294		79.974	38.98	1	9546400			305	562	186	191	420	420		9606
CIGKPGGSLDNSEQK	15	Unmodified	_CIGKPGGSLDNSEQK_			0	0	1	Q9Y5L4	Q9Y5L4	Q9Y5L4	TIMM13	Mitochondrial import inner membrane translocase subunit Tim13	MULTI-MSMS	DP1141_10	5	530.5913696289062	3	530.591116	1588.75152	0.088105	4.6748E-05	0.032576	1.7285E-05	0.12068	6.4032E-05	530.5913567902378	14.124	0.51517	14.124	13.824	14.339	0					22	8	6	0	0	0	2.6285999999999997E-21	2	4981	4910;4981		162.64	136.39	1	78711000			306	621	187	192	421;422	422		9606
CLAAEDVVFIGPDTHAIQAMGDKIESK	27	Oxidation (M)	_CLAAEDVVFIGPDTHAIQAM(Oxidation (M))GDKIESK_	CLAAEDVVFIGPDTHAIQAM(1)GDKIESK	CLAAEDVVFIGPDTHAIQAM(130)GDKIESK	0	1	1	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_8	3	734.3480224609375	4	733.611125	2930.41539	0.67177	0.00049282	-0.22294	-0.00016355	0.44884	0.00032927	734.1125200636778	19.396	0.49986	19.396	18.976	19.476	0					9	4	4	0	0	0	3.2949E-12	1	13007	13007		127.96	104.04	1	49674000			307	110	188	193	423	423	93	9606
CLAAEDVVFIGPDTHAIQAMGDKIESK	27	Unmodified	_CLAAEDVVFIGPDTHAIQAMGDKIESK_			0	0	1	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-SECPEP	DP1141_8	3	729.0708618164062	4	729.612396	2914.42048	0.38289	0.00027936	0.26746	0.00019514	0.65036	0.00047451	729.8631826008447	20.803	0.30009	20.803	20.578	20.878	0					8	2	4	0	0	0	0.0033408	1	15043	15043		58.284	37.606	1	10833000			308	110	188	194	424	424		9606
CLLLHPAGHAEPAAGSHR	18	Unmodified	_CLLLHPAGHAEPAAGSHR_			0	0	0	Q96S55	Q96S55	Q96S55	WRNIP1	ATPase WRNIP1	MULTI-MSMS	DP1141_8	3	474.237548828125	4	474.242972	1892.94278	0.48757	0.00023122	0.21725	0.00010303	0.70482	0.00033426	474.4938435831436	14.822	0.39757	14.822	14.674	15.072	0					6	3	2	0	0	0	0.010081	1	5763	5763		55.864	34.024	1	15303000			309	522	189	195	425	425		9606
CLPPSEAASDNHLK	14	Unmodified	_CLPPSEAASDNHLK_			0	0	0	Q14241	Q14241	Q14241	TCEB3	Transcription elongation factor B polypeptide 3	MULTI-MSMS	DP1141_7	2	513.9208374023438	3	513.58044	1537.71949	-0.14385	-7.388E-05	1.3864	0.00071201	1.2425	0.00063813	513.5817585262103	14.658	0.60114	14.658	14.508	15.109	0					7	5	2	0	0	0	0.012773	1	5597	5597		73.219	44.004	1	8726200			310	385	190	196	426	426		9606
CNFESNFPR	9	Unmodified	_CNFESNFPR_			0	0	0	Q96JM3	Q96JM3	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	MULTI-SECPEP	DP1141_7	2	585.8955688476562	2	585.753472	1169.49239	0.73245	0.00042903	-0.4351	-0.00025486	0.29734	0.00017417	585.7533800619416	17.699	0.2996	17.699	17.549	17.849	0					4	2	2	0	0	0	0.018265	1	10542	10542		127.46	127.46	1	23385000			311	514	191	197	427	427		9606
CPFTGNVSIR	10	Unmodified	_CPFTGNVSIR_			0	0	0	P62280	P62280	P62280	RPS11	40S ribosomal protein S11	MULTI-MSMS	DP1141_10	5	576.3247680664062	2	575.787315	1149.56008	0.044751	2.5767E-05	-0.03816	-2.1972E-05	0.0065907	3.7948E-06	575.7875088746466	17.538	0.40055	17.538	17.187	17.588	0					10	3	4	0	0	0	0.0025628	1	10451	10451		141.52	61.058	1	31805000			312	295	192	198	428	428		9606
CSDSDGLAPPQHLIR	15	Unmodified	_CSDSDGLAPPQHLIR_			0	0	0	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MULTI-MSMS	DP1141_8	3	556.3075561523438	3	555.938628	1664.79405	0.13474	7.4908E-05	-0.0092984	-5.1693E-06	0.12544	6.9739E-05	555.9386984277181	17.023	0.5737	17.023	16.9	17.474	0					12	5	4	0	0	0	0.026167	1	9376	9376		70.622	55.235	1	73486000			313	104	193	199	429	429		9606
CSDSDGLAPPQHLIR	15	Unmodified	_CSDSDGLAPPQHLIR_			0	0	0	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MULTI-MSMS	DP1141_9	4	556.2733764648438	3	555.938628	1664.79405	0.46628	0.00025922	-0.36118	-0.00020079	0.1051	5.843E-05	555.9384725110705	17.088	0.44116	17.088	16.896	17.338	0					12	4	4	0	0	0	0.00076786	1	9327	9327		105	86.899	1	132250000			314	104	193	199	430	430		9606
CTGGEVGATSALAPK	15	Unmodified	_CTGGEVGATSALAPK_			0	0	0	P30050	P30050	P30050	RPL12	60S ribosomal protein L12	MULTI-MSMS	DP1141_10	5	710.2831420898438	2	709.850841	1417.68713	1.2099	0.00085886	-0.79539	-0.00056461	0.41453	0.00029425	709.8502952291262	16.116	0.46911	16.116	15.697	16.166	0					7	4	3	0	0	0	2.3146E-05	1	8146	8146		151.13	111.58	1	27631000			315	197	194	200	431	431		9606
CVACETPKPGTCVK	14	Unmodified	_CVACETPKPGTCVK_			0	0	1	P49790	P49790	P49790	NUP153	Nuclear pore complex protein Nup153	MULTI-MSMS	DP1141_7	2	536.5858154296875	3	536.251049	1605.73132	0.44778	0.00024012	-0.40494	-0.00021715	0.042841	2.2973E-05	536.2512288959823	14.162	0.43062	14.162	13.78	14.21	0					16	4	5	0	0	0	0.0043512	3	4775	4615;4680;4775		161.25	132.3	1	74639000			316	252	195	201	432;433;434	434		9606
CVIFEIPGAPDDEAVR	16	Unmodified	_CVIFEIPGAPDDEAVR_			0	0	0	Q96I25	Q96I25	Q96I25	RBM17	Splicing factor 45	MULTI-SECPEP	DP1141_8	3	894.7982788085938	2	894.435269	1786.85598	0.44349	0.00039667	1.4459	0.0012932	1.8894	0.0016899	894.9370580419733	21.228	0.60096	21.228	20.778	21.379	0					9	5	3	0	0	0	3.2107E-06	1	15721	15721		125.54	82.739	1	48195000			317	513	196	202	435	435		9606
CYLFGGLANDSEDPKNNIPR	20	Unmodified	_CYLFGGLANDSEDPKNNIPR_			0	0	1	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-MSMS	DP1141_7	2	761.3700561523438	3	760.695303	2279.06408	0.69924	0.00053191	-1.0615	-0.00080747	-0.36225	-0.00027556	761.0289505156529	19.501	0.2998	19.501	19.35	19.65	0					6	2	3	0	0	0	0.012729	1	13255	13255		88.551	71.936	1	17514000			318	259	197	203	436	436		9606
DAANLAKEKQR	11	Unmodified	_DAANLAKEKQR_			0	0	2	O43150	O43150	O43150	ASAP2	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2	MULTI-SECPEP	DP1141_8	3	621.8565673828125	2	622.341301	1242.66805	0.52851	0.00032891	3.9425	0.0024536	4.471	0.0027825	622.3436682008395	19.726	0.50144	19.726	19.275	19.777	0					7	4	2	0	0	0	0.0094561	1	13135	13135		98.582	45.089	1	57331000			319	55	198	204	437	437		9606
DAEAWFNEK	9	Unmodified	_DAEAWFNEK_			0	0	0	CON__P13645;P13645;Q7Z3Y7;CON__Q148H6;CON__Q7Z3Y7;CON__Q7Z3Y8;CON__Q7Z3Z0;Q7Z3Y8;Q7Z3Z0	CON__P13645	CON__P13645	KRT10;KRT28;KRT27;KRT25	Keratin, type I cytoskeletal 10;Keratin, type I cytoskeletal 28;Keratin, type I cytoskeletal 27;Keratin, type I cytoskeletal 25	MULTI-MSMS	DP1141_7	2	555.7774658203125	2	555.248546	1108.48254	-0.017275	-9.5919E-06	0.54146	0.00030064	0.52418	0.00029105	555.2488585521435	19.3	0.30043	19.3	19.15	19.451	0					4	2	2	0	0	0	2.1455E-05	1	12927	12927		149.82	106.01	1	190900000		+	320	17	199	205	438	438		9606
DAEAWFNEK	9	Unmodified	_DAEAWFNEK_			0	0	0	CON__P13645;P13645;Q7Z3Y7;CON__Q148H6;CON__Q7Z3Y7;CON__Q7Z3Y8;CON__Q7Z3Z0;Q7Z3Y8;Q7Z3Z0	CON__P13645	CON__P13645	KRT10;KRT28;KRT27;KRT25	Keratin, type I cytoskeletal 10;Keratin, type I cytoskeletal 28;Keratin, type I cytoskeletal 27;Keratin, type I cytoskeletal 25	MULTI-MSMS	DP1141_9	4	555.2761840820312	2	555.248546	1108.48254	0.50769	0.0002819	-0.041728	-2.3169E-05	0.46597	0.00025873	555.2485142960859	19.288	0.30057	19.288	19.138	19.438	0					4	2	2	0	0	0	3.7116E-29	2	12767	12767;12941		178.3	127.59	1	77690000		+	321	17	199	205	439;440	439		9606
DAEDVDLNHYR	11	Unmodified	_DAEDVDLNHYR_			0	0	0	Q15435	Q15435	Q15435	PPP1R7	Protein phosphatase 1 regulatory subunit 7	MULTI-MSMS	DP1141_9	4	674.3175659179688	2	673.802205	1345.58986	0.35698	0.00024054	-0.41526	-0.00027981	-0.058279	-3.9269E-05	673.8018597289228	16.569	0.33448	16.569	16.358	16.693	0					6	3	2	0	0	0	4.6929999999999996E-66	1	8392	8392		200.05	154.89	1	10728000			322	404	200	206	441	441		9606
DAEEWFFTK	9	Unmodified	_DAEEWFFTK_			0	0	0	CON__P02533;P02533;CON__Q6IFX2	CON__P02533	CON__P02533	KRT14	Keratin, type I cytoskeletal 14	MULTI-MSMS	DP1141_9	4	586.7752075195312	2	586.766571	1171.51859	0.38392	0.00022527	0.25636	0.00015042	0.64028	0.00037569	586.7666866920405	21.488	0.3977	21.488	21.338	21.736	0					5	3	2	0	0	0	4.3238E-21	1	16214	16214		174.52	156.53	1	24142000		+	323	9	201	207	442	442		9606
DAETWFLSK	9	Unmodified	_DAETWFLSK_			0	0	0	CON__P08779;P08779	CON__P08779	CON__P08779	KRT16	Keratin, type I cytoskeletal 16	MULTI-MSMS	DP1141_9	4	549.3200073242188	2	548.769114	1095.52368	0.59577	0.00032694	-0.17073	-9.3691E-05	0.42504	0.00023325	548.7690015681034	20.887	0.50114	20.887	20.636	21.138	0					7	4	2	0	0	0	0.0070169	1	15164	15164		101.72	37.154	1	99355000		+	324	16	202	208	443	443		9606
DAGTIAGLNVMR	12	Oxidation (M)	_DAGTIAGLNVM(Oxidation (M))R_	DAGTIAGLNVM(1)R	DAGTIAGLNVM(110)R	0	1	0	P11021	P11021	P11021	HSPA5	78 kDa glucose-regulated protein	MULTI-MSMS	DP1141_8	3	617.7965087890625	2	617.316437	1232.61832	0.53511	0.00033033	0.018845	1.1633E-05	0.55395	0.00034197	617.3166993255658	18.025	0.40087	18.025	17.674	18.075	0					7	3	3	0	0	0	0.025519	1	10834	10834		107.57	65.239	1	27192000			325	139	203	209	444	444	133	9606
DAGVIAGLNVLR	12	Unmodified	_DAGVIAGLNVLR_			0	0	0	P0DMV8;P0DMV9;P34931	P0DMV8	P0DMV8	HSPA1A;HSPA1B;HSPA1L	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like	MULTI-MSMS	DP1141_8	3	599.8163452148438	2	599.351137	1196.68772	0.39485	0.00023665	0.23367	0.00014005	0.62851	0.0003767	599.3514445354182	20.828	0.60059	20.828	20.678	21.279	0					13	5	3	0	0	0	0.0065066	2	15147	15147;15210		99.013	60.874	1	747510000			326	135	204	210	445;446	445		9606
DAHQSLLATR	10	Unmodified	_DAHQSLLATR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-SECPEP	DP1141_7	2	556.9351806640625	2	556.296362	1110.57817	-0.23387	-0.0001301	0.34508	0.00019197	0.11121	6.1868E-05	556.2965893526828	15.359	0.30214	15.359	15.21	15.512	0					6	2	3	0	0	0	2.3328E-05	1	6692	6692		151.83	104.17	1	541250000			327	142	205	211	447	447		9606
DAKDKLESEMEDAYHEHQANLLR	23	Oxidation (M)	_DAKDKLESEM(Oxidation (M))EDAYHEHQANLLR_	DAKDKLESEM(1)EDAYHEHQANLLR	DAKDKLESEM(52)EDAYHEHQANLLR	0	1	2	P23246	P23246	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	MULTI-MSMS	DP1141_7	2	552.9812622070312	5	552.460561	2757.26642	0.40154	0.00022184	0.16702	9.2274E-05	0.56857	0.00031411	552.6613216761427	17.003	0.313	17.003	16.738	17.051	0					7	3	3	0	0	0	0.0067424	1	9226	9226		51.568	36.562	1	19657000			328	181	206	212	448	448	158	9606
DALSDLALHFLNK	13	Unmodified	_DALSDLALHFLNK_			0	0	0	P50991	P50991	P50991	CCT4	T-complex protein 1 subunit delta	MULTI-MSMS	DP1141_8	3	728.8942260742188	2	728.893366	1455.77218	0.42817	0.00031209	0.88527	0.00064527	1.3134	0.00095736	728.8941100470996	23.199	0.38204	23.199	23.103	23.485	0					7	4	3	0	0	0	0.00081352	1	18713	18713		133.81	75.178	1	27873000			329	258	207	213	449	449		9606
DAPAESVAYHAQNNPPVPPKPQPK	24	Unmodified	_DAPAESVAYHAQNNPPVPPKPQPK_			0	0	1	Q9H2P0	Q9H2P0	Q9H2P0	ADNP	Activity-dependent neuroprotector homeobox protein	MULTI-MSMS	DP1141_7	2	851.768798828125	3	851.434588	2551.28194	0.40881	0.00034808	-0.0173	-1.473E-05	0.39151	0.00033335	851.7686076002556	15.84	0.40283	15.84	15.512	15.914	0					7	3	3	0	0	0	0.025255	1	7483	7483		53.454	32.607	1	14372000			330	559	208	214	450	450		9606
DCQLNAHKDHQYQFLEDAVR	20	Unmodified	_DCQLNAHKDHQYQFLEDAVR_			0	0	1	Q13263	Q13263	Q13263	TRIM28	Transcription intermediary factor 1-beta	MULTI-SECPEP	DP1141_7	2	621.9879760742188	4	622.542203	2486.1397	0.33941	0.0002113	-0.47772	-0.0002974	-0.13831	-8.6103E-05	622.7926082985169	17.999	0.50013	17.999	17.649	18.149	0					7	4	3	0	0	0	2.5156E-09	1	10851	10851		103.9	103.9	1	127780000			331	372	209	215	451	451		9606
DDDIAALVVDNGSGMCK	17	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))DDDIAALVVDNGSGMCK_			1	0	0	P60709	P60709	P60709	ACTB	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed	MULTI-MSMS	DP1141_6	1	911.4036254882812	2	911.403308	1820.79206	0.48133	0.00043868	-1.4	-0.001276	-0.9187	-0.00083731	911.9027564006005	22.666	0.17481	22.666	22.553	22.728	0					5	3	2	0	0	0	0.0012366	1	17553	17553		139.78	115.43	1	3235000			332	277	210	216	452	452		9606
DDDIAALVVDNGSGMCK	17	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))DDDIAALVVDNGSGMCK_			1	0	0	P60709	P60709	P60709	ACTB	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed	MULTI-MSMS	DP1141_9	4	912.43701171875	2	911.403308	1820.79206	0.98992	0.00090221	-1.1246	-0.0010249	-0.13465	-0.00012272	911.9043577184652	22.697	0.19732	22.697	22.582	22.779	0					6	2	3	0	0	0	0.00012237	2	17880	17880;17995		107.65	91.173	1	5405400			333	277	210	216	453;454	453		9606
DDGLFSGDPNWFPK	14	Unmodified	_DDGLFSGDPNWFPK_			0	0	0	P37802	P37802	P37802	TAGLN2	Transgelin-2	MULTI-MSMS	DP1141_10	5	797.8629760742188	2	797.862263	1593.70997	0.74049	0.00059081	-0.002117	-1.6891E-06	0.73837	0.00058912	797.8623017120239	22.799	0.51012	22.799	22.518	23.028	0					17	5	4	0	0	0	7.6369E-30	3	18623	18562;18623;18648		177.44	144.44	1	47443000			334	213	211	217	455;456;457	456		9606
DDGLFSGDPNWFPKK	15	Unmodified	_DDGLFSGDPNWFPKK_			0	0	1	P37802	P37802	P37802	TAGLN2	Transgelin-2	MULTI-MSMS	DP1141_10	5	575.6181030273438	3	574.942255	1721.80494	0.98756	0.00056779	-0.1538	-8.8425E-05	0.83377	0.00047937	574.9421122463075	20.825	0.50019	20.825	20.576	21.076	0					8	4	3	0	0	0	0.01494	1	15777	15777		68.262	29.246	1	10081000			335	213	212	218	458	458		9606
DEALSDGDDLR	11	Unmodified	_DEALSDGDDLR_			0	0	0	Q01831	Q01831	Q01831	XPC	DNA repair protein complementing XP-C cells	MULTI-SECPEP	DP1141_6	1	402.2118835449219	3	402.514201	1204.52077	-0.62079	-0.00024988	-1.2368	-0.00049783	-1.8576	-0.00074771	402.51360148683295	16.635	0.22432	16.635	16.505	16.729	0					4	2	2	0	0	0	0.020617	1	7838	7838		73.885	38.44	1	1893300			336	341	213	219	459	459		9606
DEPIHILNVAIK	12	Unmodified	_DEPIHILNVAIK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	681.393310546875	2	681.393002	1360.77145	1.2443	0.00084789	-0.34155	-0.00023273	0.90279	0.00061516	681.3930626594325	19.756	0.88506	19.756	19.305	20.19	0					15	8	2	0	0	0	3.8307E-66	1	13044	13044		167.93	94.269	1	1113000000			337	367	214	220	460	460		9606
DEPIHILNVAIK	12	Unmodified	_DEPIHILNVAIK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	454.9322204589844	3	454.59776	1360.77145	0.74689	0.00033953	-0.21146	-9.6127E-05	0.53543	0.00024341	454.59774198949617	19.756	0.40017	19.756	19.406	19.806	0					5	3	2	0	0	0	0.008265	1	13054	13054		84.605	46.61	1	255740000			338	367	214	220	461	461		9606
DETEFYLGKR	10	Unmodified	_DETEFYLGKR_			0	0	1	P18077	P18077	P18077	RPL35A	60S ribosomal protein L35a	MULTI-SECPEP	DP1141_10	5	629.7798461914062	2	629.309135	1256.60372	-1.0217	-0.00064298	2.6165	0.0016466	1.5948	0.0010036	629.3102667729484	17.538	0.60044	17.538	17.087	17.688	0					8	5	3	0	0	0	0.014673	1	10575	10575		132.08	89.22	1	16477000			339	166	215	221	462	462		9606
DFFNYLPLSSQDPAPVR	17	Unmodified	_DFFNYLPLSSQDPAPVR_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	983.9910278320312	2	983.48889	1964.96323	0.51952	0.00051094	-0.298	-0.00029308	0.22152	0.00021786	983.9898351361877	22.837	0.57057	22.837	22.475	23.045	0					15	6	5	0	0	0	1.3906000000000001E-167	2	18053	18021;18053		295.26	202.48	1	63161000			340	111	216	222	463;464	464		9606
DFFNYLPLSSQDPAPVR	17	Unmodified	_DFFNYLPLSSQDPAPVR_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	656.3297729492188	3	655.995019	1964.96323	0.99988	0.00065592	-0.48556	-0.00031853	0.51432	0.00033739	656.3289241798739	22.837	0.30737	22.837	22.565	22.872	0					10	3	4	0	0	0	0.027017	1	18083	18083		59.673	37.359	1	12006000			341	111	216	222	465	465		9606
DFFNYLPLSSQDPAPVR	17	Unmodified	_DFFNYLPLSSQDPAPVR_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	983.4900512695312	2	983.48889	1964.96323	0.46897	0.00046123	-0.19741	-0.00019415	0.27157	0.00026708	983.9901952699358	22.829	0.51406	22.829	22.504	23.018	0					11	6	4	0	0	0	1.8127E-15	1	18146	18146		193.81	136.47	1	14921000			342	111	216	222	466	466		9606
DFPYEEDSRPR	11	Unmodified	_DFPYEEDSRPR_			0	0	1	Q96I25	Q96I25	Q96I25	RBM17	Splicing factor 45	MULTI-MSMS	DP1141_8	3	470.8941650390625	3	470.880996	1409.62116	0.05419	2.5517E-05	0.31412	0.00014791	0.36831	0.00017343	470.8811151522379	16.684	0.41046	16.684	16.562	16.973	0					8	4	2	0	0	0	0.025464	1	8699	8699		117.02	104.06	1	42176000			343	513	217	223	467	467		9606
DFPYEEDSRPR	11	Unmodified	_DFPYEEDSRPR_			0	0	1	Q96I25	Q96I25	Q96I25	RBM17	Splicing factor 45	MULTI-SECPEP	DP1141_9	4	705.319091796875	2	705.817855	1409.62116	0.73725	0.00052037	-0.097025	-6.8482E-05	0.64023	0.00045188	705.8178948925258	16.742	0.40352	16.742	16.553	16.957	0					7	5	2	0	0	0	0.013679	1	8710	8710		93.111	67.489	1	18053000			344	513	217	223	468	468		9606
DFTATFGPLDSLNTR	15	Unmodified	_DFTATFGPLDSLNTR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_10	5	828.4522094726562	2	827.907202	1653.79985	0.6261	0.00051835	0.50792	0.00042051	1.134	0.00093886	827.9074823017808	22.009	0.69926	22.009	21.459	22.159	0					11	6	3	0	0	0	0.021214	1	17563	17563		85.522	47.527	1	10729000			345	142	218	224	469	469		9606
DFTATFGPLDSLNTR	15	Unmodified	_DFTATFGPLDSLNTR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	828.9539184570312	2	827.907202	1653.79985	1.2185	0.0010088	-0.19937	-0.00016506	1.0191	0.00084375	827.9069670550781	22.033	0.42909	22.033	21.711	22.14	0					16	5	4	0	0	0	0.026527	1	16671	16671		74.611	58.981	1	49246000			346	142	218	224	470	470		9606
DFTATFGPLDSLNTR	15	Unmodified	_DFTATFGPLDSLNTR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	827.9078369140625	2	827.907202	1653.79985	0.65789	0.00054467	-0.073891	-6.1175E-05	0.584	0.0004835	827.9071823632692	21.997	0.79574	21.997	21.35	22.146	0					22	7	6	0	0	0	1.2126E-161	6	16976	16905;16967;16976;16982;17128;17149		286.86	265.29	1	222240000			347	142	218	224	471;472;473;474;475;476	473		9606
DFTATFGPLDSLNTR	15	Unmodified	_DFTATFGPLDSLNTR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	827.9076538085938	2	827.907202	1653.79985	0.87768	0.00072664	0.034086	2.822E-05	0.91176	0.00075486	827.9072618083457	22.029	0.49954	22.029	21.679	22.179	0					7	4	2	0	0	0	6.6892E-120	1	16846	16846		264.17	235.46	1	88000000			348	142	218	224	477	477		9606
DFTATFGPLDSLNTR	15	Unmodified	_DFTATFGPLDSLNTR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-SECPEP	DP1141_9	4	828.4520263671875	2	827.907202	1653.79985	-0.44244	-0.0003663	0.81133	0.0006717	0.36888	0.0003054	827.9078799728723	22.079	0.86743	22.079	21.338	22.205	0					17	8	4	0	0	0	2.6544E-23	1	16965	16965		160.67	160.67	1	55177000			349	142	218	224	478	478		9606
DFTVASPAEFVTR	13	Unmodified	_DFTVASPAEFVTR_			0	0	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_10	5	720.3618774414062	2	720.361899	1438.70924	1.4999	0.0010805	-0.6174	-0.00044475	0.88251	0.00063572	720.3614341078154	20.825	0.49917	20.825	20.376	20.875	0					9	4	3	0	0	0	0.0054588	1	15624	15624		105.17	64.45	1	48535000			350	367;40	219	225	479	479		9606
DFTVASPAEFVTR	13	Unmodified	_DFTVASPAEFVTR_			0	0	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	720.3619995117188	2	720.361899	1438.70924	0.95465	0.00068769	-0.23948	-0.00017251	0.71516	0.00051518	720.3619210604476	20.812	1.2557	20.812	20.291	21.546	0					24	13	3	0	0	0	1.6788000000000002E-233	3	14319	14319;14422;14715		256.38	182.21	1	615670000			351	367;40	219	225	480;481;482	480		9606
DFTVASPAEFVTR	13	Unmodified	_DFTVASPAEFVTR_			0	0	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	720.4063720703125	2	720.361899	1438.70924	0.58959	0.00042472	0.2758	0.00019867	0.86538	0.00062339	720.3622840615325	20.8	0.69915	20.8	20.451	21.15	0					16	6	4	0	0	0	1.5789E-09	1	15232	15232		159.34	107.89	1	63625000			352	367;40	219	225	483	483		9606
DHAATTAGAASLAGGHHR	18	Unmodified	_DHAATTAGAASLAGGHHR_			0	0	0	P29083	P29083	P29083	GTF2E1	General transcription factor IIE subunit 1	MULTI-MSMS	DP1141_8	3	425.9608154296875	4	425.960746	1699.81388	0.13043	5.5559E-05	-0.20651	-8.7967E-05	-0.076081	-3.2408E-05	425.96077404042444	12.857	0.81431	12.857	12.706	13.52	0					18	8	3	0	0	0	0.013989	1	3096	3096		50.053	39.237	1	1383800			353	194	220	226	484	484		9606
DHAVVVGVYRPPPK	14	Unmodified	_DHAVVVGVYRPPPK_			0	0	1	P22087	P22087	P22087	FBL	rRNA 2-O-methyltransferase fibrillarin	MULTI-MSMS	DP1141_9	4	512.793701171875	3	511.956059	1532.84635	0.057602	2.949E-05	1.6365	0.00083784	1.6941	0.00086733	512.2916871050426	15.559	0.79108	15.559	15.174	15.965	0					14	7	3	0	0	0	0.01635	1	6825	6825		97.957	76.045	1	54990000			354	176	221	227	485	485		9606
DHLPSSPGLLTVGEDMQPK	19	Oxidation (M)	_DHLPSSPGLLTVGEDM(Oxidation (M))QPK_	DHLPSSPGLLTVGEDM(1)QPK	DHLPSSPGLLTVGEDM(49)QPK	0	1	0	A8MUA0	A8MUA0	A8MUA0		Putative UPF0607 protein ENSP00000381514	MULTI-SECPEP	DP1141_9	4	509.6073913574219	4	510.00439	2035.98846	0.13081	6.6712E-05	-2.6837	-0.0013687	-2.5529	-0.001302	510.0031758947429	15.179	0.58409	15.179	14.887	15.471	0					12	5	4	0	0	0	0.021786	1	6068	6068		49.049	14.139	1	7389400			355	4	222	228	486	486	3	9606
DHSVQLPKPVHKPNR	15	Unmodified	_DHSVQLPKPVHKPNR_			0	0	2	Q9NRL2	Q9NRL2	Q9NRL2	BAZ1A	Bromodomain adjacent to zinc finger domain protein 1A	MULTI-MSMS	DP1141_7	2	438.8096923828125	4	438.747048	1750.95909	0.77413	0.00033965	-0.098783	-4.3341E-05	0.67534	0.00029631	438.9976082180074	13.904	0.50653	13.904	13.528	14.035	0					10	5	3	0	0	0	0.00072667	1	4467	4467		93.649	70.738	1	3321100			356	572	223	229	487	487		9606
DIDIHEVR	8	Unmodified	_DIDIHEVR_			0	0	0	Q00839	Q00839	Q00839	HNRNPU	Heterogeneous nuclear ribonucleoprotein U	MULTI-MSMS	DP1141_7	2	499.2955017089844	2	498.759081	995.503609	0.17721	8.8386E-05	0.23524	0.00011733	0.41245	0.00020571	498.75928623242925	15.982	0.60023	15.982	15.714	16.315	0					11	5	4	0	0	0	0.018192	1	7562	7562		98.299	37.338	1	37144000			357	337	224	230	488	488		9606
DIENQYETQITQIEHEVSSSGQEVQSSAK	29	Unmodified	_DIENQYETQITQIEHEVSSSGQEVQSSAK_			0	0	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_6	1	1089.5118408203125	3	1088.84281	3263.50659	0.4132	0.00044991	0.095297	0.00010376	0.5085	0.00055367	1089.177307645558	21.905	0.21349	21.905	21.787	22.001	0					4	2	2	0	0	0	5.6235E-18	1	16444	16444		107.65	78.87	1	12125000		+	358	19	225	231	489	489		9606
DIENQYETQITQIEHEVSSSGQEVQSSAK	29	Unmodified	_DIENQYETQITQIEHEVSSSGQEVQSSAK_			0	0	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_9	4	1089.1805419921875	3	1088.84281	3263.50659	-0.56327	-0.00061332	1.8917	0.0020598	1.3285	0.0014465	1089.179383951181	21.979	0.29303	21.979	21.736	22.029	0					12	2	6	0	0	0	1.2885E-07	1	16861	16861		67.951	38.529	1	8459700		+	359	19	225	231	490	490		9606
DIGEGNLSTAAAAALAAAAVK	21	Unmodified	_DIGEGNLSTAAAAALAAAAVK_			0	0	0	Q8TAQ2	Q8TAQ2	Q8TAQ2	SMARCC2	SWI/SNF complex subunit SMARCC2	MULTI-MSMS	DP1141_7	2	629.3399658203125	3	629.005695	1883.99526	0.3347	0.00021053	0.16563	0.00010418	0.50033	0.00031471	629.005782597629	22.522	0.25333	22.522	22.319	22.572	0					8	2	4	0	0	0	0.028991	1	17804	17804		37.4	10.809	1	14509000			360	480	226	232	491	491		9606
DIIVIGNDITYR	12	Unmodified	_DIIVIGNDITYR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	696.38037109375	2	696.380091	1390.74563	1.2652	0.00088107	-0.1128	-7.8548E-05	1.1524	0.00080252	696.3800731531671	20.732	0.37645	20.732	20.485	20.862	0					7	3	3	0	0	0	9.1207E-11	1	14586	14586		161.51	126.24	1	249140000			361	367	227	233	492	492		9606
DIPGLTDTTVPR	12	Unmodified	_DIPGLTDTTVPR_			0	0	0	P62753	P62753	P62753	RPS6	40S ribosomal protein S6	MULTI-MSMS	DP1141_6	1	643.6840209960938	2	642.843342	1283.67213	0.62104	0.00039923	1.9755	0.0012699	2.5965	0.0016691	642.8432743543854	19.211	0.50031	19.211	18.805	19.305	0					10	4	3	0	0	0	0.0050895	1	12052	12052		105.98	70.067	1	2834700			362	302	228	234	493	493		9606
DIPSLPPLPPLPPLPPLDR	19	Unmodified	_DIPSLPPLPPLPPLPPLDR_			0	0	0	P49750	P49750	P49750	YLPM1	YLP motif-containing protein 1	MULTI-MSMS	DP1141_7	2	1023.0958251953125	2	1022.5957	2043.17685	0.40677	0.00041596	-0.17125	-0.00017512	0.23551	0.00024084	1022.5958741873457	24.285	0.39542	24.285	24.084	24.48	0					11	4	3	0	0	0	4.5508E-25	3	20410	20410;20497;20606		173.72	148.48	1	7125200			363	250	229	235	494;495;496	494		9606
DIPVLVATDVAAR	13	Unmodified	_DIPVLVATDVAAR_			0	0	0	Q86XP3	Q86XP3	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	MULTI-MSMS	DP1141_7	2	670.383544921875	2	670.382634	1338.75072	0.59908	0.00040162	0.4515	0.00030268	1.0506	0.00070429	670.3828697634824	20.501	0.40039	20.501	20.15	20.551	0					9	3	3	0	0	0	2.8699E-06	2	14742	14742;14773		152.04	99.786	1	77719000			364	460	230	236	497;498	497		9606
DISEVIALGVPNPR	14	Unmodified	_DISEVIALGVPNPR_			0	0	0	Q13573	Q13573	Q13573	SNW1	SNW domain-containing protein 1	MULTI-MSMS	DP1141_8	3	740.3795166015625	2	740.411923	1478.80929	0.77342	0.00057265	0.47386	0.00035085	1.2473	0.0009235	740.4120960970808	21.629	0.30053	21.629	21.379	21.679	0					6	2	3	0	0	0	2.6081E-81	2	16203	16164;16203		205.18	171.29	1	13281000			365	377	231	237	499;500	500		9606
DISEVIALGVPNPR	14	Unmodified	_DISEVIALGVPNPR_			0	0	0	Q13573	Q13573	Q13573	SNW1	SNW domain-containing protein 1	MULTI-MSMS	DP1141_9	4	741.8563842773438	2	740.411923	1478.80929	0.37733	0.00027938	0.86448	0.00064007	1.2418	0.00091945	740.4124801999847	21.589	0.3977	21.589	21.338	21.736	0					7	3	3	0	0	0	0.0073653	1	16223	16223		109.66	80.707	1	10295000			366	377	231	237	501	501		9606
DIVENICGR	9	Unmodified	_DIVENICGR_			0	0	0	P42166	P42166	P42166	TMPO	Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin	MULTI-MSMS	DP1141_8	3	537.7769165039062	2	538.263673	1074.51279	0.40083	0.00021575	3.0604	0.0016473	3.4612	0.001863	538.2655508165114	17.123	0.80107	17.123	16.973	17.774	0					9	7	2	0	0	0	0.033822	1	10255	10255		75.213	20.663	1	10832000			367	225	232	238	502	502		9606
DKEVEFGGPAPR	12	Unmodified	_DKEVEFGGPAPR_			0	0	1	P49750	P49750	P49750	YLPM1	YLP motif-containing protein 1	MSMS	DP1141_7	2	651.3547973632812	2	651.327859	1300.64116	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.749	1	15.749	15.249	16.249	0								0	0	0	8.172E-16	1	7214	7214		175.93	106.12	1				368	250	233	239	503	503		9606
DKLPPSMRK	9	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))DKLPPSM(Oxidation (M))RK_	DKLPPSM(1)RK	DKLPPSM(43)RK	1	1	2	Q9Y3Q4	Q9Y3Q4	Q9Y3Q4	HCN4	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4	MSMS	DP1141_8	3	565.3145141601562	2	565.305341	1128.59613	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.913	1	18.913	18.413	19.413	0								0	0	0	0.035772	1	12206	12206		43.246	11.717	1				369	617	234	240	504	504	425	9606
DKPHVNVGTIGHVDHGK	17	Unmodified	_DKPHVNVGTIGHVDHGK_			0	0	1	P49411	P49411	P49411	TUFM	Elongation factor Tu, mitochondrial	MULTI-MSMS	DP1141_9	4	453.23931884765625	4	453.239321	1808.92818	-0.42222	-0.00019137	0.54068	0.00024506	0.11847	5.3694E-05	453.23958097503026	14.281	0.58109	14.281	14.053	14.634	0					18	7	5	0	0	0	0.015362	1	4725	4725		142.4	113.76	1	24877000			370	247	235	241	505	505		9606
DLAILQCHGELDPMVPVR	18	Oxidation (M)	_DLAILQCHGELDPM(Oxidation (M))VPVR_	DLAILQCHGELDPM(1)VPVR	DLAILQCHGELDPM(87)VPVR	0	1	0	O95372	O95372	O95372	LYPLA2	Acyl-protein thioesterase 2	MULTI-MSMS	DP1141_10	5	694.4022827148438	3	693.68357	2078.02888	1.2614	0.00087503	-0.65463	-0.0004541	0.6068	0.00042092	694.01734716933	20.026	0.89944	20.026	19.776	20.676	0					13	8	3	0	0	0	0.0025563	1	14558	14558		87.287	64.303	1	114040000			371	90	236	242	506	506	77	9606
DLAILQCHGELDPMVPVR	18	Oxidation (M)	_DLAILQCHGELDPM(Oxidation (M))VPVR_	DLAILQCHGELDPM(1)VPVR	DLAILQCHGELDPM(67)VPVR	0	1	0	O95372	O95372	O95372	LYPLA2	Acyl-protein thioesterase 2	MSMS	DP1141_10	5	1040.0218505859375	2	1040.02172	2078.02888	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.14	1	20.14	19.64	20.64	0								0	0	0	0.025891	1	14653	14653		67.252	30.573	1				372	90	236	242	507	507	77	9606
DLALVNDQLLGFVR	14	Unmodified	_DLALVNDQLLGFVR_			0	0	0	Q29RF7	Q29RF7	Q29RF7	PDS5A	Sister chromatid cohesion protein PDS5 homolog A	MULTI-MSMS	DP1141_7	2	786.9415893554688	2	786.940847	1571.86714	0.63191	0.00049727	-0.07187	-5.6557E-05	0.56004	0.00044072	786.940820735627	23.393	0.20246	23.393	23.278	23.481	0					6	2	3	0	0	0	0.0018384	1	19159	19159		138.71	104.82	1	10511000			373	415	237	243	508	508		9606
DLDFAQQK	8	Unmodified	_DLDFAQQK_			0	0	0	Q8IX01	Q8IX01	Q8IX01	SUGP2	SURP and G-patch domain-containing protein 2	MULTI-MSMS	DP1141_10	5	482.9472351074219	2	482.740357	963.46616	-0.072186	-3.4847E-05	0.44705	0.00021581	0.37486	0.00018096	482.740584892517	17.137	0.6908	17.137	16.797	17.488	0					10	8	2	0	0	0	5.1744E-06	1	9825	9825		133.47	76.016	1	12170000			374	464	238	244	509	509		9606
DLEKPFLLPVEAVYSVPGR	19	Unmodified	_DLEKPFLLPVEAVYSVPGR_			0	0	1	P49411	P49411	P49411	TUFM	Elongation factor Tu, mitochondrial	MULTI-MSMS	DP1141_9	4	710.6909790039062	3	710.39289	2128.15684	0.59012	0.00041922	0.0099021	7.0344E-06	0.60002	0.00042625	710.7273196330103	22.337	0.22466	22.337	22.205	22.43	0					8	2	4	0	0	0	0.010667	2	17431	17431;17460		95.206	84.702	1	9525600			375	247	239	245	510;511	510		9606
DLILNPR	7	Unmodified	_DLILNPR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MSMS	DP1141_6	1	420.27105712890625	2	420.750527	839.486502	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.79	1	17.79	17.29	18.29	0								0	0	0	0.0049849	1	9924	9924		118.06	63.27	1				376	402	240	246	512	512		9606
DLILNPR	7	Unmodified	_DLILNPR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_7	2	420.7506103515625	2	420.750527	839.486502	0.41037	0.00017266	-0.14892	-6.2659E-05	0.26144	0.00011	420.75042654065925	17.899	0.49999	17.899	17.549	18.049	0					9	4	3	0	0	0	0.0010528	2	10678	10678;10749		118.06	60.245	1	124310000			377	402	240	246	513;514	513		9606
DLKDYFTK	8	Unmodified	_DLKDYFTK_			0	0	1	Q99729	Q99729	Q99729	HNRNPAB	Heterogeneous nuclear ribonucleoprotein A/B	MULTI-MSMS	DP1141_9	4	514.8037109375	2	515.266207	1028.51786	0.016624	8.5659E-06	1.3861	0.00071419	1.4027	0.00072276	515.2668954408501	18.518	0.49986	18.518	18.337	18.837	0					6	4	2	0	0	0	0.0037869	1	11592	11592		125.82	55.819	1	4486300			378	532	241	247	515	515		9606
DLLDTVLPHLYNETK	15	Unmodified	_DLLDTVLPHLYNETK_			0	0	0	Q86VP6	Q86VP6	Q86VP6	CAND1	Cullin-associated NEDD8-dissociated protein 1	MULTI-MSMS	DP1141_7	2	885.9678955078125	2	885.967259	1769.91997	0.5075	0.00044963	0.35238	0.0003122	0.85988	0.00076183	886.468481925983	22.45	0.33066	22.45	22.241	22.572	0					5	3	2	0	0	0	1.1984E-14	1	17734	17734		167.44	104.98	1	9543400			379	458	242	248	516	516		9606
DLLHPSLEEEKKK	13	Unmodified	_DLLHPSLEEEKKK_			0	0	2	Q71UM5	Q71UM5	Q71UM5	RPS27L	40S ribosomal protein S27-like	MULTI-SECPEP	DP1141_10	5	522.3141479492188	3	522.622634	1564.84607	0.39875	0.00020839	0.2835	0.00014816	0.68225	0.00035656	522.9571218773041	15.658	0.32087	15.658	15.46	15.781	0					5	3	2	0	0	0	0.0013949	1	7407	7407		122.18	96.648	1	42457000			380	443	243	249	517	517		9606
DLLHPSPEEEKRK	13	Unmodified	_DLLHPSPEEEKRK_			0	0	2	P42677	P42677	P42677	RPS27	40S ribosomal protein S27	MULTI-MSMS	DP1141_10	5	526.9485473632812	3	526.61425	1576.82092	0.089729	4.7252E-05	0.17924	9.4391E-05	0.26897	0.00014164	526.6143092764071	14.436	0.45943	14.436	14.276	14.736	0					9	6	2	0	0	0	1.9424E-09	2	5469	5469;5561		158.34	121.76	1	88381000			381	227	244	250	518;519	518		9606
DLLHPSPEEEKRK	13	Unmodified	_DLLHPSPEEEKRK_			0	0	2	P42677	P42677	P42677	RPS27	40S ribosomal protein S27	MULTI-MSMS	DP1141_6	1	526.9485473632812	3	526.61425	1576.82092	-0.0055543	-2.925E-06	0.092573	4.875E-05	0.087019	4.5826E-05	526.9486489597803	14.459	0.39802	14.459	14.31	14.708	0					10	3	4	0	0	0	0.0035278	1	4798	4798		119.21	94.987	1	9320500			382	227	244	250	520	520		9606
DLTTAGAVTQCYR	13	Unmodified	_DLTTAGAVTQCYR_			0	0	0	Q02543	Q02543	Q02543	RPL18A	60S ribosomal protein L18a	MULTI-MSMS	DP1141_6	1	728.3517456054688	2	728.348465	1454.68238	0.7739	0.00056367	1.8366	0.0013377	2.6105	0.0019014	728.3498248542194	17.609	0.40063	17.609	17.404	17.805	0					8	3	3	0	0	0	0.0046147	1	9813	9813		114.89	79.449	1	1902500			383	342	245	251	521	521		9606
DLWYLETEKPPPPAR	15	Unmodified	_DLWYLETEKPPPPAR_			0	0	1	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-MSMS	DP1141_7	2	906.4705810546875	2	906.469969	1810.92539	0.38179	0.00034608	-0.56318	-0.00051051	-0.18139	-0.00016442	906.4695042098459	19.6	0.39941	19.6	19.451	19.85	0					8	3	3	0	0	0	0.025222	1	13600	13600		101.47	68.468	1	17720000			384	259	246	252	522	522		9606
DMAGLLKPTACTMLVSSLR	19	2 Oxidation (M)	_DM(Oxidation (M))AGLLKPTACTM(Oxidation (M))LVSSLR_	DM(1)AGLLKPTACTM(1)LVSSLR	DM(78)AGLLKPTACTM(78)LVSSLR	0	2	1	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	699.9867553710938	3	699.356466	2095.04757	1.0494	0.00073389	-0.59612	-0.0004169	0.45325	0.00031698	699.6905688944969	19.415	0.30029	19.415	19.205	19.506	0					6	2	3	0	0	0	0.003768	1	12531	12531		78.456	53.002	1	5133700			385	142	247	253	523	523	137;138	9606
DMAGLLKPTACTMLVSSLR	19	Oxidation (M)	_DMAGLLKPTACTM(Oxidation (M))LVSSLR_	DMAGLLKPTACTM(1)LVSSLR	DM(-97)AGLLKPTACTM(97)LVSSLR	0	1	1	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	694.6939697265625	3	694.024827	2079.05265	1.1072	0.00076841	-1.0305	-0.00071516	0.076722	5.3247E-05	694.3582925623774	20.601	0.50022	20.601	20.15	20.651	0					14	4	4	0	0	0	4.4443E-05	2	14891	14825;14891		118.96	94.509	2	75474000			386	142	247	254	524;525	525	137;138	9606
DMPIQAFLLYQEPVLGPVR	19	Oxidation (M)	_DM(Oxidation (M))PIQAFLLYQEPVLGPVR_	DM(1)PIQAFLLYQEPVLGPVR	DM(350)PIQAFLLYQEPVLGPVR	0	1	0	CON__P02666	CON__P02666	CON__P02666			MULTI-MSMS	DP1141_10	5	1101.5853271484375	2	1101.58501	2201.15546	0.43343	0.00047746	0.23176	0.0002553	0.66519	0.00073276	1102.0867536477858	23.615	0.29155	23.615	23.42	23.712	0					11	3	4	0	0	0	0	2	19831	19831;19928		353.65	320.33	1	15500000		+	387	13	248	255	526;527	526	12	
DMPIQAFLLYQEPVLGPVR	19	Oxidation (M)	_DM(Oxidation (M))PIQAFLLYQEPVLGPVR_	DM(1)PIQAFLLYQEPVLGPVR	DM(160)PIQAFLLYQEPVLGPVR	0	1	0	CON__P02666	CON__P02666	CON__P02666			MULTI-MSMS	DP1141_10	5	735.0609130859375	3	734.725764	2201.15546	0.94048	0.00069099	-0.22322	-0.000164	0.71726	0.00052699	735.0598581179173	23.653	0.43008	23.653	23.42	23.851	0					12	5	4	0	0	0	1.1028E-12	2	19847	19847;19930		161.1	145.12	1	14277000		+	388	13	248	255	528;529	528	12	
DMPIQAFLLYQEPVLGPVR	19	Oxidation (M)	_DM(Oxidation (M))PIQAFLLYQEPVLGPVR_	DM(1)PIQAFLLYQEPVLGPVR	DM(170)PIQAFLLYQEPVLGPVR	0	1	0	CON__P02666	CON__P02666	CON__P02666			MULTI-MSMS	DP1141_7	2	735.0608520507812	3	734.725764	2201.15546	0.35104	0.00025792	0.52346	0.0003846	0.8745	0.00064252	735.0605840894318	23.592	0.22768	23.592	23.414	23.642	0					8	2	4	0	0	0	6.5438E-18	2	19426	19372;19426		166.21	146.28	1	24620000		+	389	13	248	255	530;531	531	12	
DMPIQAFLLYQEPVLGPVR	19	Oxidation (M)	_DM(Oxidation (M))PIQAFLLYQEPVLGPVR_	DM(1)PIQAFLLYQEPVLGPVR	DM(230)PIQAFLLYQEPVLGPVR	0	1	0	CON__P02666	CON__P02666	CON__P02666			MULTI-MSMS	DP1141_8	3	1102.087158203125	2	1101.58501	2201.15546	1.0155	0.0011186	-0.9091	-0.0010014	0.10637	0.00011718	1102.0853966733478	23.597	0.22535	23.597	23.485	23.711	0					6	2	3	0	0	0	3.2919E-145	1	19307	19307		225.86	181.96	1	9548100		+	390	13	248	255	532	532	12	
DMPIQAFLLYQEPVLGPVR	19	Oxidation (M)	_DM(Oxidation (M))PIQAFLLYQEPVLGPVR_	DM(1)PIQAFLLYQEPVLGPVR	DM(120)PIQAFLLYQEPVLGPVR	0	1	0	CON__P02666	CON__P02666	CON__P02666			MULTI-MSMS	DP1141_8	3	735.060791015625	3	734.725764	2201.15546	0.58898	0.00043274	0.20628	0.00015156	0.79526	0.0005843	735.0601468540888	23.617	0.29126	23.617	23.42	23.711	0					10	3	4	0	0	0	9.9087E-05	1	19308	19308		124.08	110.06	1	9582200		+	391	13	248	255	533	533	12	
DMPIQAFLLYQEPVLGPVR	19	Oxidation (M)	_DM(Oxidation (M))PIQAFLLYQEPVLGPVR_	DM(1)PIQAFLLYQEPVLGPVR	DM(270)PIQAFLLYQEPVLGPVR	0	1	0	CON__P02666	CON__P02666	CON__P02666			MULTI-MSMS	DP1141_9	4	1102.0869140625	2	1101.58501	2201.15546	-0.13829	-0.00015233	0.061282	6.7507E-05	-0.077003	-8.4826E-05	1101.5845425709701	23.608	0.26717	23.608	23.403	23.67	0					9	3	4	0	0	0	0	2	19330	19330;19351		274.39	239.31	1	9527500		+	392	13	248	255	534;535	534	12	
DMPIQAFLLYQEPVLGPVR	19	Oxidation (M)	_DM(Oxidation (M))PIQAFLLYQEPVLGPVR_	DM(1)PIQAFLLYQEPVLGPVR	DM(90)PIQAFLLYQEPVLGPVR	0	1	0	CON__P02666	CON__P02666	CON__P02666			MULTI-MSMS	DP1141_9	4	734.7266845703125	3	734.725764	2201.15546	0.8425	0.00061901	0.15121	0.0001111	0.99371	0.00073011	734.7259340430871	23.604	0.26717	23.604	23.403	23.67	0					9	3	4	0	0	0	0.0022788	2	19333	19333;19358		89.507	76.658	1	8728700		+	393	13	248	255	536;537	536	12	
DNHLLGTFDLTGIPPAPR	18	Unmodified	_DNHLLGTFDLTGIPPAPR_			0	0	0	P11021	P11021	P11021	HSPA5	78 kDa glucose-regulated protein	MULTI-MSMS	DP1141_8	3	645.8701782226562	3	645.34253	1933.00576	0.90159	0.00058184	0.061902	3.9948E-05	0.9635	0.00062179	645.6768562044078	21.128	1.0013	21.128	20.978	21.979	0					19	9	3	0	0	0	7.2527E-05	2	15482	15482;15661		116.61	93.083	1	74816000			394	139	249	256	538;539	538		9606
DNHSPVPIITPTDPIDR	17	Unmodified	_DNHSPVPIITPTDPIDR_			0	0	0	O00763	O00763	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	629.6226806640625	3	629.658407	1885.95339	1.1102	0.00069902	-0.68684	-0.00043247	0.42332	0.00026655	629.6583723691866	19.055	0.30019	19.055	18.905	19.205	0					4	2	2	0	0	0	0.016356	1	11958	11958		70.802	35.711	1	7219100			395	40	250	257	540	540		9606
DPLLLAIIPK	10	Unmodified	_DPLLLAIIPK_			0	0	0	Q9HAV4	Q9HAV4	Q9HAV4	XPO5	Exportin-5	MULTI-MSMS	DP1141_7	2	546.85498046875	2	546.854993	1091.69543	0.25487	0.00013938	0.20946	0.00011454	0.46433	0.00025392	546.8550313392849	22.92	0.26205	22.92	22.728	22.99	0					8	3	3	0	0	0	0.011156	2	18326	18326;18441		95.909	85.772	1	3387200			396	565	251	258	541;542	541		9606
DPQELVASFSER	12	Unmodified	_DPQELVASFSER_			0	0	0	Q9UHR5	Q9UHR5	Q9UHR5	SAP30BP	SAP30-binding protein	MULTI-MSMS	DP1141_9	4	689.80859375	2	689.335881	1376.65721	0.17767	0.00012247	3.9171	0.0027002	4.0948	0.0028227	689.3384166768134	20.422	0.40014	20.422	20.136	20.536	0					7	3	3	0	0	0	0.0072664	1	14360	14360		90.05	51.3	1	17752000			397	594	252	259	543	543		9606
DPQQPAQQQQPAQQPK	16	Unmodified	_DPQQPAQQQQPAQQPK_			0	0	0	O75909	O75909	O75909	CCNK	Cyclin-K	MULTI-MSMS	DP1141_8	3	908.9505004882812	2	908.950463	1815.88637	0.16289	0.00014806	-0.044312	-4.0278E-05	0.11858	0.00010778	908.9505134431644	13.443	0.65414	13.443	13.006	13.66	0					16	7	3	0	0	0	0.0024053	3	3645	3516;3645;3651		136.96	115.18	1	2062000			398	82	253	260	544;545;546	545		9606
DPSLPLLELQDIMTSVSGR	19	Oxidation (M)	_DPSLPLLELQDIM(Oxidation (M))TSVSGR_	DPSLPLLELQDIM(1)TSVSGR	DPSLPLLELQDIM(180)TSVSGR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	1044.038818359375	2	1044.03809	2086.06162	0.38585	0.00040284	0.53299	0.00055646	0.91884	0.0009593	1044.540078507994	23.518	0.51426	23.518	23.287	23.802	0					20	7	5	0	0	0	2.0445E-34	3	18649	18649;18708;18908		181.75	154.12	1	11669000			399	367	254	261	547;548;549	547	265	9606
DPSLPLLELQDIMTSVSGR	19	Oxidation (M)	_DPSLPLLELQDIM(Oxidation (M))TSVSGR_	DPSLPLLELQDIM(1)TSVSGR	DPSLPLLELQDIM(60)TSVSGR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MSMS	DP1141_6	1	696.4827880859375	3	696.36115	2086.06162	NaN	NaN	NaN	NaN	NaN	NaN	NaN	23.53	1	23.53	23.03	24.03	0								0	0	0	0.022188	1	18720	18720		59.585	31.942	1				400	367	254	261	550	550	265	9606
DPSLPLLELQDIMTSVSGR	19	Oxidation (M)	_DPSLPLLELQDIM(Oxidation (M))TSVSGR_	DPSLPLLELQDIM(1)TSVSGR	DPSLPLLELQDIM(120)TSVSGR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	1044.5401611328125	2	1044.03809	2086.06162	0.40692	0.00042484	-0.24637	-0.00025722	0.16055	0.00016762	1044.5386681698903	23.526	0.31868	23.526	23.414	23.733	0					5	3	2	0	0	0	0.00011612	1	19435	19435		115.1	85.293	1	2474900			401	367	254	261	551	551	265	9606
DQSAVVVQGLPEGVAFK	17	Unmodified	_DQSAVVVQGLPEGVAFK_			0	0	0	P78347	P78347	P78347	GTF2I	General transcription factor II-I	MSMS	DP1141_7	2	872.4114379882812	2	872.467426	1742.9203	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.491	1	20.491	19.991	20.991	0								0	0	0	2.2488999999999997E-19	1	14764	14764		154.23	112.69	1				402	327	255	262	552	552		9606
DREEDEEDAYERR	13	Unmodified	_DREEDEEDAYERR_			0	0	2	P49756	P49756	P49756	RBM25	RNA-binding protein 25	MSMS	DP1141_7	2	856.3641357421875	2	856.361344	1710.70813	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.544	1	14.544	14.044	15.044	0								0	0	0	9.7385E-33	1	5339	5339		165.63	130.74	1				403	251	256	263	553	553		9606
DRLLASTLVHSVK	13	Unmodified	_DRLLASTLVHSVK_			0	0	1	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-SECPEP	DP1141_7	2	479.9308776855469	3	480.284064	1437.83036	0.61748	0.00029656	-0.69605	-0.0003343	-0.078578	-3.774E-05	480.2836665958976	17.599	0.5001	17.599	17.149	17.649	0					7	4	2	0	0	0	0.028073	1	10129	10129		93.237	70.745	1	37898000			404	580	257	264	554	554		9606
DSPALDKMIPSR	12	Oxidation (M)	_DSPALDKM(Oxidation (M))IPSR_	DSPALDKM(1)IPSR	DSPALDKM(84)IPSR	0	1	1		REV__P27816	REV__P27816			MULTI-SECPEP	DP1141_9	4	673.9190673828125	2	673.342652	1344.67075	0.91547	0.00061643	-0.22685	-0.00015275	0.68862	0.00046368	673.3424994757614	23.63	0.5769	23.63	23.46	24.037	0					12	7	2	0	0	0	0.035947	1	19291	19291		83.647	49.725	1	28138000	+		405	625	258	265	555	555	429	9606
DSTFDLPADSIAPFHICYYGR	21	Unmodified	_DSTFDLPADSIAPFHICYYGR_			0	0	0	Q8N1G2	Q8N1G2	Q8N1G2	CMTR1	Cap-specific mRNA (nucleoside-2-O-)-methyltransferase 1	MULTI-MSMS	DP1141_7	2	816.5440063476562	3	815.710842	2444.1107	0.65229	0.00053208	-0.06428	-5.2434E-05	0.58801	0.00047965	816.3793903049692	22.315	0.25407	22.315	22.146	22.4	0					8	2	4	0	0	0	5.0064E-05	1	17453	17453		99.813	85.798	1	5846200			406	468	259	266	556	556		9606
DSTLIMQLLR	10	Oxidation (M)	_DSTLIM(Oxidation (M))QLLR_	DSTLIM(1)QLLR	DSTLIM(120)QLLR	0	1	0	P31946;P27348;Q04917;P61981;P31947;P63104;P62258	P31946;P63104;P62258	P63104	YWHAB;YWHAQ;YWHAH;YWHAG;SFN;YWHAZ;YWHAE	14-3-3 protein beta/alpha;14-3-3 protein beta/alpha, N-terminally processed;14-3-3 protein theta;14-3-3 protein eta;14-3-3 protein gamma;14-3-3 protein gamma, N-terminally processed;14-3-3 protein sigma;14-3-3 protein zeta/delta;14-3-3 protein epsilon	MULTI-MSMS	DP1141_10	5	603.331787109375	2	603.331556	1204.64856	0.73466	0.00044325	-0.24209	-0.00014606	0.49258	0.00029719	603.3313537575494	22.108	0.39021	22.108	21.959	22.349	0					6	3	2	0	0	0	0.031245	1	17714	17714		120.87	78.004	1	32195000			407	316;290;201	260	267	557	557	170	9606
DSTLIMQLLR	10	Oxidation (M)	_DSTLIM(Oxidation (M))QLLR_	DSTLIM(1)QLLR	DSTLIM(90)QLLR	0	1	0	P31946;P27348;Q04917;P61981;P31947;P63104;P62258	P31946;P63104;P62258	P63104	YWHAB;YWHAQ;YWHAH;YWHAG;SFN;YWHAZ;YWHAE	14-3-3 protein beta/alpha;14-3-3 protein beta/alpha, N-terminally processed;14-3-3 protein theta;14-3-3 protein eta;14-3-3 protein gamma;14-3-3 protein gamma, N-terminally processed;14-3-3 protein sigma;14-3-3 protein zeta/delta;14-3-3 protein epsilon	MSMS	DP1141_7	2	603.3319702148438	2	603.331556	1204.64856	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.2	1	22.2	21.7	22.7	0								0	0	0	0.027476	1	17277	17277		89.698	38.422	1				408	316;290;201	260	267	558	558	170	9606
DSTLIMQLLR	10	Oxidation (M)	_DSTLIM(Oxidation (M))QLLR_	DSTLIM(1)QLLR	DSTLIM(110)QLLR	0	1	0	P31946;P27348;Q04917;P61981;P31947;P63104;P62258	P31946;P63104;P62258	P63104	YWHAB;YWHAQ;YWHAH;YWHAG;SFN;YWHAZ;YWHAE	14-3-3 protein beta/alpha;14-3-3 protein beta/alpha, N-terminally processed;14-3-3 protein theta;14-3-3 protein eta;14-3-3 protein gamma;14-3-3 protein gamma, N-terminally processed;14-3-3 protein sigma;14-3-3 protein zeta/delta;14-3-3 protein epsilon	MULTI-MSMS	DP1141_8	3	603.3319702148438	2	603.331556	1204.64856	0.50523	0.00030482	0.1675	0.00010106	0.67272	0.00040588	603.3316512045253	22.129	0.29991	22.129	21.979	22.279	0					6	2	3	0	0	0	0.022237	2	17139	17139;17173		113.26	86.141	1	16577000			409	316;290;201	260	267	559;560	559	170	9606
DSTLIMQLLR	10	Oxidation (M)	_DSTLIM(Oxidation (M))QLLR_	DSTLIM(1)QLLR	DSTLIM(110)QLLR	0	1	0	P31946;P27348;Q04917;P61981;P31947;P63104;P62258	P31946;P63104;P62258	P63104	YWHAB;YWHAQ;YWHAH;YWHAG;SFN;YWHAZ;YWHAE	14-3-3 protein beta/alpha;14-3-3 protein beta/alpha, N-terminally processed;14-3-3 protein theta;14-3-3 protein eta;14-3-3 protein gamma;14-3-3 protein gamma, N-terminally processed;14-3-3 protein sigma;14-3-3 protein zeta/delta;14-3-3 protein epsilon	MULTI-MSMS	DP1141_9	4	603.3314208984375	2	603.331556	1204.64856	-0.27199	-0.0001641	0.55264	0.00033343	0.28066	0.00016933	603.3319515537381	22.251	0.42413	22.251	21.93	22.354	0					10	4	3	0	0	0	0.013798	2	17174	17174;17224		111.95	81.377	1	23639000			410	316;290;201	260	267	561;562	561	170	9606
DTAASGYGTQNIR	13	Unmodified	_DTAASGYGTQNIR_			0	0	0	Q9Y314	Q9Y314	Q9Y314	NOSIP	Nitric oxide synthase-interacting protein	MULTI-SECPEP	DP1141_9	4	677.3681030273438	2	677.323305	1352.63206	0.21256	0.00014398	0.57911	0.00039224	0.79167	0.00053622	677.3234133083463	15.747	0.29965	15.747	15.573	15.872	0					4	2	2	0	0	0	2.9011999999999997E-21	1	7029	7029		169.65	76.492	1	3695600			411	614	261	268	563	563		9606
DTGILDSIGR	10	Unmodified	_DTGILDSIGR_			0	0	0	P02686	P02686	P02686	MBP	Myelin basic protein	MULTI-SECPEP	DP1141_10	5	523.2708740234375	2	523.77747	1045.54039	1.0262	0.00053749	-0.8441	-0.00044212	0.18208	9.5372E-05	523.7769682354298	19.426	0.29937	19.426	19.277	19.576	0					4	2	2	0	0	0	8.963E-24	1	13550	13550		190.26	108.02	1	146190000			412	99	262	269	564	564		9606
DTGKTPVEPEVAIHR	15	Unmodified	_DTGKTPVEPEVAIHR_			0	0	1	P60866	P60866	P60866	RPS20	40S ribosomal protein S20	MULTI-MSMS	DP1141_10	5	550.2938842773438	3	550.293288	1647.85803	0.39769	0.00021885	0.22772	0.00012531	0.62541	0.00034416	550.293526717597	15.506	0.41007	15.506	15.199	15.609	0					9	4	4	0	0	0	4.416E-83	2	7247	7118;7247		191.63	166.3	1	39188000			413	279	263	270	565;566	566		9606
DTKRCLEMK	9	Oxidation (M)	_DTKRCLEM(Oxidation (M))K_	DTKRCLEM(1)K	DTKRCLEM(78)K	0	1	2	Q9NY28	Q9NY28	Q9NY28	GALNT8	Probable polypeptide N-acetylgalactosaminyltransferase 8	MULTI-SECPEP	DP1141_7	2	598.8611450195312	2	598.79174	1195.56893	0.091847	5.4997E-05	2.6847	0.0016076	2.7765	0.0016626	598.793632447366	15.16	0.40022	15.16	15.009	15.409	0					5	3	2	0	0	0	0.020866	1	6270	6270		77.923	22.553	1	12915000			414	579	264	271	567	567	411	9606
DTLLSVEIVHELKGEGK	17	Unmodified	_DTLLSVEIVHELKGEGK_			0	0	1	Q8N1G2	Q8N1G2	Q8N1G2	CMTR1	Cap-specific mRNA (nucleoside-2-O-)-methyltransferase 1	MULTI-MSMS	DP1141_7	2	623.3536987304688	3	623.010557	1866.00984	0.53054	0.00033053	-0.03997	-2.4902E-05	0.49057	0.00030563	623.3447279062628	20.2	0.30056	20.2	20.05	20.351	0					4	2	2	0	0	0	0.0027007	1	14434	14434		155.06	130.01	1	17999000			415	468	265	272	568	568		9606
DTPGHGSGWAETPR	14	Unmodified	_DTPGHGSGWAETPR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_10	5	489.8920593261719	3	489.891895	1466.65385	0.27661	0.00013551	0.013319	6.5246E-06	0.28993	0.00014203	489.89187410942725	15.506	0.24092	15.506	15.368	15.609	0					8	2	4	0	0	0	0.0015486	1	7245	7245		132.31	121.36	1	47194000			416	78	266	273	569	569		9606
DTPGHGSGWAETPR	14	Unmodified	_DTPGHGSGWAETPR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MSMS	DP1141_7	2	489.8919982910156	3	489.891895	1466.65385	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.569	1	15.569	15.069	16.069	0								0	0	0	0.011377	1	6919	6919		132.86	103.52	1				417	78	266	273	570	570		9606
DTPGHGSGWAETPR	14	Unmodified	_DTPGHGSGWAETPR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MSMS	DP1141_7	2	734.3345336914062	2	734.334204	1466.65385	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.581	1	15.581	15.081	16.081	0								0	0	0	9.6412E-16	1	6936	6936		153.54	117.88	1				418	78	266	273	571	571		9606
DTPGHGSGWAETPR	14	Unmodified	_DTPGHGSGWAETPR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	490.2078857421875	3	489.891895	1466.65385	0.6526	0.0003197	-0.029565	-1.4484E-05	0.62304	0.00030522	489.89194347001734	15.524	0.60507	15.524	15.271	15.876	0					9	5	3	0	0	0	0.0020463	1	6696	6696		102.52	97.147	1	354610000			419	78	266	273	572	572		9606
DTPLFSEAR	9	Unmodified	_DTPLFSEAR_			0	0	0	O00763	O00763	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	517.587890625	2	518.258914	1034.50327	0.9021	0.00046752	-0.81572	-0.00042276	0.086376	4.4765E-05	518.2584563713931	18.155	0.4	18.155	17.805	18.205	0					5	3	2	0	0	0	0.015676	1	10472	10472		104.06	60.288	1	24759000			420	40	267	274	573	573		9606
DTPTSAGPNSFNK	13	Unmodified	_DTPTSAGPNSFNK_			0	0	0	Q8WW12	Q8WW12	Q8WW12	PCNP	PEST proteolytic signal-containing nuclear protein	MULTI-MSMS	DP1141_10	5	668.3129272460938	2	668.312406	1334.61026	-0.073979	-4.9441E-05	0.33164	0.00022164	0.25766	0.0001722	668.312759178251	15.411	0.49399	15.411	15.039	15.533	0					15	5	4	0	0	0	1.0321E-10	2	6876	6876;6883		161.51	128.47	1	90735000			421	486	268	275	574;575	574		9606
DTSYLFITGPDVVK	14	Unmodified	_DTSYLFITGPDVVK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	777.9064331054688	2	777.906139	1553.79772	0.38914	0.00030271	0.13978	0.00010873	0.52891	0.00041145	777.9061469007506	21.529	0.60024	21.529	21.379	21.979	0					13	5	4	0	0	0	0.020281	1	16241	16241		90.913	62.736	1	121950000			422	111	269	276	576	576		9606
DVDAAYMNK	9	Unmodified	_DVDAAYMNK_			0	0	0	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;O95678;CON__O95678;CON__P13647;P13647;P04259;CON__Q14CN4-1;CON__Q6IME9;Q14CN4	CON__P02538;CON__P13647;P04259;CON__Q14CN4-1	CON__P02538	KRT6A;KRT6C;KRT75;KRT5;KRT6B;KRT72	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 75;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 72	MULTI-SECPEP	DP1141_9	4	513.7742309570312	2	513.731674	1025.4488	-0.057668	-2.9626E-05	0.31357	0.00016109	0.2559	0.00013147	513.7317791746602	16.008	0.28573	16.008	15.772	16.058	0					4	2	2	0	0	0	0.024211	1	7528	7528		95.352	12.681	1	51921000		+	423	10;101;18;22	270	277	577	577		9606
DVDAAYMNKVELQAK	15	Oxidation (M)	_DVDAAYM(Oxidation (M))NKVELQAK_	DVDAAYM(1)NKVELQAK	DVDAAYM(150)NKVELQAK	0	1	1	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;P04259;CON__Q14CN4-1;CON__Q6IME9;Q14CN4	CON__P02538;P04259;CON__Q14CN4-1	CON__P02538	KRT6A;KRT6C;KRT6B;KRT72	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 72	MULTI-MSMS	DP1141_9	4	570.9505004882812	3	570.950422	1709.82944	0.063701	3.637E-05	-0.20956	-0.00011965	-0.14586	-8.3277E-05	570.9505088376153	16.599	0.23434	16.599	16.458	16.693	0					10	2	5	0	0	0	1.9438E-05	1	8531	8531		152.16	32.282	1	34078000		+	424	10;101;22	271	278	578	578	11	9606
DVDDGLQAAEEVGYPVMIK	19	Oxidation (M)	_DVDDGLQAAEEVGYPVM(Oxidation (M))IK_	DVDDGLQAAEEVGYPVM(1)IK	DVDDGLQAAEEVGYPVM(190)IK	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	1032.9945068359375	2	1032.99334	2063.97214	0.33007	0.00034096	0.073645	7.6074E-05	0.40372	0.00041704	1032.9936349524141	20.997	0.62438	20.997	20.582	21.206	0					22	6	6	0	0	0	9.5663E-46	2	14693	14693;14712		188.63	143.8	1	48729000			425	367	272	279	579;580	579	266	9606
DVDDGLQAAEEVGYPVMIK	19	Unmodified	_DVDDGLQAAEEVGYPVMIK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	1025.498291015625	2	1024.99589	2047.97722	0.4492	0.00046043	-0.32265	-0.00033071	0.12656	0.00012972	1025.497046586434	21.898	0.38993	21.898	21.546	21.936	0					16	4	4	0	0	0	2.9804E-05	2	16133	16077;16133		116.96	86.523	1	8711500			426	367	272	280	581;582	582		9606
DVFLAWVASR	10	Unmodified	_DVFLAWVASR_			0	0	0	O94842	O94842	O94842	TOX4	TOX high mobility group box family member 4	MULTI-MSMS	DP1141_7	2	582.3143920898438	2	582.314023	1162.61349	0.67704	0.00039425	0.08828	5.1406E-05	0.76532	0.00044566	582.3140537955933	22.858	0.17739	22.858	22.728	22.906	0					4	2	2	0	0	0	0.0070205	1	18313	18313		118.18	76.95	1	3277600			427	85	273	281	583	583		9606
DVFLAWVASR	10	Unmodified	_DVFLAWVASR_			0	0	0	O94842	O94842	O94842	TOX4	TOX high mobility group box family member 4	MULTI-SECPEP	DP1141_8	3	581.7512817382812	2	582.314023	1162.61349	0.26879	0.00015652	0.25053	0.00014589	0.51932	0.00030241	582.3141282671047	22.908	0.23329	22.908	22.72	22.953	0					4	2	2	0	0	0	0.025779	1	18129	18129		91.584	50.555	1	2349400			428	85	273	281	584	584		9606
DVHTLLDR	8	Unmodified	_DVHTLLDR_			0	0	0	Q9NPD3	Q9NPD3	Q9NPD3	EXOSC4	Exosome complex component RRP41	MULTI-MSMS	DP1141_10	5	484.7632141113281	2	484.761623	967.508694	0.024071	1.1669E-05	0.59701	0.00028941	0.62108	0.00030108	484.7618843533158	16.893	0.2782	16.893	16.727	17.005	0					10	4	3	0	0	0	9.2961E-07	2	9485	9485;9493		149.4	71.367	1	105370000			429	570	274	282	585;586	585		9606
DVNAAIAAIK	10	Unmodified	_DVNAAIAAIK_			0	0	0	P68366	P68366	P68366	TUBA4A	Tubulin alpha-4A chain	MULTI-MSMS	DP1141_9	4	493.2874450683594	2	493.287474	984.560395	0.050092	2.471E-05	0.29673	0.00014637	0.34682	0.00017108	493.28758682356096	18.529	0.50029	18.529	18.137	18.637	0					10	4	3	0	0	0	0.023011	1	11700	11700		81.296	14.867	1	13636000			430	322	275	283	587	587		9606
DVNAAIATIK	10	Unmodified	_DVNAAIATIK_			0	0	0	P68363;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;Q71U36	P68363	TUBA1B;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-SECPEP	DP1141_7	2	507.78460693359375	2	508.292756	1014.57096	0.11017	5.6E-05	0.099774	5.0714E-05	0.20995	0.00010671	508.29278857734147	17.899	0.59995	17.899	17.549	18.149	0					8	5	3	0	0	0	0.022875	1	10804	10804		105.52	56.079	1	154970000			431	321;442	276	284	588	588		9606
DVNAAIATIK	10	Unmodified	_DVNAAIATIK_			0	0	0	P68363;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;Q71U36	P68363	TUBA1B;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_8	3	508.29278564453125	2	508.292756	1014.57096	0.61999	0.00031514	-0.19918	-0.00010124	0.42081	0.0002139	508.29272276656627	17.925	0.501	17.925	17.574	18.075	0					7	4	2	0	0	0	0.0075116	1	10791	10791		100.25	50.887	1	966530000			432	321;442	276	284	589	589		9606
DVNAAIATIK	10	Unmodified	_DVNAAIATIK_			0	0	0	P68363;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;Q71U36	P68363	TUBA1B;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_9	4	508.29290771484375	2	508.292756	1014.57096	-0.23549	-0.0001197	0.62595	0.00031817	0.39047	0.00019847	508.29303168293245	17.987	0.59947	17.987	17.537	18.137	0					9	5	3	0	0	0	0.0037363	1	10726	10726		109.66	44.906	1	37110000			433	321;442	276	284	590	590		9606
DVPLGTPLCIIVEK	14	Unmodified	_DVPLGTPLCIIVEK_			0	0	0	P10515	P10515	P10515	DLAT	Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial	MULTI-MSMS	DP1141_8	3	777.934326171875	2	777.434009	1552.85347	0.43858	0.00034097	-3.0238	-0.0023508	-2.5852	-0.0020098	777.4317278148494	22.37	1.9593	22.37	21.279	23.238	0					48	21	4	0	0	0	0.035788	1	16597	16597		65.695	34.347	1	24329000			434	138	277	285	591	591		9606
DYFEQYGK	8	Unmodified	_DYFEQYGK_			0	0	0	P09651;Q32P51;A0A2R8Y4L2	P09651	P09651	HNRNPA1;HNRNPA1L2	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2	MULTI-MSMS	DP1141_9	4	524.8108520507812	2	525.232364	1048.45018	0.22735	0.00011941	0.15542	8.1632E-05	0.38277	0.00020105	525.232422697823	18.187	0.29993	18.187	17.937	18.237	0					6	2	3	0	0	0	0.014358	1	11034	11034		91.9	70.928	1	13472000			435	130	278	286	592	592		9606
DYLHYIR	7	Unmodified	_DYLHYIR_			0	0	0	P62280	P62280	P62280	RPS11	40S ribosomal protein S11	MSMS	DP1141_10	5	490.2566223144531	2	490.253434	978.492316	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.955	1	17.955	17.455	18.455	0								0	0	0	0.011981	1	11233	11233		122.98	70.342	1				436	295	279	287	593	593		9606
DYQELMNTK	9	Oxidation (M)	_DYQELM(Oxidation (M))NTK_	DYQELM(1)NTK	DYQELM(160)NTK	0	1	0	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_6	1	578.8114013671875	2	579.260796	1156.50704	0.65596	0.00037997	-0.060209	-3.4877E-05	0.59576	0.0003451	579.2608065700406	15.563	0.39558	15.563	15.408	15.804	0					9	3	3	0	0	0	1.0062E-12	2	6364	6364;6428		163.15	98.944	1	122440000		+	437	102	280	288	594;595	594	83	9606
DYQELMNTK	9	Oxidation (M)	_DYQELM(Oxidation (M))NTK_	DYQELM(1)NTK	DYQELM(150)NTK	0	1	0	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_7	2	579.2958374023438	2	579.260796	1156.50704	0.36203	0.00020971	0.05505	3.1888E-05	0.41708	0.0002416	579.2608064625202	15.564	0.40527	15.564	15.409	15.815	0					7	3	3	0	0	0	3.4722E-05	1	6888	6888		153.04	103.59	1	151910000		+	438	102	280	288	596	596	83	9606
DYQELMNTK	9	Oxidation (M)	_DYQELM(Oxidation (M))NTK_	DYQELM(1)NTK	DYQELM(120)NTK	0	1	0	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_8	3	579.2979736328125	2	579.260796	1156.50704	0.1831	0.00010606	0.38386	0.00022235	0.56696	0.00032842	579.2611302675679	15.625	0.40536	15.625	15.37	15.776	0					7	3	3	0	0	0	0.029652	1	6843	6843		120.87	73.294	1	45099000		+	439	102	280	288	597	597	83	9606
DYQELMNTK	9	Oxidation (M)	_DYQELM(Oxidation (M))NTK_	DYQELM(1)NTK	DYQELM(110)NTK	0	1	0	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_9	4	579.2610473632812	2	579.260796	1156.50704	0.41648	0.00024125	0.074026	4.288E-05	0.49051	0.00028413	579.2608573815019	15.623	0.40086	15.623	15.372	15.772	0					7	3	3	0	0	0	0.027622	1	6838	6838		113.26	67.92	1	54833000		+	440	102	280	288	598	598	83	9606
DYQELMNTK	9	Unmodified	_DYQELMNTK_			0	0	0	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_8	3	571.6184692382812	2	571.263339	1140.51212	-0.019456	-1.1114E-05	-3.8607	-0.0022055	-3.8801	-0.0022166	571.261235053427	17.718	0.40013	17.718	17.474	17.874	0					7	3	3	0	0	0	0.00049575	1	10447	10447		132.76	77.982	1	16763000		+	441	102	280	289	599	599		9606
DYQELMNVK	9	Oxidation (M)	_DYQELM(Oxidation (M))NVK_	DYQELM(1)NVK	DYQELM(93)NVK	0	1	0	CON__P35908v2;CON__P35908;P35908;CON__Q5XKE5;Q5XKE5;CON__P12035;CON__Q01546;P12035;Q01546	CON__P35908v2	CON__P35908v2	KRT2;KRT79;KRT3;KRT76	Keratin, type II cytoskeletal 2 epidermal;Keratin, type II cytoskeletal 79;Keratin, type II cytoskeletal 3;Keratin, type II cytoskeletal 2 oral	MULTI-SECPEP	DP1141_7	2	577.6593017578125	2	578.271164	1154.52777	0.80215	0.00046386	-0.61492	-0.00035559	0.18723	0.00010827	578.2707495651872	16.694	0.72366	16.694	16.014	16.738	0					9	7	2	0	0	0	0.033309	1	8839	8839		93.429	73.725	1	72013000		+	442	20	281	290	600	600	24	9606
EAAAALVEEETRR	13	Unmodified	_EAAAALVEEETRR_			0	0	1	O75934	O75934	O75934	BCAS2	Pre-mRNA-splicing factor SPF27	MULTI-MSMS	DP1141_10	5	723.3753051757812	2	722.873162	1443.73177	0.66309	0.00047933	-0.039645	-2.8658E-05	0.62344	0.00045067	722.8730252304197	16.881	0.2782	16.881	16.727	17.005	0					10	4	4	0	0	0	3.1945E-279	1	9496	9496		235.01	135.2	1	53762000			443	83	282	291	601	601		9606
EAALIALR	8	Unmodified	_EAALIALR_			0	0	0	Q9NRP7	Q9NRP7	Q9NRP7	STK36	Serine/threonine-protein kinase 36	MULTI-MSMS	DP1141_8	3	429.540771484375	2	428.766178	855.517802	-0.13725	-5.8848E-05	0.11794	5.0569E-05	-0.019309	-8.279E-06	428.7662631191471	16.612	0.85183	16.612	15.976	16.828	0					22	8	5	0	0	0	0.021515	1	8293	8293		88.643	14.204	1	1085300000			444	573	283	292	602	602		9606
EADGGGVGRGKDISTITGHR	20	Unmodified	_EADGGGVGRGKDISTITGHR_			0	0	2	Q96T23	Q96T23	Q96T23	RSF1	Remodeling and spacing factor 1	MSMS	DP1141_10	5	991.96630859375	2	992.003759	1981.99296	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.901	1	19.901	19.401	20.401	0								0	0	0	0.017245	1	14295	14295		90.697	39.445	1				445	524	284	293	603	603		9606
EAETDEIKILLEESRAQQK	19	Unmodified	_EAETDEIKILLEESRAQQK_			0	0	2	Q8TDY2	Q8TDY2	Q8TDY2	RB1CC1	RB1-inducible coiled-coil protein 1	MULTI-MSMS	DP1141_8	3	559.290771484375	4	558.29449	2229.14886	0.065665	3.666E-05	-0.30493	-0.00017024	-0.23926	-0.00013358	558.5450478864112	14.527	0.82329	14.527	14.05	14.873	0					29	9	7	0	0	0	0.030463	1	5124	5124		35.304	0	1	525010000			446	481	285	294	604	604		9606
EAETDEIKILLEESRAQQK	19	Unmodified	_EAETDEIKILLEESRAQQK_			0	0	2	Q8TDY2	Q8TDY2	Q8TDY2	RB1CC1	RB1-inducible coiled-coil protein 1	MULTI-MSMS	DP1141_8	3	744.3909912109375	3	744.056895	2229.14886	0.74301	0.00055284	-1.008	-0.00075003	-0.26501	-0.00019718	744.3905284764397	14.527	0.4064	14.527	14.268	14.674	0					13	4	4	0	0	0	0.011072	1	5379	5379		55.912	25.829	1	74215000			447	481	285	294	605	605		9606
EALENANTNTEVLK	14	Unmodified	_EALENANTNTEVLK_			0	0	0	Q9H444	Q9H444	Q9H444	CHMP4B	Charged multivesicular body protein 4b	MULTI-MSMS	DP1141_9	4	773.3916625976562	2	773.391384	1544.76822	0.81077	0.00062705	0.31931	0.00024695	1.1301	0.000874	773.3912504613581	16.605	0.23434	16.605	16.458	16.693	0					6	2	3	0	0	0	0.0020357	1	8545	8545		150.09	87.512	1	16197000			448	561	286	295	606	606		9606
EALGGQALYPHVLVK	15	Unmodified	_EALGGQALYPHVLVK_			0	0	0	Q9BUJ2	Q9BUJ2	Q9BUJ2	HNRNPUL1	Heterogeneous nuclear ribonucleoprotein U-like protein 1	MSMS	DP1141_7	2	797.7279663085938	2	797.951215	1593.88788	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.668	1	18.668	18.168	19.168	0								0	0	0	0.0010286	1	11978	11978		164.48	107.31	1				449	540	287	296	607	607		9606
EANNFLWPFK	10	Unmodified	_EANNFLWPFK_			0	0	0	P18124	P18124	P18124	RPL7	60S ribosomal protein L7	MULTI-MSMS	DP1141_10	5	633.3197631835938	2	633.319306	1264.62406	-0.2361	-0.00014953	1.2217	0.00077371	0.98557	0.00062418	633.3199518782205	22.481	0.25082	22.481	22.349	22.6	0					6	2	3	0	0	0	0.013295	1	18242	18242		91.069	57.324	1	27415000			450	167	288	297	608	608		9606
EAPPMEKPEVVK	12	Oxidation (M)	_EAPPM(Oxidation (M))EKPEVVK_	EAPPM(1)EKPEVVK	EAPPM(120)EKPEVVK	0	1	1	P62841	P62841	P62841	RPS15	40S ribosomal protein S15	MULTI-MSMS	DP1141_10	5	457.2655029296875	3	457.239244	1368.6959	-0.086124	-3.9379E-05	0.34214	0.00015644	0.25602	0.00011706	457.23952358883554	13.952	0.87984	13.952	13.72	14.6	0					29	14	4	0	0	0	0.0058792	2	4715	4715;4726		115.29	93.678	1	15280000			451	306	289	298	609;610	609	240	9606
EAPPMEKPEVVK	12	Oxidation (M)	_EAPPM(Oxidation (M))EKPEVVK_	EAPPM(1)EKPEVVK	EAPPM(81)EKPEVVK	0	1	1	P62841	P62841	P62841	RPS15	40S ribosomal protein S15	MULTI-SECPEP	DP1141_6	1	457.9727783203125	3	457.239244	1368.6959	0.60142	0.00027499	0.55323	0.00025296	1.1546	0.00052795	457.2391634781799	13.925	0.39737	13.925	13.736	14.133	0					5	4	2	0	0	0	0.0068693	1	3987	3987		80.834	50.695	1	273570			452	306	289	298	611	611	240	9606
EASFEYLQNEGER	13	Unmodified	_EASFEYLQNEGER_			0	0	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	786.3527221679688	2	786.352259	1570.68997	0.33552	0.00026384	0.26862	0.00021123	0.60414	0.00047507	786.3524703779875	18.355	0.39944	18.355	18.205	18.604	0					11	3	5	0	0	0	1.7961000000000002E-29	4	11006	10884;10954;11006;11012		176.95	162.53	1	116850000			453	367;40	290	299	612;613;614;615	614		9606
EATKEVHTQAENAEFMR	17	Oxidation (M)	_EATKEVHTQAENAEFM(Oxidation (M))R_	EATKEVHTQAENAEFM(1)R	EATKEVHTQAENAEFM(56)R	0	1	1	P09601	P09601	P09601	HMOX1	Heme oxygenase 1	MULTI-SECPEP	DP1141_10	5	669.3099975585938	3	669.646061	2005.91635	0.15573	0.00010429	-0.58968	-0.00039488	-0.43395	-0.00029059	669.6454324588183	16.116	0.48995	16.116	15.873	16.363	0					6	4	2	0	0	0	0.028307	1	8341	8341		55.66	29.423	1	5718100			454	129	291	300	616	616	123	9606
EAYPGDVFYLHSR	13	Unmodified	_EAYPGDVFYLHSR_			0	0	0	P25705	P25705	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	MULTI-SECPEP	DP1141_10	5	518.277099609375	3	518.584291	1552.73104	0.79248	0.00041097	-0.013091	-6.7887E-06	0.77939	0.00040418	518.9182160814844	19.001	0.30038	19.001	18.777	19.077	0					6	2	3	0	0	0	0.025528	1	12842	12842		69.229	38.791	1	7139700			455	187	292	301	617	617		9606
EAYPGDVFYLHSR	13	Unmodified	_EAYPGDVFYLHSR_			0	0	0	P25705	P25705	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	518.58447265625	3	518.584291	1552.73104	0.52434	0.00027191	-0.59553	-0.00030883	-0.071195	-3.6921E-05	518.5838770529489	19.026	0.3998	19.026	18.775	19.175	0					10	3	4	0	0	0	0.002957	1	12410	12410		104.17	67.031	1	52065000			456	187	292	301	618	618		9606
EDGNEEDKENQGDETQGQQPPQR	23	Unmodified	_EDGNEEDKENQGDETQGQQPPQR_			0	0	1	P67809	P67809	P67809	YBX1	Nuclease-sensitive element-binding protein 1	MULTI-MSMS	DP1141_9	4	876.795166015625	3	876.706201	2627.09677	0.48605	0.00042613	-0.31298	-0.00027439	0.17307	0.00015173	877.0402906660574	12.853	1.1752	12.853	12.702	13.877	0					40	13	4	0	0	0	2.0227000000000002E-267	4	2890	2754;2890;2962;3490		259.64	253.64	1	27383000			457	319	293	302	619;620;621;622	620		9606
EDLESSGLQR	10	Unmodified	_EDLESSGLQR_			0	0	0	Q9UK76	Q9UK76	Q9UK76	HN1	Hematological and neurological expressed 1 protein;Hematological and neurological expressed 1 protein, N-terminally processed	MULTI-MSMS	DP1141_10	5	567.7676391601562	2	567.275292	1132.53603	0.81114	0.00046014	-0.36325	-0.00020607	0.44788	0.00025407	567.2747522620978	15.826	0.27123	15.826	15.697	15.968	0					4	2	2	0	0	0	0.0066842	1	7801	7801		120.15	57.69	1	10341000			458	596	294	303	623	623		9606
EDQTEYLEER	10	Unmodified	_EDQTEYLEER_			0	0	0	P08238;P07900;Q58FF6;Q58FF7	P08238	P08238	HSP90AB1;HSP90AA1;HSP90AB4P;HSP90AB3P	Heat shock protein HSP 90-beta;Heat shock protein HSP 90-alpha;Putative heat shock protein HSP 90-beta 4;Putative heat shock protein HSP 90-beta-3	MULTI-MSMS	DP1141_8	3	656.3096313476562	2	656.288596	1310.56264	0.61013	0.00040042	0.14787	9.7044E-05	0.75799	0.00049746	656.2886618346307	16.684	0.26166	16.684	16.469	16.731	0					4	2	2	0	0	0	5.252E-05	1	8642	8642		150.27	105.92	1	6675300			459	126	295	304	624	624		9606
EDSQRPGAHLTVK	13	Unmodified	_EDSQRPGAHLTVK_			0	0	1	P09651;Q32P51	P09651	P09651	HNRNPA1;HNRNPA1L2	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2	MULTI-MSMS	DP1141_9	4	479.9198913574219	3	479.919673	1436.73719	0.31141	0.00014945	-0.12889	-6.1857E-05	0.18252	8.7593E-05	479.91969144415947	13.54	0.84847	13.54	13.204	14.053	0					15	11	2	0	0	0	0.028179	1	3648	3648		90.412	50.832	1	4212600			460	130	296	305	625	625		9606
EDSVKPGAHLTVK	13	Unmodified	_EDSVKPGAHLTVK_			0	0	1	P51991	P51991	P51991	HNRNPA3	Heterogeneous nuclear ribonucleoprotein A3	MULTI-MSMS	DP1141_9	4	690.8780517578125	2	690.877716	1379.74088	0.24361	0.0001683	0.32488	0.00022445	0.56849	0.00039276	691.3793824426118	14.111	0.1839	14.111	13.994	14.178	0					6	2	3	0	0	0	0.010959	1	4518	4518		102.05	80.002	1	3610400			461	262	297	306	626	626		9606
EEAISNMVVALK	12	Oxidation (M)	_EEAISNM(Oxidation (M))VVALK_	EEAISNM(1)VVALK	EEAISNM(190)VVALK	0	1	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	660.3468627929688	2	660.347403	1318.68025	0.91626	0.00060505	-0.50411	-0.00033289	0.41214	0.00027216	660.3471500763663	17.655	0.70101	17.655	17.304	18.005	0					21	6	5	0	0	0	4.5448E-40	2	9841	9841;9873		188.91	123.45	1	122300000			462	367;40	298	307	627;628	627	33	9606
EEAISNMVVALK	12	Unmodified	_EEAISNMVVALK_			0	0	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	652.9583740234375	2	652.349945	1302.68534	0.29643	0.00019338	0.038518	2.5127E-05	0.33495	0.0002185	652.3500891763156	19.856	0.48455	19.856	19.606	20.09	0					8	4	3	0	0	0	1.8894E-21	1	13125	13125		172.98	129.54	1	97948000			463	367;40	298	308	629	629		9606
EEEEFNTGPLSVLTQSVK	18	Unmodified	_EEEEFNTGPLSVLTQSVK_			0	0	0	P62316	P62316	P62316	SNRPD2	Small nuclear ribonucleoprotein Sm D2	MSMS	DP1141_10	5	1004.0006713867188	2	1003.99948	2005.98442	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.989	1	21.989	21.489	22.489	0								0	0	0	5.0492E-20	1	17389	17389		155.86	97.758	1				464	298	299	309	630	630		9606
EEEIAALVIDNGSGMCK	17	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))EEEIAALVIDNGSGM(Oxidation (M))CK_	EEEIAALVIDNGSGM(1)CK	EEEIAALVIDNGSGM(100)CK	1	1	0	P63261	P63261	P63261	ACTG1	Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	MULTI-MSMS	DP1141_9	4	947.9345703125	2	947.432066	1892.84958	0.95431	0.00090415	-0.74681	-0.00070755	0.20751	0.0001966	947.9332638210157	23.301	0.21669	23.301	23.186	23.403	0					6	2	3	0	0	0	0.00015116	2	18928	18856;18928		125.84	80.075	1	10889000			465	318	300	310	631;632	632	245	9606
EEFLIPIYHQVAVQFADLHDTPGR	24	Unmodified	_EEFLIPIYHQVAVQFADLHDTPGR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_10	5	699.684814453125	4	699.609243	2794.40786	1.1499	0.00080449	-0.88551	-0.00061951	0.2644	0.00018498	699.8594751180027	22.481	0.25082	22.481	22.349	22.6	0					6	2	3	0	0	0	7.7376E-08	2	18201	18201;18272		132.65	114.1	1	6404600			466	367	301	311	633;634	633		9606
EEFLIPIYHQVAVQFADLHDTPGR	24	Unmodified	_EEFLIPIYHQVAVQFADLHDTPGR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_10	5	933.1463623046875	3	932.476565	2794.40786	0.4889	0.00045589	0.54849	0.00051146	1.0374	0.00096735	933.1458074264955	22.494	0.25082	22.494	22.349	22.6	0					6	2	3	0	0	0	0.0010808	1	18277	18277		65.779	40.566	1	5728500			467	367	301	311	635	635		9606
EEFLIPIYHQVAVQFADLHDTPGR	24	Unmodified	_EEFLIPIYHQVAVQFADLHDTPGR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MSMS	DP1141_7	2	932.4549560546875	3	932.476565	2794.40786	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.5	1	22.5	22	23	0								0	0	0	2.6678E-11	1	17729	17729		131.56	98.191	1				468	367	301	311	636	636		9606
EEFLIPIYHQVAVQFADLHDTPGR	24	Unmodified	_EEFLIPIYHQVAVQFADLHDTPGR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MSMS	DP1141_9	4	932.8114624023438	3	932.476565	2794.40786	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.564	1	22.564	22.064	23.064	0								0	0	0	0.0082467	1	17714	17714		71.656	50.433	1				469	367	301	311	637	637		9606
EEGIGPENLR	10	Unmodified	_EEGIGPENLR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	557.2803344726562	2	557.280377	1112.5462	-0.23203	-0.00012931	0.56832	0.00031672	0.33629	0.00018741	557.2806791303469	16.914	0.50832	16.914	16.595	17.103	0					21	6	5	0	0	0	1.0956E-13	4	8435	8310;8435;8543;8659		166.52	115.45	1	195370000			470	367	302	312	638;639;640;641	639		9606
EEGIGPENLR	10	Unmodified	_EEGIGPENLR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	557.2806396484375	2	557.280377	1112.5462	0.38468	0.00021438	-0.062645	-3.4911E-05	0.32204	0.00017947	557.2803827024871	16.902	0.37354	16.902	16.58	16.953	0					9	4	3	0	0	0	0.010394	1	9185	9185		97.635	62.197	1	16542000			471	367	302	312	642	642		9606
EEPSNPFLAFVEK	13	Unmodified	_EEPSNPFLAFVEK_			0	0	0	Q7LBC6	Q7LBC6	Q7LBC6	KDM3B	Lysine-specific demethylase 3B	MULTI-MSMS	DP1141_7	2	753.8778686523438	2	753.877382	1505.74021	0.91317	0.00068842	-0.40234	-0.00030331	0.51083	0.00038511	754.378568139193	22.622	0.34379	22.622	22.319	22.663	0					7	3	3	0	0	0	0.0061576	1	17961	17961		91.469	50.389	1	11670000			472	447	303	313	643	643		9606
EEPSNPFLAFVEK	13	Unmodified	_EEPSNPFLAFVEK_			0	0	0	Q7LBC6	Q7LBC6	Q7LBC6	KDM3B	Lysine-specific demethylase 3B	MULTI-MSMS	DP1141_8	3	753.84375	2	753.877382	1505.74021	0.78004	0.00058805	1.6439	0.0012393	2.4239	0.0018273	753.878897643393	22.61	0.50863	22.61	22.279	22.788	0					8	5	2	0	0	0	0.0095787	1	17639	17639		87.713	46.633	1	5692800			473	447	303	313	644	644		9606
EEQQLHRQERDR	12	Unmodified	_EEQQLHRQERDR_			0	0	2	Q07283	Q07283	Q07283	TCHH	Trichohyalin	MSMS	DP1141_10	5	812.884765625	2	812.400941	1622.78733	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.762	1	18.762	18.262	19.262	0								0	0	0	0.013379	1	12544	12544		106.4	66.526	1				474	352	304	314	645	645		9606
EFGAGPLFNQILPLLMSPTLEDQER	25	Oxidation (M)	_EFGAGPLFNQILPLLM(Oxidation (M))SPTLEDQER_	EFGAGPLFNQILPLLM(1)SPTLEDQER	EFGAGPLFNQILPLLM(120)SPTLEDQER	0	1	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	944.8167114257812	3	944.480987	2830.42113	0.41352	0.00039056	0.80496	0.00076027	1.2185	0.0011508	944.8162470122043	25.155	0.48604	25.155	24.886	25.372	0					12	5	4	0	0	0	1.1908E-11	1	21616	21616		124.31	93.544	1	5386600			475	78	305	315	646	646	64	9606
EFLHAQEEVKR	11	Unmodified	_EFLHAQEEVKR_			0	0	1	P43686	P43686	P43686	PSMC4	26S protease regulatory subunit 6B	MULTI-MSMS	DP1141_9	4	462.5752258300781	3	462.577247	1384.70991	0.010007	4.6288E-06	-0.50457	-0.0002334	-0.49456	-0.00022877	462.5768340673256	14.933	0.46025	14.933	14.714	15.174	0					8	4	3	0	0	0	0.014204	1	5756	5756		78.488	24.891	1	13952000			476	230	306	316	647	647		9606
EFLIKLGLVNDK	12	Unmodified	_EFLIKLGLVNDK_			0	0	1	Q9HAU5	Q9HAU5	Q9HAU5	UPF2	Regulator of nonsense transcripts 2	MULTI-SECPEP	DP1141_10	5	695.35595703125	2	694.911027	1387.8075	1.1961	0.00083119	0.54536	0.00037898	1.7415	0.0012102	695.4133546129585	20.626	0.29952	20.626	20.476	20.775	0					4	2	2	0	0	0	0.018206	1	15219	15219		106.88	32.715	1	6342400			477	564	307	317	648	648		9606
EFQSPDEEMKK	11	Unmodified	_EFQSPDEEMKK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_6	1	456.54315185546875	3	456.543104	1366.60748	0.028565	1.3041E-05	0.40651	0.00018559	0.43508	0.00019863	456.5432763577409	15.058	0.4998	15.058	14.609	15.108	0					7	4	3	0	0	0	0.0049701	1	5573	5573		97.597	84.36	1	9057700			478	78	308	318	649	649		9606
EFQSPDEEMKK	11	Unmodified	_EFQSPDEEMKK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	456.5430603027344	3	456.543104	1366.60748	0.03841	1.7536E-05	0.13908	6.3497E-05	0.17749	8.1033E-05	456.54326623545643	15.059	0.70127	15.059	14.508	15.21	0					18	6	4	0	0	0	0.0023573	3	6139	5947;6076;6139		146.11	115.9	1	244090000			479	78	308	318	650;651;652	652		9606
EFQSPDEEMKK	11	Unmodified	_EFQSPDEEMKK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	685.3583374023438	2	684.311017	1366.60748	0.1792	0.00012263	0.48052	0.00032883	0.65972	0.00045146	684.3113414608389	15.059	0.40093	15.059	14.708	15.109	0					8	3	3	0	0	0	0.022216	1	6173	6173		125.71	69.281	1	57379000			480	78	308	318	653	653		9606
EFTEAVEAK	9	Unmodified	_EFTEAVEAK_			0	0	0	P35232	P35232	P35232	PHB	Prohibitin	MULTI-MSMS	DP1141_10	5	512.2534790039062	2	512.253297	1022.49204	0.38722	0.00019836	-0.18136	-9.2902E-05	0.20586	0.00010545	512.2532147525997	15.736	0.5331	15.736	15.533	16.066	0					11	5	4	0	0	0	0.010204	1	7564	7564		98.458	64.455	1	38796000			481	206	309	319	654	654		9606
EGLPLMVFANWR	12	Oxidation (M)	_EGLPLM(Oxidation (M))VFANWR_	EGLPLM(1)VFANWR	EGLPLM(150)VFANWR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	724.871826171875	2	724.871379	1447.72821	0.91131	0.00066058	-0.3105	-0.00022508	0.60081	0.00043551	724.8712124950438	22.704	0.46814	22.704	22.426	22.894	0					20	8	4	0	0	0	7.1783E-05	2	17541	17488;17541		150.36	120.59	1	28318000			482	367	310	320	655;656	656	267	9606
EGLPLMVFANWR	12	Oxidation (M)	_EGLPLM(Oxidation (M))VFANWR_	EGLPLM(1)VFANWR	EGLPLM(100)VFANWR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_7	2	724.8717651367188	2	724.871379	1447.72821	0.2515	0.00018231	0.098943	7.1721E-05	0.35045	0.00025403	724.8715919359263	22.703	0.31496	22.703	22.486	22.801	0					5	3	2	0	0	0	0.01003	1	18123	18123		104.2	71.88	1	20896000			483	367	310	320	657	657	267	9606
EGLPLMVFANWR	12	Oxidation (M)	_EGLPLM(Oxidation (M))VFANWR_	EGLPLM(1)VFANWR	EGLPLM(120)VFANWR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_8	3	725.183349609375	2	724.871379	1447.72821	0.3319	0.00024058	-0.022928	-1.662E-05	0.30897	0.00022397	724.8716512831289	22.704	0.38828	22.704	22.565	22.953	0					9	4	4	0	0	0	0.023846	2	17843	17843;17918		117.81	85.593	1	14954000			484	367	310	320	658;659	658	267	9606
EGLPLMVFANWR	12	Oxidation (M)	_EGLPLM(Oxidation (M))VFANWR_	EGLPLM(1)VFANWR	EGLPLM(150)VFANWR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_9	4	724.8720092773438	2	724.871379	1447.72821	0.58654	0.00042517	0.19023	0.00013789	0.77677	0.00056306	724.8715593218394	22.711	0.34913	22.711	22.43	22.779	0					10	4	4	0	0	0	2.5302E-05	1	17977	17977		153.08	124.39	1	22672000			485	367	310	320	660	660	267	9606
EGLPLMVFANWR	12	Unmodified	_EGLPLMVFANWR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	717.3758544921875	2	716.873922	1431.73329	0.43244	0.00031	0.15527	0.00011131	0.58771	0.00042131	716.8739954754923	23.909	0.30389	23.909	23.642	23.946	0					10	3	4	0	0	0	3.4096E-40	3	19797	19797;19863;19880		185.72	149.81	1	11685000			486	367	310	321	661;662;663	661		9606
EGLPLMVFANWR	12	Unmodified	_EGLPLMVFANWR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_8	3	716.8744506835938	2	716.873922	1431.73329	0.22782	0.00016332	1.301	0.00093264	1.5288	0.001096	716.8748357159161	23.903	0.31814	23.903	23.631	23.949	0					7	3	3	0	0	0	0.022149	1	19667	19667		78.149	45.829	1	4965200			487	367	310	321	664	664		9606
EGMNIVEAMER	11	2 Oxidation (M)	_EGM(Oxidation (M))NIVEAM(Oxidation (M))ER_	EGM(1)NIVEAM(1)ER	EGM(82)NIVEAM(82)ER	0	2	0	P62937	P62937	P62937	PPIA	Peptidyl-prolyl cis-trans isomerase A;Peptidyl-prolyl cis-trans isomerase A, N-terminally processed	MULTI-MSMS	DP1141_6	1	655.78955078125	2	655.789395	1309.56424	-0.10488	-6.878E-05	0.31122	0.0002041	0.20634	0.00013532	655.7897974346884	15.29	0.40211	15.29	15.108	15.51	0					7	3	3	0	0	0	0.026917	1	5986	5986		82.029	44.964	1	6261500			488	315	311	322	665	665	243;244	9606
EGPAVVGQFIQDVK	14	Unmodified	_EGPAVVGQFIQDVK_			0	0	0	Q86VP6	Q86VP6	Q86VP6	CAND1	Cullin-associated NEDD8-dissociated protein 1	MULTI-MSMS	DP1141_7	2	744.3995361328125	2	743.898648	1485.78274	0.86904	0.00064648	-0.23584	-0.00017544	0.6332	0.00047104	743.8985604201143	20.501	0.40039	20.501	20.15	20.551	0					5	3	2	0	0	0	0.0038674	1	14849	14849		108.98	65.215	1	44828000			489	458	312	323	666	666		9606
EGPLCDELIR	10	Unmodified	_EGPLCDELIR_			0	0	0	Q15029	Q15029	Q15029	EFTUD2	116 kDa U5 small nuclear ribonucleoprotein component	MULTI-MSMS	DP1141_7	2	602.0393676757812	2	601.297713	1200.58087	0.36187	0.00021759	3.9991	0.0024047	4.361	0.0026223	601.299448364008	18.8	0.2999	18.8	18.65	18.95	0					4	2	2	0	0	0	0.012178	1	12245	12245		93.598	63.28	1	33421000			490	399	313	324	667	667		9606
EGRVILERALVR	12	Unmodified	_EGRVILERALVR_			0	0	2	P62699	P62699	P62699	YPEL5	Protein yippee-like 5	MULTI-SECPEP	DP1141_10	5	705.932373046875	2	705.930617	1409.84668	1.304	0.00092056	0.9642	0.00068066	2.2682	0.0016012	705.9314042120915	22.515	0.34117	22.515	22.259	22.6	0					5	3	2	0	0	0	0.0089348	1	18264	18264		97.597	75.258	1	7527600			491	301	314	325	668	668		9606
EGSIEIDIPVPK	12	Unmodified	_EGSIEIDIPVPK_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MSMS	DP1141_10	5	648.8563232421875	2	648.855918	1295.69728	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.067	1	20.067	19.567	20.567	0								0	0	0	0.019097	1	14544	14544		131.12	100.32	1				492	521	315	326	669	669		9606
EGSIEIDIPVPK	12	Unmodified	_EGSIEIDIPVPK_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	648.8564453125	2	648.855918	1295.69728	0.4147	0.00026908	0.37608	0.00024402	0.79077	0.0005131	648.8560853542839	20.04	0.3848	20.04	19.806	20.19	0					10	3	4	0	0	0	0.0050817	2	13490	13490;13517		123.96	86.35	1	87376000			493	521	315	326	670;671	670		9606
EGSIEIDIPVPK	12	Unmodified	_EGSIEIDIPVPK_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_7	2	648.8563842773438	2	648.855918	1295.69728	0.055693	3.6136E-05	0.13493	8.7553E-05	0.19063	0.00012369	648.855839934677	20	0.59984	20	19.551	20.15	0					9	5	3	0	0	0	0.0047446	2	14095	14059;14095		147.73	102.98	1	45428000			494	521	315	326	672;673	673		9606
EGSIEIDIPVPK	12	Unmodified	_EGSIEIDIPVPK_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	649.3767700195312	2	648.855918	1295.69728	1.0031	0.00065085	-0.22327	-0.00014487	0.7798	0.00050598	648.8557392944219	20.026	0.70073	20.026	19.476	20.176	0					16	6	4	0	0	0	0.0032775	4	13822	13720;13822;13888;13923		142.83	125.68	1	380540000			495	521	315	326	674;675;676;677	675		9606
EGSIEIDIPVPK	12	Unmodified	_EGSIEIDIPVPK_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_9	4	648.8563232421875	2	648.855918	1295.69728	0.80607	0.00052302	-0.33197	-0.0002154	0.4741	0.00030762	648.8556000787386	19.988	0.69776	19.988	19.539	20.237	0					14	6	4	0	0	0	0.0024805	3	13894	13894;13922;14004		151.22	109.83	1	48244000			496	521	315	326	678;679;680	678		9606
EGTLTQVPLAPPPPGAPPSPAPAR	24	Unmodified	_EGTLTQVPLAPPPPGAPPSPAPAR_			0	0	0	P48634	P48634	P48634	PRRC2A	Protein PRRC2A	MULTI-MSMS	DP1141_7	2	773.9036865234375	3	773.42162	2317.24303	0.45504	0.00035194	-1.0653	-0.0008239	-0.61023	-0.00047197	773.7551995829615	19.1	0.30053	19.1	18.95	19.25	0					4	2	2	0	0	0	0.026368	1	12769	12769		41.017	27.59	1	6113200			497	243	316	327	681	681		9606
EHALLAYTLGVK	12	Unmodified	_EHALLAYTLGVK_			0	0	0	P68104;Q5VTE0;Q05639	P68104	P68104	EEF1A1;EEF1A1P5;EEF1A2	Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3;Elongation factor 1-alpha 2	MULTI-MSMS	DP1141_9	4	657.8670654296875	2	657.874445	1313.73434	1.0098	0.00066433	-0.38941	-0.00025618	0.6204	0.00040815	658.3755540332024	19.088	0.30088	19.088	18.837	19.138	0					6	2	3	0	0	0	2.2779999999999997E-66	1	12377	12377		201.61	161.99	1	9258100			498	320	317	328	682	682		9606
EHALLAYTLGVK	12	Unmodified	_EHALLAYTLGVK_			0	0	0	P68104;Q5VTE0;Q05639	P68104	P68104	EEF1A1;EEF1A1P5;EEF1A2	Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3;Elongation factor 1-alpha 2	MULTI-SECPEP	DP1141_9	4	439.2733154296875	3	438.918722	1313.73434	0.038296	1.6809E-05	0.21455	9.4169E-05	0.25284	0.00011098	438.9186619986504	19.088	0.30088	19.088	18.837	19.138	0					4	2	2	0	0	0	0.0022661	1	12411	12411		115.29	83.068	1	5495200			499	320	317	328	683	683		9606
EHFQHVAAPYIAK	13	Unmodified	_EHFQHVAAPYIAK_			0	0	0	Q9H2P0	Q9H2P0	Q9H2P0	ADNP	Activity-dependent neuroprotector homeobox protein	MULTI-SECPEP	DP1141_9	4	503.89520263671875	3	504.264892	1509.77285	-0.262	-0.00013212	-2.1444	-0.0010813	-2.4064	-0.0012134	504.5979048261911	16.008	0.98653	16.008	15.372	16.358	0					21	9	4	0	0	0	0.027711	1	7581	7581		68.463	37.466	1	18303000			500	559	318	329	684	684		9606
EHHFGSSGMTLHER	14	Unmodified	_EHHFGSSGMTLHER_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_7	2	542.7908325195312	3	542.247684	1623.72122	0.077612	4.2085E-05	0.29918	0.00016223	0.37679	0.00020431	542.2479559450229	14.658	0.30041	14.658	14.508	14.809	0					6	2	3	0	0	0	0.00088589	1	5633	5633		126.09	111.14	1	20023000			501	612	319	330	685	685		9606
EHHFGSSGMTLHER	14	Unmodified	_EHHFGSSGMTLHER_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_7	2	406.9377136230469	4	406.937582	1623.72122	-0.031726	-1.291E-05	0.051648	2.1017E-05	0.019922	8.107E-06	406.9376855547783	14.658	0.40066	14.658	14.508	14.909	0					10	3	4	0	0	0	0.0021558	1	5670	5670		82.515	71.345	1	63525000			502	612	319	330	686	686		9606
EHHFGSSGMTLHER	14	Unmodified	_EHHFGSSGMTLHER_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-SECPEP	DP1141_9	4	406.42755126953125	4	406.937582	1623.72122	0.25807	0.00010502	-0.62926	-0.00025607	-0.37118	-0.00015105	406.93739652804186	14.75	0.32222	14.75	14.473	14.795	0					7	3	3	0	0	0	0.017724	1	5357	5357		60.55	42.633	1	8239200			503	612	319	330	687	687		9606
EHLELLKHMHTVGEK	15	Oxidation (M)	_EHLELLKHM(Oxidation (M))HTVGEK_	EHLELLKHM(1)HTVGEK	EHLELLKHM(64)HTVGEK	0	1	1	Q7Z2E3	Q7Z2E3	Q7Z2E3	APTX	Aprataxin	MULTI-SECPEP	DP1141_7	2	605.6368408203125	3	606.317327	1815.93015	0.22309	0.00013527	0.81689	0.00049529	1.04	0.00063056	606.3166441807398	15.409	0.30214	15.409	15.21	15.512	0					4	2	2	0	0	0	0.015295	1	6579	6579		64.224	33.01	1	2621100			504	448	320	331	688	688	334	9606
EHVEPVFGFPQFVR	14	Unmodified	_EHVEPVFGFPQFVR_			0	0	0	O75792	O75792	O75792	RNASEH2A	Ribonuclease H2 subunit A	MULTI-MSMS	DP1141_9	4	563.6344604492188	3	563.291219	1686.85183	0.22285	0.00012553	-1.1808	-0.00066512	-0.95792	-0.00053959	563.2897001255097	21.03	0.50114	21.03	20.636	21.138	0					5	4	2	0	0	0	0.0011827	1	15437	15437		104.17	78.853	1	2153800			505	81	321	332	689	689		9606
EIAEAYLGK	9	Unmodified	_EIAEAYLGK_			0	0	0	P11142	P11142	P11142	HSPA8	Heat shock cognate 71 kDa protein	MULTI-SECPEP	DP1141_8	3	496.74365234375	2	497.266207	992.517862	0.49731	0.00024729	-0.030172	-1.5003E-05	0.46714	0.00023229	497.26622486918586	17.323	0.40122	17.323	17.073	17.474	0					7	3	3	0	0	0	0.019994	1	9644	9644		96.492	26.493	1	47927000			506	140	322	333	690	690		9606
EIAQDFKTDLR	11	Unmodified	_EIAQDFKTDLR_			0	0	1	Q71DI3;Q16695;P84243;P68431	Q71DI3	Q71DI3	HIST2H3A;HIST3H3;H3F3A;HIST1H3A	Histone H3.2;Histone H3.1t;Histone H3.3;Histone H3.1	MULTI-MSMS	DP1141_10	5	446.245849609375	3	445.90162	1334.68303	-0.61434	-0.00027393	1.9653	0.00087633	1.351	0.0006024	446.237136060285	17.237	0.90959	17.237	16.878	17.788	0					18	9	3	0	0	0	0.021642	1	9954	9954		113.69	73.671	1	32254000			507	324	323	334	691	691		9606
EIAQDFKTDLR	11	Unmodified	_EIAQDFKTDLR_			0	0	1	Q71DI3;Q16695;P84243;P68431	Q71DI3	Q71DI3	HIST2H3A;HIST3H3;H3F3A;HIST1H3A	Histone H3.2;Histone H3.1t;Histone H3.3;Histone H3.1	MULTI-MSMS	DP1141_10	5	668.3709716796875	2	668.348791	1334.68303	-0.4645	-0.00031045	1.0336	0.00069078	0.56905	0.00038033	668.3495454446372	17.237	0.38231	17.237	17.005	17.387	0					6	3	2	0	0	0	1.1836E-51	1	9991	9991		194.12	118.02	1	22962000			508	324	323	334	692	692		9606
EIEELKELLPEIR	13	Unmodified	_EIEELKELLPEIR_			0	0	1	P49321	P49321	P49321	NASP	Nuclear autoantigenic sperm protein	MULTI-MSMS	DP1141_7	2	805.9449462890625	2	805.95362	1609.89269	0.79322	0.0006393	-0.0070503	-5.6822E-06	0.78617	0.00063362	805.9532474313712	21.248	0.30011	21.248	21.05	21.35	0					4	2	2	0	0	0	4.0394999999999995E-80	1	15829	15829		168.85	131.13	1	7504800			509	245	324	335	693	693		9606
EIEFLPSR	8	Unmodified	_EIEFLPSR_			0	0	0	O00763	O00763	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	495.7948303222656	2	495.766374	989.518196	0.46961	0.00023281	0.23785	0.00011792	0.70746	0.00035073	495.76659728595666	19.055	0.3002	19.055	18.805	19.105	0					4	2	2	0	0	0	0.0010543	1	11937	11937		130.04	52.117	1	9225700			510	40	325	336	694	694		9606
EIETYHNLLEGGQEDFESSGAGK	23	Unmodified	_EIETYHNLLEGGQEDFESSGAGK_			0	0	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_6	1	838.415283203125	3	837.382107	2509.12449	1.1247	0.0009418	-0.71301	-0.00059706	0.41169	0.00034474	837.7159790293555	19.355	0.40025	19.355	19.205	19.606	0					11	3	5	0	0	0	1.6278E-55	2	12587	12587;12601		133.21	113.81	1	37166000		+	511	19	326	337	695;696	695		9606
EIETYHNLLEGGQEDFESSGAGK	23	Unmodified	_EIETYHNLLEGGQEDFESSGAGK_			0	0	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-SECPEP	DP1141_8	3	838.15673828125	3	837.382107	2509.12449	0.89903	0.00075283	-0.42251	-0.0003538	0.47652	0.00039903	837.7162166089852	19.426	0.3004	19.426	19.175	19.476	0					6	2	3	0	0	0	2.8827E-48	1	12987	12987		164.89	151.3	1	45437000		+	512	19	326	337	697	697		9606
EIFLSQPILLELEAPLK	17	Unmodified	_EIFLSQPILLELEAPLK_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MSMS	DP1141_10	5	977.0679321289062	2	977.068985	1952.12342	NaN	NaN	NaN	NaN	NaN	NaN	NaN	24.473	1	24.473	23.973	24.973	0								0	0	0	2.9956E-135	1	21056	21056		210.93	136.23	1				513	286;212;287	327	338	698	698		9606
EIFLSQPILLELEAPLK	17	Unmodified	_EIFLSQPILLELEAPLK_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_7	2	977.5703125	2	977.068985	1952.12342	0.41208	0.00040263	-0.0019915	-1.9458E-06	0.41008	0.00040068	977.5706265773256	24.439	0.23679	24.439	24.243	24.48	0					4	2	2	0	0	0	2.8684E-33	1	20642	20642		180.61	140.55	1	9779600			514	286;212;287	327	338	699	699		9606
EIFLSQPILLELEAPLK	17	Unmodified	_EIFLSQPILLELEAPLK_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_8	3	977.5701904296875	2	977.068985	1952.12342	0.40365	0.0003944	0.44136	0.00043124	0.84501	0.00082563	977.5708278642185	24.421	0.3389	24.421	24.194	24.533	0					11	3	4	0	0	0	3.2653E-247	3	20378	20360;20378;20465		255.54	236.96	1	76262000			515	286;212;287	327	338	700;701;702	701		9606
EIFLSQPILLELEAPLK	17	Unmodified	_EIFLSQPILLELEAPLK_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_9	4	977.5732421875	2	977.068985	1952.12342	1.1742	0.0011472	0.40286	0.00039362	1.577	0.0015409	977.5708309142937	24.482	0.58425	24.482	24.037	24.621	0					12	6	4	0	0	0	1.3177999999999999E-219	1	20501	20501		253.42	192.18	1	11542000			516	286;212;287	327	338	703	703		9606
EIIDLVLDR	9	Unmodified	_EIIDLVLDR_			0	0	0	P68363;Q71U36	P68363;Q71U36	P68363	TUBA1B;TUBA1A	Tubulin alpha-1B chain;Tubulin alpha-1A chain	MSMS	DP1141_6	1	543.7559204101562	2	543.313689	1084.61282	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.316	1	21.316	20.816	21.816	0								0	0	0	1.1423E-43	1	15431	15431		176.09	74.76	1				517	321;442	328	339	704	704		9606
EIIDLVLDR	9	Unmodified	_EIIDLVLDR_			0	0	0	P68363;Q71U36	P68363;Q71U36	P68363	TUBA1B;TUBA1A	Tubulin alpha-1B chain;Tubulin alpha-1A chain	MSMS	DP1141_6	1	543.3140258789062	2	543.313689	1084.61282	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.365	1	21.365	20.865	21.865	0								0	0	0	9.5387E-33	1	15507	15507		170.3	73.805	1				518	321;442	328	339	705	705		9606
EIIDLVLDR	9	Unmodified	_EIIDLVLDR_			0	0	0	P68363;Q71U36	P68363;Q71U36	P68363	TUBA1B;TUBA1A	Tubulin alpha-1B chain;Tubulin alpha-1A chain	MULTI-MSMS	DP1141_8	3	544.302490234375	2	543.313689	1084.61282	0.73574	0.00039974	-0.12975	-7.0496E-05	0.60598	0.00032924	543.3137552011989	21.33	0.50137	21.33	21.178	21.679	0					5	3	2	0	0	0	0.0047867	2	15823	15823;15924		122.19	53.805	1	945910000			519	321;442	328	339	706;707	706		9606
EIISNLAK	8	Unmodified	_EIISNLAK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	444.2635498046875	2	444.263468	886.512382	0.71077	0.00031577	-0.86354	-0.00038364	-0.15277	-6.7871E-05	444.26320361845757	16.594	0.53835	16.594	16.415	16.953	0					17	6	3	0	0	0	0.0002199	2	8616	8616;8621		128.86	18.792	1	1394900000			520	78	329	340	708;709	708		9606
EILGTAQSVGCNVDGR	16	Unmodified	_EILGTAQSVGCNVDGR_			0	0	0	P30050	P30050	P30050	RPL12	60S ribosomal protein L12	MULTI-SECPEP	DP1141_10	5	837.9171142578125	2	838.407043	1674.79953	-0.23225	-0.00019472	0.67735	0.00056789	0.44509	0.00037317	838.4078053373574	17.538	0.30041	17.538	17.287	17.588	0					6	2	3	0	0	0	0.017208	1	10478	10478		84.169	56.741	1	68869000			521	197	330	341	710	710		9606
EITALAPSTMK	11	Oxidation (M)	_EITALAPSTM(Oxidation (M))K_	EITALAPSTM(1)K	EITALAPSTM(60)K	0	1	0	P60709;P68133;P68032;P63267;P62736;P63261	P60709;P63261	P60709	ACTB;ACTA1;ACTC1;ACTG2;ACTA2;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, alpha skeletal muscle;Actin, alpha cardiac muscle 1;Actin, gamma-enteric smooth muscle;Actin, aortic smooth muscle;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	MULTI-SECPEP	DP1141_7	2	589.297607421875	2	589.310289	1176.60602	0.8645	0.00050946	-0.41548	-0.00024485	0.44902	0.00026461	589.3100034546995	16.165	0.30021	16.165	15.914	16.215	0					4	2	2	0	0	0	0.026709	1	7909	7909		60.167	8.6392	1	33933000			522	277;318	331	342	711	711	228	9606
EITALAPSTMK	11	Oxidation (M)	_EITALAPSTM(Oxidation (M))K_	EITALAPSTM(1)K	EITALAPSTM(110)K	0	1	0	P60709;P68133;P68032;P63267;P62736;P63261	P60709;P63261	P60709	ACTB;ACTA1;ACTC1;ACTG2;ACTA2;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, alpha skeletal muscle;Actin, alpha cardiac muscle 1;Actin, gamma-enteric smooth muscle;Actin, aortic smooth muscle;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	MULTI-SECPEP	DP1141_9	4	588.8060913085938	2	589.310289	1176.60602	0.40897	0.00024101	0.11824	6.9677E-05	0.5272	0.00031069	589.310144778036	16.108	0.38557	16.108	15.872	16.258	0					7	3	3	0	0	0	0.021674	1	7699	7699		112.3	70.419	1	29418000			523	277;318	331	342	712	712	228	9606
EITALAPSTMK	11	Unmodified	_EITALAPSTMK_			0	0	0	P60709;P68133;P68032;P63267;P62736;P63261	P60709;P63261	P60709	ACTB;ACTA1;ACTC1;ACTG2;ACTA2;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, alpha skeletal muscle;Actin, alpha cardiac muscle 1;Actin, gamma-enteric smooth muscle;Actin, aortic smooth muscle;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	MULTI-SECPEP	DP1141_7	2	581.790771484375	2	581.312832	1160.61111	0.77174	0.00044862	-0.03903	-2.2688E-05	0.73271	0.00042593	581.3128363312422	17.4	0.40028	17.4	17.149	17.549	0					5	3	2	0	0	0	0.0047861	1	9922	9922		104.42	80.901	1	38355000			524	277;318	331	343	713	713		9606
EITALAPSTMK	11	Unmodified	_EITALAPSTMK_			0	0	0	P60709;P68133;P68032;P63267;P62736;P63261	P60709;P63261	P60709	ACTB;ACTA1;ACTC1;ACTG2;ACTA2;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, alpha skeletal muscle;Actin, alpha cardiac muscle 1;Actin, gamma-enteric smooth muscle;Actin, aortic smooth muscle;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	MULTI-MSMS	DP1141_9	4	581.636474609375	2	581.312832	1160.61111	0.32712	0.00019016	0.19643	0.00011419	0.52355	0.00030435	581.3129917213008	17.387	0.29965	17.387	17.238	17.537	0					4	2	2	0	0	0	0.0070298	1	9776	9776		99.013	56.822	1	29959000			525	277;318	331	343	714	714		9606
EIVHLQAGQCGNQIGAK	17	Unmodified	_EIVHLQAGQCGNQIGAK_			0	0	0	P68371;P04350	P68371	P68371	TUBB4B;TUBB4A	Tubulin beta-4B chain;Tubulin beta-4A chain	MULTI-MSMS	DP1141_6	1	608.3145751953125	3	608.312465	1821.91557	0.2752	0.00016741	0.26284	0.00015989	0.53805	0.0003273	608.3128698055626	16.255	0.40047	16.255	16.005	16.405	0					5	3	2	0	0	0	0.00021706	1	7451	7451		103.66	0	1	8780700			526	323	332	344	715	715		9606
EIVHLQAGQCGNQIGAK	17	Unmodified	_EIVHLQAGQCGNQIGAK_			0	0	0	P68371;P04350	P68371	P68371	TUBB4B;TUBB4A	Tubulin beta-4B chain;Tubulin beta-4A chain	MULTI-MSMS	DP1141_9	4	609.3312377929688	3	608.312465	1821.91557	-0.31034	-0.00018878	0.72692	0.0004422	0.41659	0.00025341	608.3130979798526	16.208	0.40007	16.208	16.058	16.458	0					11	3	5	0	0	0	0.0012826	1	7834	7834		124.16	0	1	134290000			527	323	332	344	716	716		9606
EKAQELSDWIHQLESEK	17	Unmodified	_EKAQELSDWIHQLESEK_			0	0	1	P13805	P13805	P13805	TNNT1	Troponin T, slow skeletal muscle	MSMS	DP1141_10	5	1035.1429443359375	2	1035.51055	2069.00655	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.591	1	20.591	20.091	21.091	0								0	0	0	0.0038641	1	15333	15333		110.39	25.729	1				528	148	333	345	717	717		9606
EKLCYVALDFEQEMATAASSSSLEK	25	Unmodified	_EKLCYVALDFEQEMATAASSSSLEK_			0	0	1	P60709;Q6S8J3;P63261	P60709;P63261	P60709	ACTB;POTEE;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;POTE ankyrin domain family member E;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	MULTI-MSMS	DP1141_10	5	562.469482421875	5	562.268099	2806.30411	1.0997	0.00061833	-0.41832	-0.00023521	0.68138	0.00038312	562.468621275429	18.825	0.69003	18.825	18.387	19.077	0					32	6	7	0	0	0	0.023361	1	12655	12655		34.817	9.9208	1	327590000			529	277;318	334	346	718	718		9606
EKLCYVALDFEQEMATAASSSSLEK	25	Unmodified	_EKLCYVALDFEQEMATAASSSSLEK_			0	0	1	P60709;Q6S8J3;P63261	P60709;P63261	P60709	ACTB;POTEE;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;POTE ankyrin domain family member E;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	MULTI-MSMS	DP1141_9	4	562.4695434570312	5	562.268099	2806.30411	0.30949	0.00017402	0.48818	0.00027449	0.79767	0.0004485	562.4691712836657	18.787	0.6008	18.787	18.537	19.138	0					21	5	5	0	0	0	0.033206	1	12162	12162		31.176	16.599	1	217500000			530	277;318	334	346	719	719		9606
EKPQTLPSAVK	11	Unmodified	_EKPQTLPSAVK_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-SECPEP	DP1141_8	3	599.5452880859375	2	599.34552	1196.67649	0.20369	0.00012208	0.33162	0.00019876	0.53531	0.00032084	599.3457024518832	14.31	0.33607	14.31	14.109	14.445	0					6	3	2	0	0	0	1.5272E-12	1	4931	4931		178.54	74.485	1	36837000			531	365	335	347	720	720		9606
EKPQTLPSAVK	11	Unmodified	_EKPQTLPSAVK_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	599.9328002929688	2	599.34552	1196.67649	0.094253	5.649E-05	0.49767	0.00029827	0.59192	0.00035476	599.3457430147959	14.344	0.29508	14.344	14.178	14.473	0					7	3	3	0	0	0	0.028652	1	4745	4745		130.01	59.75	1	17374000			532	365	335	347	721	721		9606
EKPQTLPSAVKGDEK	15	Unmodified	_EKPQTLPSAVKGDEK_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_10	5	542.9620971679688	3	542.961427	1625.86245	0.041359	2.2456E-05	0.67649	0.00036731	0.71785	0.00038977	542.9619287040605	14	0.3814	14	13.772	14.153	0					20	6	5	0	0	0	1.0266E-08	2	4730	4730;4793		146.27	115.18	1	38513000			533	365	336	348	722;723	722		9606
EKPQTLPSAVKGDEK	15	Unmodified	_EKPQTLPSAVKGDEK_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_10	5	406.9770812988281	4	407.472889	1625.86245	0.52345	0.00021329	0.022129	9.0169E-06	0.54557	0.00022231	407.47283056836477	14.001	0.31796	14.001	13.772	14.09	0					14	4	4	0	0	0	0.0011798	4	4791	4754;4791;4795;4879		115.83	98.401	1	15188000			534	365	336	348	724;725;726;727	725		9606
EKPQTLPSAVKGDEK	15	Unmodified	_EKPQTLPSAVKGDEK_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_6	1	542.9616088867188	3	542.961427	1625.86245	0.27601	0.00014986	0.030504	1.6563E-05	0.30652	0.00016643	542.9616493022553	14.012	0.65376	14.012	13.657	14.31	0					27	7	6	0	0	0	1.2158E-68	2	4076	3971;4076		175.27	143.69	1	149260000			535	365	336	348	728;729	729		9606
EKPQTLPSAVKGDEK	15	Unmodified	_EKPQTLPSAVKGDEK_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_6	1	407.4730224609375	4	407.472889	1625.86245	-0.075316	-3.0689E-05	0.080273	3.2709E-05	0.0049567	2.0197E-06	407.4730486533366	14.012	0.75234	14.012	13.657	14.409	0					25	8	5	0	0	0	0.0014853	2	3983	3983;4077		130.47	110.69	1	69624000			536	365	336	348	730;731	730		9606
EKPQTLPSAVKGDEK	15	Unmodified	_EKPQTLPSAVKGDEK_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_6	1	814.263916015625	2	813.938502	1625.86245	0.34106	0.0002776	-0.31488	-0.00025629	0.026185	2.1313E-05	814.4396368593286	14.012	0.32199	14.012	13.811	14.133	0					8	3	3	0	0	0	0.00019102	1	4055	4055		151.16	89.399	1	2611700			537	365	336	348	732	732		9606
EKPQTLPSAVKGDEK	15	Unmodified	_EKPQTLPSAVKGDEK_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_7	2	542.9617309570312	3	542.961427	1625.86245	0.59562	0.0003234	-0.10917	-5.9276E-05	0.48645	0.00026412	542.9613733287812	13.99	0.41983	13.99	13.701	14.121	0					13	4	4	0	0	0	1.9609E-09	1	4523	4523		143.93	105.74	1	62146000			538	365	336	348	733	733		9606
EKPQTLPSAVKGDEK	15	Unmodified	_EKPQTLPSAVKGDEK_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_7	2	407.4729309082031	4	407.472889	1625.86245	0.50049	0.00020394	-0.11719	-4.775E-05	0.3833	0.00015619	407.47281531165055	13.99	0.60783	13.99	13.701	14.309	0					15	6	5	0	0	0	0.0011798	1	4532	4532		120.29	106.35	1	28784000			539	365	336	348	734	734		9606
EKPQTLPSAVKGDEK	15	Unmodified	_EKPQTLPSAVKGDEK_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	542.9615478515625	3	542.961427	1625.86245	0.40828	0.00022168	-0.19826	-0.00010765	0.21002	0.00011403	542.9614643285947	14.013	0.83308	14.013	13.52	14.354	0					32	10	6	0	0	0	7.2643E-10	4	4273	4084;4138;4273;4321		151.49	119.05	1	1019599999.9999999			540	365	336	348	735;736;737;738	737		9606
EKPQTLPSAVKGDEK	15	Unmodified	_EKPQTLPSAVKGDEK_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	407.4729309082031	4	407.472889	1625.86245	0.090219	3.6762E-05	0.030319	1.2354E-05	0.12054	4.9116E-05	407.47294799673574	14.013	0.76631	14.013	13.587	14.354	0					32	9	6	0	0	0	3.2231E-06	2	4330	4330;4443		136.14	108.66	1	420430000			541	365	336	348	739;740	739		9606
EKPQTLPSAVKGDEK	15	Unmodified	_EKPQTLPSAVKGDEK_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	813.9386596679688	2	813.938502	1625.86245	0.56148	0.00045701	-0.33985	-0.00027662	0.22163	0.00018039	813.9382241298341	14.013	0.37931	14.013	13.729	14.109	0					10	4	4	0	0	0	5.647E-138	2	4455	4455;4496		227.06	153.17	1	43836000			542	365	336	348	741;742	741		9606
EKPQTLPSAVKGDEK	15	Unmodified	_EKPQTLPSAVKGDEK_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	543.2958984375	3	542.961427	1625.86245	0.58413	0.00031716	-0.35458	-0.00019252	0.22955	0.00012464	542.9614773833299	14.02	0.7113	14.02	13.601	14.312	0					38	10	6	0	0	0	0.0020138	2	4178	4126;4178		123.72	83.971	1	338510000			543	365	336	348	743;744	744		9606
EKPQTLPSAVKGDEK	15	Unmodified	_EKPQTLPSAVKGDEK_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	407.4729309082031	4	407.472889	1625.86245	0.10174	4.1455E-05	-0.057653	-2.3492E-05	0.044084	1.7963E-05	407.4729718679248	14.02	0.57499	14.02	13.672	14.247	0					33	8	6	0	0	0	9.0334E-10	2	4253	4186;4253		139.64	122.21	1	132410000			544	365	336	348	745;746	746		9606
EKPQTLPSAVKGDEK	15	Unmodified	_EKPQTLPSAVKGDEK_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MSMS	DP1141_9	4	813.9390258789062	2	813.938502	1625.86245	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.022	1	14.022	13.522	14.522	0								0	0	0	9.264499999999999E-129	1	4331	4331		207.47	142.74	1				545	365	336	348	747	747		9606
EKSRMNLPK	9	Oxidation (M)	_EKSRM(Oxidation (M))NLPK_	EKSRM(1)NLPK	EKSRM(83)NLPK	0	1	2	Q14746	Q14746	Q14746	COG2	Conserved oligomeric Golgi complex subunit 2	MULTI-SECPEP	DP1141_7	2	559.7581787109375	2	559.802965	1117.59138	0.41232	0.00023082	-0.57922	-0.00032425	-0.1669	-9.3432E-05	559.8025949600868	16.176	0.40018	16.176	15.914	16.315	0					5	3	2	0	0	0	0.02004	1	7605	7605		82.75	25.94	1	8363000			546	393	337	349	748	748	302	9606
EKVDSQYPPVQR	12	Unmodified	_EKVDSQYPPVQR_			0	0	1	P49790	P49790	P49790	NUP153	Nuclear pore complex protein Nup153	MULTI-MSMS	DP1141_8	3	482.58453369140625	3	482.584291	1444.73104	0.55062	0.00026572	0.72099	0.00034794	1.2716	0.00061366	482.5841791295578	14.633	0.71838	14.633	14.354	15.072	0					18	7	4	0	0	0	0.016398	1	5423	5423		91.313	69.238	1	17188000			547	252	338	350	749	749		9606
EKVDSQYPPVQR	12	Unmodified	_EKVDSQYPPVQR_			0	0	1	P49790	P49790	P49790	NUP153	Nuclear pore complex protein Nup153	MULTI-MSMS	DP1141_9	4	482.9230041503906	3	482.584291	1444.73104	0.44962	0.00021698	0.6732	0.00032487	1.1228	0.00054185	482.5843888090075	14.589	0.5748	14.589	14.312	14.887	0					19	6	4	0	0	0	0.01672	1	5140	5140		89.805	56.053	1	9566600			548	252	338	350	750	750		9606
EKYGINTDPPK	11	Unmodified	_EKYGINTDPPK_			0	0	1	Q9Y3B4	Q9Y3B4	Q9Y3B4	SF3B6	Splicing factor 3B subunit 6	MULTI-MSMS	DP1141_10	5	421.21856689453125	3	421.218949	1260.63502	0.19487	8.2085E-05	-2.5937	-0.0010925	-2.3989	-0.0010104	421.218977902711	15.24	0.94215	15.24	14.667	15.609	0					29	11	4	0	0	0	0.025636	2	6531	6464;6531		94.363	35.519	1	54211000			549	615	339	351	751;752	752		9606
EKYIDQELNK	10	Unmodified	_EKYIDQELNK_			0	0	1	Q58FG0	Q58FG0	Q58FG0	HSP90AA5P	Putative heat shock protein HSP 90-alpha A5	MSMS	DP1141_6	1	640.3043212890625	2	640.330067	1278.64558	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.804	1	14.804	14.304	15.304	0								0	0	0	0.01804	1	5135	5135		122.19	35.354	1				550	417	340	352	753	753		9606
ELAEDGYSGVEVR	13	Unmodified	_ELAEDGYSGVEVR_			0	0	0	P23396	P23396	P23396	RPS3	40S ribosomal protein S3	MULTI-MSMS	DP1141_10	5	712.3392944335938	2	712.33862	1422.66269	0.6921	0.00049301	-0.26723	-0.00019035	0.42488	0.00030266	712.3384899050749	17.538	0.60028	17.538	17.287	17.887	0					12	5	4	0	0	0	1.9604E-66	2	10595	10357;10595		199.33	142.9	1	184940000			551	182	341	353	754;755	755		9606
ELALALQEALEPAVR	15	Unmodified	_ELALALQEALEPAVR_			0	0	0	Q5RKV6	Q5RKV6	Q5RKV6	EXOSC6	Exosome complex component MTR3	MULTI-MSMS	DP1141_10	5	812.4097900390625	2	811.959237	1621.90392	0.70528	0.00057266	0.25223	0.0002048	0.9575	0.00077745	811.959572131578	22.108	0.58982	22.108	21.759	22.349	0					8	5	3	0	0	0	1.9322E-31	2	17434	17434;17600		182.41	144.73	1	14388000			552	418	342	354	756;757	756		9606
ELAPAVSVLQLFCSSPK	17	Unmodified	_ELAPAVSVLQLFCSSPK_			0	0	0	Q9UBF2;Q9Y678	Q9UBF2	Q9UBF2	COPG2;COPG1	Coatomer subunit gamma-2;Coatomer subunit gamma-1	MULTI-MSMS	DP1141_8	3	924.4844360351562	2	923.492587	1844.97062	0.29435	0.00027183	1.2076	0.0011152	1.502	0.0013871	923.4939555450521	23.665	0.22535	23.665	23.485	23.711	0					4	2	2	0	0	0	0.011883	1	19205	19205		83.729	48.206	1	5472100			553	588	343	355	758	758		9606
ELEPGDGPIAVIVCPTR	17	Unmodified	_ELEPGDGPIAVIVCPTR_			0	0	0	Q86XP3	Q86XP3	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	MULTI-MSMS	DP1141_7	2	911.972900390625	2	911.972019	1821.92948	0.68236	0.00062229	0.26045	0.00023752	0.94281	0.00085981	911.972364199411	20.8	0.39962	20.8	20.551	20.95	0					9	3	3	0	0	0	0.0031569	2	15390	15282;15390		108.59	75.736	1	17749000			554	460	344	356	759;760	760		9606
ELEQVCNPIISGLYQGAGGPGPGGFGAQGPK	31	Unmodified	_ELEQVCNPIISGLYQGAGGPGPGGFGAQGPK_			0	0	0	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MSMS	DP1141_8	3	1019.0208740234375	3	1019.16958	3054.48692	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.781	1	21.781	21.281	22.281	0								0	0	0	7.8814E-12	1	16463	16463		101.71	80.219	1				555	135	345	357	761	761		9606
ELGITALHIK	10	Unmodified	_ELGITALHIK_			0	0	0	P62263	P62263	P62263	RPS14	40S ribosomal protein S14	MULTI-MSMS	DP1141_10	5	548.34814453125	2	547.832049	1093.64954	0.069444	3.8044E-05	0.49032	0.00026862	0.55977	0.00030666	547.8323740649298	18.337	0.2995	18.337	18.187	18.487	0					4	2	2	0	0	0	0.0062267	1	11955	11955		120.87	38.197	1	14779000			556	291	346	358	762	762		9606
ELGPDGEEAEGPGAGDGPPR	20	Unmodified	_ELGPDGEEAEGPGAGDGPPR_			0	0	0	P18615	P18615	P18615	NELFE	Negative elongation factor E	MULTI-MSMS	DP1141_9	4	953.9254760742188	2	953.924308	1905.83406	0.54128	0.00051634	-0.20367	-0.00019429	0.33761	0.00032205	953.9247196280767	16.556	0.33448	16.556	16.358	16.693	0					9	3	3	0	0	0	1.829E-12	2	8478	8478;8510		190.57	156.78	1	11833000			557	168	347	359	763;764	763		9606
ELGQITQK	8	Unmodified	_ELGQITQK_			0	0	0		REV__A5PLK6	REV__A5PLK6			MULTI-MSMS	DP1141_6	1	458.7586669921875	2	458.758549	915.502546	1.0221	0.0004689	-1.0266	-0.00047094	-0.0044512	-2.042E-06	458.75821386739494	17.655	0.50063	17.655	17.404	17.905	0					7	4	2	0	0	0	0.018941	1	9947	9947		97.602	8.2327	1	3305600	+		558	623	348	360	765	765		9606
ELHGQNPVVTPCNK	14	Unmodified	_ELHGQNPVVTPCNK_			0	0	0	Q16630	Q16630	Q16630	CPSF6	Cleavage and polyadenylation specificity factor subunit 6	MULTI-SECPEP	DP1141_8	3	531.9158325195312	3	531.599835	1591.77767	0.11485	6.1056E-05	0.2783	0.00014795	0.39316	0.000209	531.5999457678676	14.624	0.41871	14.624	14.354	14.772	0					7	4	2	0	0	0	0.026557	1	5249	5249		65.092	31.124	1	50741000			559	413	349	361	766	766		9606
ELIIGDR	7	Unmodified	_ELIIGDR_			0	0	0	P25705	P25705	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_10	5	408.2347717285156	2	408.23471	814.454868	0.012729	5.1965E-06	0.30209	0.00012333	0.31482	0.00012852	408.23478809827066	17.045	0.30909	17.045	16.878	17.187	0					7	3	3	0	0	0	0.02476	1	9759	9759		100.07	17.804	1	30655000			560	187	350	362	767	767		9606
ELIIGDR	7	Unmodified	_ELIIGDR_			0	0	0	P25705	P25705	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_7	2	408.2350769042969	2	408.23471	814.454868	0.38401	0.00015676	0.15684	6.4026E-05	0.54084	0.00022079	408.234732119666	17.003	0.41104	17.003	16.738	17.149	0					6	4	2	0	0	0	0.022555	1	9265	9265		100.74	31.359	1	17312000			561	187	350	362	768	768		9606
ELINLIQCR	9	Unmodified	_ELINLIQCR_			0	0	0	Q9UK61	Q9UK61	Q9UK61	FAM208A	Protein FAM208A	MULTI-MSMS	DP1141_7	2	579.8173217773438	2	579.818615	1157.62268	0.58609	0.00033982	-2.0662	-0.001198	-1.4801	-0.00085821	579.8173641747014	19.7	0.49968	19.7	19.551	20.05	0					5	4	2	0	0	0	0.0040625	1	13724	13724		104.75	57.089	1	40147000			562	595	351	363	769	769		9606
ELIPNIPFQMLLR	13	Oxidation (M)	_ELIPNIPFQM(Oxidation (M))LLR_	ELIPNIPFQM(1)LLR	ELIPNIPFQM(140)LLR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	800.4505615234375	2	800.449994	1598.88543	0.59135	0.00047334	0.11369	9.1001E-05	0.70503	0.00056434	800.4502870233725	23.161	0.37289	23.161	22.906	23.278	0					18	4	5	0	0	0	0.0028794	1	18644	18644		137.95	90.766	1	517430000			563	142	352	364	770	770	139	9606
ELIPNIPFQMLLR	13	Oxidation (M)	_ELIPNIPFQM(Oxidation (M))LLR_	ELIPNIPFQM(1)LLR	ELIPNIPFQM(71)LLR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	534.3037109375	3	533.969088	1598.88543	0.20309	0.00010844	0.72723	0.00038832	0.93031	0.00049676	534.3037283016233	23.139	0.20802	23.139	22.99	23.198	0					6	2	3	0	0	0	0.010271	1	18762	18762		71.268	53.524	1	4284800			564	142	352	364	771	771	139	9606
ELIPNIPFQMLLR	13	Oxidation (M)	_ELIPNIPFQM(Oxidation (M))LLR_	ELIPNIPFQM(1)LLR	ELIPNIPFQM(100)LLR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	800.45068359375	2	800.449994	1598.88543	0.71574	0.00057291	-0.0088382	-7.0745E-06	0.7069	0.00056584	800.4500438362685	23.115	0.28448	23.115	22.953	23.238	0					15	3	5	0	0	0	0.02819	1	18480	18480		103.26	84.631	1	82331000			565	142	352	364	772	772	139	9606
ELIPNIPFQMLLR	13	Oxidation (M)	_ELIPNIPFQM(Oxidation (M))LLR_	ELIPNIPFQM(1)LLR	ELIPNIPFQM(110)LLR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_9	4	800.4510498046875	2	800.449994	1598.88543	0.38856	0.00031102	-0.0013477	-1.0787E-06	0.38721	0.00030994	800.9511868381553	23.156	0.32024	23.156	22.939	23.259	0					12	4	4	0	0	0	0.026093	1	18556	18556		108.43	70.877	1	7669500			566	142	352	364	773	773	139	9606
ELIPNIPFQMLLR	13	Unmodified	_ELIPNIPFQMLLR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	792.4530639648438	2	792.452536	1582.89052	0.6119	0.0004849	-0.036743	-2.9117E-05	0.57516	0.00045579	792.4525938669893	24.042	0.21757	24.042	23.946	24.164	0					10	2	5	0	0	0	2.7133E-09	2	20160	20160;20161		157.66	132.81	1	45378000			567	142	352	365	774;775	774		9606
ELLDLAMQNAWFR	13	Oxidation (M)	_ELLDLAM(Oxidation (M))QNAWFR_	ELLDLAM(1)QNAWFR	ELLDLAM(160)QNAWFR	0	1	0	Q86XP3	Q86XP3	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	MULTI-MSMS	DP1141_7	2	812.3756103515625	2	811.903408	1621.79226	0.64105	0.00052047	0.087213	7.0808E-05	0.72826	0.00059128	811.9035314363232	22.455	0.25333	22.455	22.319	22.572	0					8	2	4	0	0	0	1.348E-09	1	17642	17642		161.27	120.77	1	26986000			568	460	353	366	776	776	339	9606
ELLDLAMQNAWFR	13	Unmodified	_ELLDLAMQNAWFR_			0	0	0	Q86XP3	Q86XP3	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	MULTI-MSMS	DP1141_7	2	804.4884643554688	2	803.90595	1605.79735	0.57928	0.00046569	0.54487	0.00043802	1.1242	0.00090371	803.9062907811355	23.592	0.22768	23.592	23.414	23.642	0					6	2	3	0	0	0	0.0038131	1	19412	19412		140.83	112.26	1	6768000			569	460	353	367	777	777		9606
ELNEALELK	9	Unmodified	_ELNEALELK_			0	0	0	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MULTI-MSMS	DP1141_10	5	530.3010864257812	2	529.790047	1057.56554	-0.34628	-0.00018346	0.21134	0.00011197	-0.13494	-7.1489E-05	529.790501306465	17.937	0.49979	17.937	17.588	18.087	0					8	4	3	0	0	0	0.0011966	1	11252	11252		127.68	54.014	1	23851000			570	104	354	368	778	778		9606
ELNEALELK	9	Unmodified	_ELNEALELK_			0	0	0	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MULTI-MSMS	DP1141_8	3	530.2879028320312	2	529.790047	1057.56554	0.16308	8.6397E-05	-1.9024	-0.0010078	-1.7393	-0.00092145	529.7903834826312	17.873	0.501	17.873	17.574	18.075	0					10	4	3	0	0	0	0.00060054	1	10695	10695		135.71	67.814	1	40662000			571	104	354	368	779	779		9606
ELQSVKPQEAPK	12	Unmodified	_ELQSVKPQEAPK_			0	0	1	Q92917	Q92917	Q92917	GPKOW	G patch domain and KOW motifs-containing protein	MULTI-MSMS	DP1141_8	3	452.4617614746094	3	451.91727	1352.72998	-0.22077	-9.977E-05	0.0040853	1.8462E-06	-0.21668	-9.7923E-05	451.9173552165825	14.017	0.37395	14.017	13.805	14.179	0					9	4	3	0	0	0	0.016741	1	4468	4468		108.9	54.56	1	10345000			572	498	355	369	780	780		9606
ELSMENQCSLDMKSKLNTSK	20	2 Oxidation (M)	_ELSM(Oxidation (M))ENQCSLDM(Oxidation (M))KSKLNTSK_	ELSM(1)ENQCSLDM(1)KSKLNTSK	ELSM(56)ENQCSLDM(56)KSKLNTSK	0	2	2	Q5TC82	Q5TC82	Q5TC82	RC3H1	Roquin-1	MULTI-MSMS	DP1141_8	3	1188.5501708984375	2	1188.048	2374.08145	1.4251	0.0016931	-0.72809	-0.000865	0.69705	0.00082813	1188.5486441442076	21.729	0.50035	21.729	21.479	21.979	0					7	4	2	0	0	0	0.018582	1	16427	16427		55.899	31.203	1	66244000			573	423	356	370	781	781	319;320	9606
ELSQCNCIDLSK	12	Unmodified	_ELSQCNCIDLSK_			0	0	0	Q5TAX3	Q5TAX3	Q5TAX3	ZCCHC11	Terminal uridylyltransferase 4	MULTI-SECPEP	DP1141_6	1	733.9876708984375	2	733.834333	1465.65411	-0.29451	-0.00021612	-3.6323	-0.0026655	-3.9268	-0.0028816	733.831539470739	15.259	0.9046	15.259	14.708	15.613	0					18	8	3	0	0	0	0.010979	1	5847	5847		96.665	0	1	167660000			574	421	357	371	782	782		9606
ELTLQAMADGVNKGR	15	Unmodified	_ELTLQAMADGVNKGR_			0	0	1	P16519	P16519	P16519	PCSK2	Neuroendocrine convertase 2	MSMS	DP1141_10	5	801.9144897460938	2	801.917046	1601.81954	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.624	1	18.624	18.124	19.124	0								0	0	0	0.0078674	1	12323	12323		106.62	16.792	1				575	158	358	372	783	783		9606
ELTTEIDNNIEQISSYKSEITELRR	25	Unmodified	_ELTTEIDNNIEQISSYKSEITELRR_			0	0	2	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_9	4	746.696044921875	4	746.132007	2980.49892	0.49792	0.00037152	0.63924	0.00047696	1.1372	0.00084848	746.3836675854874	20.914	0.401	20.914	20.636	21.037	0					9	3	4	0	0	0	0.0029713	1	15331	15331		48.244	22.088	1	7437600		+	576	17	359	373	784	784		9606
EMWTEVPK	8	Oxidation (M)	_EM(Oxidation (M))WTEVPK_	EM(1)WTEVPK	EM(81)WTEVPK	0	1	0	P62316	P62316	P62316	SNRPD2	Small nuclear ribonucleoprotein Sm D2	MSMS	DP1141_10	5	518.2446899414062	2	518.244418	1034.47428	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.898	1	16.898	16.398	17.398	0								0	0	0	0.031953	1	9498	9498		81.191	35.175	1				577	298	360	374	785	785	236	9606
ENNVDAVHPGYGFLSER	17	Unmodified	_ENNVDAVHPGYGFLSER_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	634.9873657226562	3	635.302623	1902.88604	-0.024482	-1.5553E-05	0.77104	0.00048985	0.74656	0.00047429	635.6371887930399	18.6	0.60052	18.6	18.149	18.75	0					10	5	4	0	0	0	4.4588E-10	1	11862	11862		157.8	124.5	1	497110000			578	142	361	375	786	786		9606
ENSKYLDEELMVLSSNSMSLTTR	23	Oxidation (M)	_ENSKYLDEELM(Oxidation (M))VLSSNSMSLTTR_	ENSKYLDEELM(0.928)VLSSNSM(0.072)SLTTR	ENSKYLDEELM(11)VLSSNSM(-11)SLTTR	0	1	1	Q8WWI1	Q8WWI1	Q8WWI1	LMO7	LIM domain only protein 7	MULTI-SECPEP	DP1141_7	2	665.838134765625	4	666.568926	2662.2466	-0.039134	-2.6085E-05	2.8776	0.0019181	2.8384	0.001892	666.8214790315624	18.9	0.70047	18.9	18.55	19.25	0					12	6	3	0	0	0	0.028343	1	12075	12075		40.952	13.342	2	126430000			579	487	362	376	787	787	358	9606
ENSLLVLDTASHSIK	15	Unmodified	_ENSLLVLDTASHSIK_			0	0	0	Q6VVB1	Q6VVB1	Q6VVB1	NHLRC1	E3 ubiquitin-protein ligase NHLRC1	MULTI-MSMS	DP1141_7	2	408.0466613769531	4	407.472889	1625.86245	0.50049	0.00020394	-0.11719	-4.775E-05	0.3833	0.00015619	407.47281531165055	13.99	0.60783	13.99	13.701	14.309	0					15	6	5	0	0	0	0.022943	1	4366	4366		40.751	9.171	1	28784000			580	437	363	377	788	788		9606
EPLYEKDSSVAAR	13	Unmodified	_EPLYEKDSSVAAR_			0	0	1	O43809	O43809	O43809	NUDT21	Cleavage and polyadenylation specificity factor subunit 5	MULTI-MSMS	DP1141_10	5	488.9159240722656	3	488.915817	1463.72562	0.24178	0.00011821	-0.26383	-0.00012899	-0.02205	-1.0781E-05	488.91577290049406	15.32	0.57321	15.32	14.96	15.533	0					11	6	3	0	0	0	0.0092661	1	6867	6867		128.57	101.94	1	76131000			581	61	364	378	789	789		9606
EPSPPIDEVINTPR	14	Unmodified	_EPSPPIDEVINTPR_			0	0	0	O60684	O60684	O60684	KPNA6	Importin subunit alpha-7	MSMS	DP1141_8	3	782.0901489257812	2	782.404295	1562.79404	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.903	1	18.903	18.403	19.403	0								0	0	0	0.011574	1	12189	12189		110.93	81.165	1				582	64	365	379	790	790		9606
EQAQILDNYTLK	12	Unmodified	_EQAQILDNYTLK_			0	0	0		REV__Q8TEK3	REV__Q8TEK3			MULTI-MSMS	DP1141_9	4	719.0167236328125	2	718.375006	1434.73546	0.62392	0.00044821	-0.31531	-0.00022651	0.30861	0.0002217	718.3748105534657	17.088	0.24141	17.088	16.896	17.138	0					4	2	2	0	0	0	0.013176	1	9174	9174		86.136	20.858	1	33340000	+		583	629	366	380	791	791		9606
EQEPMPTVDSHEPR	14	Oxidation (M)	_EQEPM(Oxidation (M))PTVDSHEPR_	EQEPM(1)PTVDSHEPR	EQEPM(98)PTVDSHEPR	0	1	0	Q9H910	Q9H910	Q9H910	HN1L	Hematological and neurological expressed 1-like protein	MULTI-MSMS	DP1141_10	5	556.9171142578125	3	556.582509	1666.7257	0.72223	0.00040198	-0.73025	-0.00040645	-0.0080252	-4.4667E-06	556.9165802764026	14.305	0.51025	14.305	14.09	14.6	0					22	7	4	0	0	0	0.00098176	2	5252	5182;5252		120.6	113.16	1	28854000			584	563	367	381	792;793	793	402	9606
EQEPMPTVDSHEPR	14	Unmodified	_EQEPMPTVDSHEPR_			0	0	0	Q9H910	Q9H910	Q9H910	HN1L	Hematological and neurological expressed 1-like protein	MULTI-MSMS	DP1141_10	5	551.5858154296875	3	551.250871	1650.73078	0.43041	0.00023726	1.001	0.0005518	1.4314	0.00078907	551.2514882304744	15.415	0.41007	15.415	15.199	15.609	0					6	4	2	0	0	0	0.025496	1	7140	7140		61.212	44.011	1	7236500			585	563	367	382	794	794		9606
EQGVLSFWR	9	Unmodified	_EQGVLSFWR_			0	0	0	P05141;P12236	P05141	P05141	SLC25A5;SLC25A6	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed;ADP/ATP translocase 3;ADP/ATP translocase 3, N-terminally processed	MULTI-MSMS	DP1141_6	1	561.2904663085938	2	561.290548	1120.56654	0.73563	0.0004129	-0.25853	-0.00014511	0.4771	0.00026779	561.2904434766118	21.256	0.24916	21.256	21.046	21.296	0					6	2	3	0	0	0	0.0012874	2	15357	15334;15357		127.02	57.8	1	12876000			586	109	368	383	795;796	796		9606
EQIVPKPEEEVAQKK	15	Unmodified	_EQIVPKPEEEVAQKK_			0	0	2	P18621	P18621	P18621	RPL17	60S ribosomal protein L17	MULTI-MSMS	DP1141_10	5	584.990478515625	3	584.656115	1750.94651	0.36624	0.00021412	-0.056964	-3.3304E-05	0.30928	0.00018082	584.990310010339	14.843	0.29308	14.843	14.667	14.96	0					11	3	4	0	0	0	7.2116E-06	2	6141	6141;6231		153.32	120.8	1	19658000			587	169	369	384	797;798	797		9606
EQNRLAQMNAITQHAK	16	Unmodified	_EQNRLAQMNAITQHAK_			0	0	1		REV__O15078	REV__O15078			MULTI-MSMS	DP1141_9	4	618.6552124023438	3	618.319731	1851.93736	0.11717	7.2449E-05	1.286	0.00079513	1.4031	0.00086758	618.320651972845	17.088	0.3413	17.088	16.896	17.238	0					14	3	5	0	0	0	0.013623	1	9275	9275		100.18	60.674	1	243760000	+		588	624	370	385	799	799		9606
EQSSYHGNQQSYPQEVHGSSR	21	Unmodified	_EQSSYHGNQQSYPQEVHGSSR_			0	0	0	Q9UGU0	Q9UGU0	Q9UGU0	TCF20	Transcription factor 20	MULTI-SECPEP	DP1141_7	2	601.652099609375	4	602.017983	2404.04283	0.91431	0.00055043	0.23849	0.00014357	1.1528	0.000694	602.2689194056744	14.024	0.349	14.024	13.861	14.21	0					5	3	2	0	0	0	0.029633	1	4549	4549		41.257	25.665	1	1796400			589	591	371	386	800	800		9606
EREEFLIPIYHQVAVQFADLHDTPGR	26	Unmodified	_EREEFLIPIYHQVAVQFADLHDTPGR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_9	4	770.8999633789062	4	770.895169	3079.55157	0.72684	0.00056031	1.7869	0.0013775	2.5138	0.0019379	771.3983273510853	21.796	0.39179	21.796	21.538	21.93	0					8	3	3	0	0	0	1.0822E-11	1	16662	16662		113.23	91.107	1	2290600			590	367	372	387	801	801		9606
ERPQDRPEDLDVPPALADFIHQQR	24	Unmodified	_ERPQDRPEDLDVPPALADFIHQQR_			0	0	2	Q01780	Q01780	Q01780	EXOSC10	Exosome component 10	MULTI-MSMS	DP1141_7	2	711.3905639648438	4	711.361227	2841.4158	0.85473	0.00060802	-0.32471	-0.00023099	0.53002	0.00037703	711.862287330775	20.37	0.40039	20.37	20.15	20.551	0					9	3	4	0	0	0	6.5591E-08	1	14504	14504		137.23	118.69	1	12323000			591	340	373	388	802	802		9606
ERPQDRPEDLDVPPALADFIHQQR	24	Unmodified	_ERPQDRPEDLDVPPALADFIHQQR_			0	0	2	Q01780	Q01780	Q01780	EXOSC10	Exosome component 10	MULTI-SECPEP	DP1141_8	3	711.1080932617188	4	711.361227	2841.4158	0.39418	0.00028041	-2.3746	-0.0016892	-1.9804	-0.0014088	711.6098120864735	20.226	0.40089	20.226	20.076	20.477	0					5	3	2	0	0	0	0.011639	1	14358	14358		60.278	28.013	1	16294000			592	340	373	388	803	803		9606
ESFADVLPEAAALVK	15	Unmodified	_ESFADVLPEAAALVK_			0	0	0	Q5VT52	Q5VT52	Q5VT52	RPRD2	Regulation of nuclear pre-mRNA domain-containing protein 2	MULTI-MSMS	DP1141_7	2	780.9216918945312	2	780.419413	1558.82427	0.73854	0.00057637	-0.31349	-0.00024465	0.42505	0.00033172	780.4193229915243	22.522	0.42112	22.522	22.241	22.663	0					10	4	3	0	0	0	0.0036447	1	17802	17802		132.56	102.79	1	12689000			593	424	374	389	804	804		9606
ESLCQAALGLILK	13	Unmodified	_ESLCQAALGLILK_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	708.4007568359375	2	708.39997	1414.78539	1.2449	0.00088191	-0.98117	-0.00069506	0.26376	0.00018685	708.3996106133812	23.455	0.19889	23.455	23.287	23.486	0					7	3	3	0	0	0	0.011726	1	18630	18630		85.862	54.228	1	2859400			594	521	375	390	805	805		9606
ESLCQAALGLILK	13	Unmodified	_ESLCQAALGLILK_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_7	2	708.4003295898438	2	708.39997	1414.78539	0.69862	0.00049491	-0.0077308	-5.4765E-06	0.69089	0.00048943	708.3999413554105	23.436	0.20246	23.436	23.278	23.481	0					4	2	2	0	0	0	0.0038811	1	19155	19155		119.62	90.372	1	58766000			595	521	375	390	806	806		9606
ESLCQAALGLILK	13	Unmodified	_ESLCQAALGLILK_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	708.4002685546875	2	708.39997	1414.78539	0.57193	0.00040515	-0.46474	-0.00032922	0.10719	7.5931E-05	708.3999169559305	23.466	0.30588	23.466	23.325	23.631	0					11	3	5	0	0	0	0.0049051	2	19050	19050;19053		112.11	57.385	1	277020000			596	521	375	390	807;808	807		9606
ESLCQAALGLILK	13	Unmodified	_ESLCQAALGLILK_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_9	4	708.4008178710938	2	708.39997	1414.78539	1.0481	0.00074249	-0.32091	-0.00022733	0.72721	0.00051516	708.3997799826957	23.437	0.25891	23.437	23.259	23.518	0					9	3	3	0	0	0	0.0051891	2	19065	19065;19094		108.57	74.809	1	48383000			597	521	375	390	809;810	809		9606
ESQPAIWNR	9	Unmodified	_ESQPAIWNR_			0	0	0	Q14676	Q14676	Q14676	MDC1	Mediator of DNA damage checkpoint protein 1	MULTI-MSMS	DP1141_7	2	550.5347900390625	2	550.777805	1099.54106	0.36557	0.00020135	-0.1579	-8.697E-05	0.20767	0.00011438	550.777939463426	17.393	0.81771	17.393	16.831	17.649	0					9	8	2	0	0	0	0.027979	1	9535	9535		77.282	50.32	1	22320000			598	388	376	391	811	811		9606
ESTLHLVLR	9	Unmodified	_ESTLHLVLR_			0	0	0	P62987;P62979;P0CG47;P0CG48;A0A2R8Y422	P62987	P62987	UBA52;RPS27A;UBB;UBC	Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Polyubiquitin-B;Ubiquitin;Polyubiquitin-C;Ubiquitin	MSMS	DP1141_10	5	534.5645141601562	2	534.314023	1066.61349	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.562	1	17.562	17.062	18.062	0								0	0	0	9.8983E-56	1	10594	10594		180.93	131.83	1				599	134	377	392	812	812		9606
ESYSVYVYK	9	Unmodified	_ESYSVYVYK_			0	0	0	Q99880;Q99879;Q99877;Q93079;Q5QNW6;P62807;P58876;P57053;O60814	Q99880	Q99880	HIST1H2BL;HIST1H2BM;HIST1H2BN;HIST1H2BH;HIST2H2BF;HIST1H2BC;HIST1H2BD;H2BFS;HIST1H2BK	Histone H2B type 1-L;Histone H2B type 1-M;Histone H2B type 1-N;Histone H2B type 1-H;Histone H2B type 2-F;Histone H2B type 1-C/E/F/G/I;Histone H2B type 1-D;Histone H2B type F-S;Histone H2B type 1-K	MULTI-MSMS	DP1141_10	5	569.0301513671875	2	569.276772	1136.53899	0.22656	0.00012898	0.98542	0.00056097	1.212	0.00068995	569.2773789586967	17.838	0.69967	17.838	17.488	18.187	0					13	6	4	0	0	0	0.0043146	1	11069	11069		122.74	69.956	1	65282000			600	65	378	393	813	813		9606
ETDPVKSPPLPEHQK	15	Unmodified	_ETDPVKSPPLPEHQK_			0	0	1	Q96JM3	Q96JM3	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	MULTI-MSMS	DP1141_7	2	567.951904296875	3	567.96506	1700.87335	0.1388	7.8834E-05	0.19934	0.00011322	0.33814	0.00019205	567.9651829705736	14.759	0.50004	14.759	14.309	14.809	0					7	4	3	0	0	0	0.023574	1	5604	5604		83.633	56.535	1	28272000			601	514	379	394	814	814		9606
ETGYVVERPSTTK	13	Unmodified	_ETGYVVERPSTTK_			0	0	1	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-SECPEP	DP1141_7	2	489.228515625	3	489.587701	1465.74127	0.012817	6.275E-06	0.25304	0.00012388	0.26586	0.00013016	489.5877680459329	14.759	0.70098	14.759	14.408	15.109	0					17	6	4	0	0	0	1.4372E-11	1	5692	5692		147.58	120.99	1	83555000			602	580	380	395	815	815		9606
ETLIEIR	7	Unmodified	_ETLIEIR_			0	0	0		REV__O15078	REV__O15078			MULTI-MSMS	DP1141_6	1	438.1923828125	2	437.255643	872.496732	1.3416	0.00058661	-1.292	-0.00056493	0.049601	2.1688E-05	437.2549736358449	18.654	1.7007	18.654	17.805	19.506	0					24	16	2	0	0	0	0.03233	1	11398	11398		97.596	17.219	1	15407000	+		603	624	381	396	816	816		9606
ETNLDSLPLVDTHSKR	16	Unmodified	_ETNLDSLPLVDTHSKR_			0	0	1	P08670	P08670	P08670	VIM	Vimentin	MULTI-SECPEP	DP1141_8	3	609.786376953125	3	608.986523	1823.93774	0.42143	0.00025665	0.70642	0.0004302	1.1279	0.00068685	609.3215288941307	17.424	0.40098	17.424	17.173	17.574	0					5	3	2	0	0	0	0.009369	1	9964	9964		75.574	50.257	1	16643000			604	127	382	397	817	817		9606
ETSHASLPQPEPPGGGGSK	19	Unmodified	_ETSHASLPQPEPPGGGGSK_			0	0	0	Q9UGU0	Q9UGU0	Q9UGU0	TCF20	Transcription factor 20	MULTI-MSMS	DP1141_7	2	611.8248291015625	3	611.630628	1831.87006	0.060538	3.7027E-05	0.17262	0.00010558	0.23315	0.0001426	611.9651219787072	15.303	0.40022	15.303	15.009	15.409	0					5	3	2	0	0	0	0.031573	1	6491	6491		45.916	16.903	1	4655000			605	591	383	398	818	818		9606
EVASNSELVQSSR	13	Unmodified	_EVASNSELVQSSR_			0	0	0	CON__P08779;P08779	CON__P08779	CON__P08779	KRT16	Keratin, type I cytoskeletal 16	MULTI-MSMS	DP1141_9	4	703.349853515625	2	703.34952	1404.68449	0.90533	0.00063676	-1.206	-0.00084825	-0.30069	-0.00021149	703.349334542753	15.224	0.59776	15.224	15.075	15.673	0					8	5	3	0	0	0	0.0077779	1	6365	6365		89.266	24.612	1	9822900		+	606	16	384	399	819	819		9606
EVATNSELVQSGK	13	Unmodified	_EVATNSELVQSGK_			0	0	0	CON__P02533;P02533;CON__Q04695;Q04695;CON__Q9QWL7	CON__P02533;CON__Q04695	CON__P02533	KRT14;KRT17	Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 17	MULTI-MSMS	DP1141_6	1	681.3552856445312	2	681.348988	1360.68342	0.69292	0.00047212	-0.14469	-9.8583E-05	0.54823	0.00037354	681.3488426077015	15.259	0.50461	15.259	15.108	15.613	0					5	4	2	0	0	0	2.2415E-66	1	5747	5747		198.62	118.4	1	47104000		+	607	9;21	385	400	820	820		9606
EVATNSELVQSGK	13	Unmodified	_EVATNSELVQSGK_			0	0	0	CON__P02533;P02533;CON__Q04695;Q04695;CON__Q9QWL7	CON__P02533;CON__Q04695	CON__P02533	KRT14;KRT17	Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 17	MULTI-MSMS	DP1141_9	4	681.5269165039062	2	681.348988	1360.68342	0.1807	0.00012312	0.13044	8.8878E-05	0.31114	0.000212	681.3491005518283	15.224	0.39614	15.224	15.075	15.471	0					7	3	3	0	0	0	3.0558E-135	1	6172	6172		231.07	184.25	1	269560000		+	608	9;21	385	400	821	821		9606
EVCEQNQQLLR	11	Unmodified	_EVCEQNQQLLR_			0	0	0	O95239	O95239	O95239	KIF4A	Chromosome-associated kinesin KIF4A	MSMS	DP1141_7	2	709.32275390625	2	708.848632	1415.68271	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.224	1	16.224	15.724	16.724	0								0	0	0	2.5436E-15	1	7996	7996		153.08	78.91	1				609	89	386	401	822	822		9606
EVDEQMLNVQNK	12	Oxidation (M)	_EVDEQM(Oxidation (M))LNVQNK_	EVDEQM(1)LNVQNK	EVDEQM(220)LNVQNK	0	1	0	P07437;P68371;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB4B;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_10	5	731.8460083007812	2	731.845755	1461.67696	0.73474	0.00053772	-0.31083	-0.00022748	0.42391	0.00031024	731.8455632051882	15.56	0.41356	15.56	15.368	15.781	0					7	4	3	0	0	0	1.1866E-112	1	7303	7303		220.39	144.11	1	146750000			610	122;323;381	387	402	823	823	107	9606
EVDEQMLNVQNK	12	Oxidation (M)	_EVDEQM(Oxidation (M))LNVQNK_	EVDEQM(1)LNVQNK	EVDEQM(180)LNVQNK	0	1	0	P07437;P68371;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB4B;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_7	2	732.338623046875	2	731.845755	1461.67696	0.10419	7.6253E-05	-0.67844	-0.00049652	-0.57425	-0.00042026	731.8452521942778	15.564	0.50509	15.564	15.409	15.914	0					6	4	2	0	0	0	2.4963E-39	1	6890	6890		183.72	119.62	1	34911000			611	122;323;381	387	402	824	824	107	9606
EVDEQMLNVQNK	12	Oxidation (M)	_EVDEQM(Oxidation (M))LNVQNK_	EVDEQM(1)LNVQNK	EVDEQM(140)LNVQNK	0	1	0	P07437;P68371;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB4B;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_8	3	731.846435546875	2	731.845755	1461.67696	0.53869	0.00039424	0.018728	1.3706E-05	0.55742	0.00040795	731.845804783685	15.524	0.6056	15.524	15.37	15.976	0					13	5	4	0	0	0	0.014088	1	6926	6926		135.71	47.655	1	59659000			612	122;323;381	387	402	825	825	107	9606
EVDEQMLNVQNK	12	Oxidation (M)	_EVDEQM(Oxidation (M))LNVQNK_	EVDEQM(1)LNVQNK	EVDEQM(260)LNVQNK	0	1	0	P07437;P68371;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB4B;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_9	4	731.8826904296875	2	731.845755	1461.67696	0.59333	0.00043423	0.054735	4.0058E-05	0.64807	0.00047429	731.8456616757695	15.523	0.50083	15.523	15.372	15.872	0					9	4	3	0	0	0	4.4692999999999995E-228	2	6770	6770;6831		256.47	182.62	1	20572000			613	122;323;381	387	402	826;827	826	107	9606
EVFFMNTQSIVQLVQR	16	Oxidation (M)	_EVFFM(Oxidation (M))NTQSIVQLVQR_	EVFFM(1)NTQSIVQLVQR	EVFFM(210)NTQSIVQLVQR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	978.0072631835938	2	978.006393	1953.99823	0.46894	0.00045862	0.24466	0.00023927	0.71359	0.0006979	978.0067067321825	21.968	0.33784	21.968	21.865	22.202	0					9	4	4	0	0	0	3.5112E-83	2	16541	16541;16544		206.1	180.08	1	56266000			614	367	388	403	828;829	828	268	9606
EVFFMNTQSIVQLVQR	16	Oxidation (M)	_EVFFM(Oxidation (M))NTQSIVQLVQR_	EVFFM(1)NTQSIVQLVQR	EVFFM(100)NTQSIVQLVQR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	652.6749877929688	3	652.340021	1953.99823	0.64515	0.00042086	0.29772	0.00019421	0.94287	0.00061507	652.674484273841	21.968	0.20744	21.968	21.865	22.072	0					8	2	4	0	0	0	0.00065139	1	16543	16543		104.09	75.312	1	35612000			615	367	388	403	830	830	268	9606
EVKMEARK	8	Oxidation (M)	_EVKM(Oxidation (M))EARK_	EVKM(1)EARK	EVKM(62)EARK	0	1	2	Q9HCH0	Q9HCH0	Q9HCH0	NCKAP5L	Nck-associated protein 5-like	MULTI-SECPEP	DP1141_10	5	504.2620544433594	2	503.771134	1005.52771	-0.17423	-8.777E-05	2.9511	0.0014867	2.7769	0.0013989	504.27412662336246	17.687	0.39981	17.687	17.488	17.887	0					5	3	2	0	0	0	0.025477	1	11097	11097		62.464	21.035	1	17068000			616	568	389	404	831	831	409	9606
EVMLILIR	8	Unmodified	_EVMLILIR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	493.80731201171875	2	493.806988	985.599423	0.36312	0.00017931	0.34593	0.00017082	0.70905	0.00035013	493.807133087236	21.3	0.49971	21.3	21.05	21.55	0					9	4	3	0	0	0	1.1679E-06	1	15962	15962		148.07	148.07	1	95238000			617	78	390	405	832	832		9606
EVMLVGIGDK	10	Oxidation (M)	_EVM(Oxidation (M))LVGIGDK_	EVM(1)LVGIGDK	EVM(96)LVGIGDK	0	1	0	P36542	P36542	P36542	ATP5C1	ATP synthase subunit gamma, mitochondrial	MSMS	DP1141_9	4	538.6109008789062	2	538.78645	1075.55835	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.868	1	17.868	17.368	18.368	0								0	0	0	0.01768	1	10526	10526		96.143	35.383	1				618	210	391	406	833	833	176	9606
EVMPLLLAYLK	11	Oxidation (M)	_EVM(Oxidation (M))PLLLAYLK_	EVM(1)PLLLAYLK	EVM(80)PLLLAYLK	0	1	0	Q8TEX9	Q8TEX9	Q8TEX9	IPO4	Importin-4	MULTI-SECPEP	DP1141_7	2	653.9988403320312	2	653.377974	1304.7414	0.024584	1.6063E-05	-2.4213	-0.0015821	-2.3968	-0.001566	653.3762842948748	22.35	0.51656	22.35	22.146	22.663	0					7	5	2	0	0	0	0.022988	1	17444	17444		80.438	27.652	1	6156100			619	483	392	407	834	834	357	9606
EVSFQSTGESEWK	13	Unmodified	_EVSFQSTGESEWK_			0	0	0	Q07021	Q07021	Q07021	C1QBP	Complement component 1 Q subcomponent-binding protein, mitochondrial	MULTI-MSMS	DP1141_10	5	757.860595703125	2	757.343903	1512.67325	0.34494	0.00026124	1.0207	0.00077305	1.3657	0.0010343	757.3449164751698	18.337	0.29952	18.337	18.087	18.387	0					4	2	2	0	0	0	0	2	11766	11721;11766		274.53	187.65	1	95062000			620	350	393	408	835;836	836		9606
EYEAEGIAK	9	Unmodified	_EYEAEGIAK_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-SECPEP	DP1141_8	3	505.91729736328125	2	505.245472	1008.47639	0.84162	0.00042522	0.15225	7.6923E-05	0.99387	0.00050215	505.24542528205643	15.221	0.29834	15.221	14.972	15.271	0					4	2	2	0	0	0	0.02281	1	6216	6216		122.74	78.05	1	15532000			621	567	394	409	837	837		9606
EYEAEGIAKDGAK	13	Unmodified	_EYEAEGIAKDGAK_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	460.9573669433594	3	460.892901	1379.65687	0.025248	1.1637E-05	-0.1043	-4.807E-05	-0.07905	-3.6434E-05	460.8928215215815	14.459	0.70454	14.459	14.268	14.972	0					9	7	2	0	0	0	0.020164	1	5103	5103		94.402	61.796	1	5031900			622	567	395	410	838	838		9606
EYEAEGIAKDGAK	13	Unmodified	_EYEAEGIAKDGAK_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	691.333984375	2	690.835714	1379.65687	0.623	0.00043039	-1.1023	-0.00076151	-0.47931	-0.00033113	690.8351768239266	14.521	0.60484	14.521	14.268	14.873	0					10	6	3	0	0	0	6.1917E-205	2	5214	5152;5214		270.54	185.38	1	7697300			623	567	395	410	839;840	840		9606
EYSSELNAPSQESDSHPR	18	Unmodified	_EYSSELNAPSQESDSHPR_			0	0	0	P49756	P49756	P49756	RBM25	RNA-binding protein 25	MULTI-MSMS	DP1141_8	3	677.8277587890625	3	678.299607	2031.87699	0.82988	0.00056291	-0.54366	-0.00036876	0.28622	0.00019414	678.633308551164	15.32	0.40026	15.32	15.072	15.472	0					5	3	2	0	0	0	0.014151	1	6557	6557		69.805	58.424	1	21735000			624	251	396	411	841	841		9606
FAAGHDAEGSHSHVHFDEK	19	Unmodified	_FAAGHDAEGSHSHVHFDEK_			0	0	0	Q9GZN8	Q9GZN8	Q9GZN8	C20orf27	UPF0687 protein C20orf27	MULTI-MSMS	DP1141_10	5	519.9447021484375	4	520.23323	2076.90381	0.42331	0.00022022	0.11683	6.0777E-05	0.54014	0.000281	520.2332897794697	14.123	0.18708	14.123	14.028	14.215	0					10	2	5	0	0	0	0.0075774	1	5032	5032		76.158	62.908	1	12204000			625	550	397	412	842	842		9606
FAAQNLHQNLIR	12	Unmodified	_FAAQNLHQNLIR_			0	0	0	Q9H0C8	Q9H0C8	Q9H0C8	ILKAP	Integrin-linked kinase-associated serine/threonine phosphatase 2C	MULTI-SECPEP	DP1141_9	4	475.2590637207031	3	475.596753	1423.76843	0.4236	0.00020146	-1.0908	-0.0005188	-0.66725	-0.00031734	475.5964697082953	17.007	0.58372	17.007	16.854	17.437	0					11	6	3	0	0	0	0.0038467	1	9068	9068		101.97	69.985	1	79776000			626	552	398	413	843	843		9606
FADGEVVR	8	Unmodified	_FADGEVVR_			0	0	0	Q14739	Q14739	Q14739	LBR	Lamin-B receptor	MULTI-SECPEP	DP1141_6	1	446.74993896484375	2	446.729792	891.445031	0.60236	0.00026909	0.23784	0.00010625	0.8402	0.00037534	446.72972902197097	15.663	0.69616	15.663	15.209	15.905	0					8	6	2	0	0	0	0.00052993	1	6473	6473		149.4	69.17	1	12395000			627	392	399	414	844	844		9606
FADLSEAANR	10	Unmodified	_FADLSEAANR_			0	0	0	P08670	P08670	P08670	VIM	Vimentin	MULTI-SECPEP	DP1141_8	3	546.7658081054688	2	547.26727	1092.51999	0.46106	0.00025232	0.067371	3.687E-05	0.52843	0.00028919	547.2673265472957	16.684	0.35826	16.684	16.469	16.828	0					6	3	2	0	0	0	0.035339	1	8720	8720		117.81	41.333	1	34442000			628	127	400	415	845	845		9606
FAGYVTSIAATELEDDDDDYSSSTSLLGQK	30	Unmodified	_FAGYVTSIAATELEDDDDDYSSSTSLLGQK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	1068.03466796875	3	1066.82101	3197.44119	0.50422	0.00053791	-0.37006	-0.00039479	0.13416	0.00014312	1067.1554738224775	22.35	0.24464	22.35	22.241	22.486	0					6	2	3	0	0	0	0.0009067	1	17474	17474		47.12	20.085	1	6813100			629	78	401	416	846	846		9606
FALPQYLK	8	Unmodified	_FALPQYLK_			0	0	0	CON__P02663	CON__P02663	CON__P02663			MULTI-MSMS	DP1141_7	2	490.8287658691406	2	490.284203	978.553853	0.29726	0.00014574	0.16142	7.914E-05	0.45867	0.00022488	490.28418355442886	19.9	0.39948	19.9	19.551	19.95	0					5	3	2	0	0	0	0.034831	1	13853	13853		85.359	42.963	1	19347000		+	630	12	402	417	847	847		
FANPFPAAVR	10	Unmodified	_FANPFPAAVR_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_10	5	545.2960205078125	2	545.295633	1088.57671	0.71267	0.00038861	-0.010041	-5.4751E-06	0.70263	0.00038314	545.2956388854791	19.227	0.49961	19.227	18.877	19.376	0					10	4	3	0	0	0	0.0030085	2	13432	13293;13432		104.21	104.21	1	91374000			631	111	403	418	848;849	849		9606
FANPFPAAVR	10	Unmodified	_FANPFPAAVR_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_6	1	545.2958374023438	2	545.295633	1088.57671	0.29574	0.00016126	0.31831	0.00017357	0.61404	0.00033484	545.2957640925148	19.256	0.40017	19.256	18.905	19.305	0					8	3	3	0	0	0	0.0023975	1	12312	12312		104.75	74.671	1	21359000			632	111	403	418	850	850		9606
FANPFPAAVR	10	Unmodified	_FANPFPAAVR_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	545.2960205078125	2	545.295633	1088.57671	0.99648	0.00054338	-0.50018	-0.00027275	0.49631	0.00027063	545.2953450494254	19.225	0.59978	19.225	18.876	19.476	0					14	5	4	0	0	0	0.0041691	2	12660	12660;12685		124.08	85.946	1	299840000			633	111	403	418	851;852	851		9606
FANPFPAAVR	10	Unmodified	_FANPFPAAVR_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	545.2960205078125	2	545.295633	1088.57671	0.68607	0.00037411	-0.84101	-0.0004586	-0.15493	-8.4485E-05	545.2955300571175	19.24	0.60145	19.24	18.837	19.438	0					11	5	3	0	0	0	0.0033701	1	12732	12732		108.46	69.156	1	18632000			634	111	403	418	853	853		9606
FASFIDK	7	Unmodified	_FASFIDK_			0	0	0	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;O95678;CON__O95678;CON__Q8VED5;P05787;CON__P05787;CON__Q7Z794;CON__Q9DCV7;CON__Q6NXH9;CON__Q9R0H5;CON__Q6ISB0;CON__P19013;CON__Q9H552;CON__P07744;CON__Q9NSB2;CON__Q3KNV1;CON__P08729;Q7Z794;P19013;P08729;Q9NSB2;CON__P13647;P13647;CON__Q6IFZ6;P04259;CON__P35908v2;CON__P35908;P35908;CON__Q5XKE5;Q5XKE5;CON__P12035;CON__Q01546;P12035;Q01546;CON__Q14CN4-1;CON__Q6IME9;Q14CN4;CON__Q3SY84;CON__Q7RTS7;CON__Q32MB2;Q3SY84;Q7RTS7;Q86Y46	CON__P02538;CON__P13647;CON__Q6IFZ6;P04259;CON__P35908v2;CON__Q14CN4-1	CON__P35908v2	KRT6A;KRT6C;KRT75;KRT8;KRT77;KRT4;KRT7;KRT84;KRT5;KRT6B;KRT2;KRT79;KRT3;KRT76;KRT72;KRT71;KRT74;KRT73	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 75;Keratin, type II cytoskeletal 8;Keratin, type II cytoskeletal 1b;Keratin, type II cytoskeletal 4;Keratin, type II cytoskeletal 7;Keratin, type II cuticular Hb4;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 2 epidermal;Keratin, type II cytoskeletal 79;Keratin, type II cytoskeletal 3;Keratin, type II cytoskeletal 2 oral;Keratin, type II cytoskeletal 72;Keratin, type II cytoskeletal 71;Keratin, type II cytoskeletal 74;Keratin, type II cytoskeletal 73	MSMS	DP1141_6	1	414.2535400390625	2	414.218529	826.422505	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.933	1	17.933	17.433	18.433	0								0	0	0	0.00044192	1	10157	10157		138.37	66.652	1			+	635	20;10;101;18;22;27	404	419	854	854		9606
FASFIDK	7	Unmodified	_FASFIDK_			0	0	0	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;O95678;CON__O95678;CON__Q8VED5;P05787;CON__P05787;CON__Q7Z794;CON__Q9DCV7;CON__Q6NXH9;CON__Q9R0H5;CON__Q6ISB0;CON__P19013;CON__Q9H552;CON__P07744;CON__Q9NSB2;CON__Q3KNV1;CON__P08729;Q7Z794;P19013;P08729;Q9NSB2;CON__P13647;P13647;CON__Q6IFZ6;P04259;CON__P35908v2;CON__P35908;P35908;CON__Q5XKE5;Q5XKE5;CON__P12035;CON__Q01546;P12035;Q01546;CON__Q14CN4-1;CON__Q6IME9;Q14CN4;CON__Q3SY84;CON__Q7RTS7;CON__Q32MB2;Q3SY84;Q7RTS7;Q86Y46	CON__P02538;CON__P13647;CON__Q6IFZ6;P04259;CON__P35908v2;CON__Q14CN4-1	CON__P35908v2	KRT6A;KRT6C;KRT75;KRT8;KRT77;KRT4;KRT7;KRT84;KRT5;KRT6B;KRT2;KRT79;KRT3;KRT76;KRT72;KRT71;KRT74;KRT73	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 75;Keratin, type II cytoskeletal 8;Keratin, type II cytoskeletal 1b;Keratin, type II cytoskeletal 4;Keratin, type II cytoskeletal 7;Keratin, type II cuticular Hb4;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 2 epidermal;Keratin, type II cytoskeletal 79;Keratin, type II cytoskeletal 3;Keratin, type II cytoskeletal 2 oral;Keratin, type II cytoskeletal 72;Keratin, type II cytoskeletal 71;Keratin, type II cytoskeletal 74;Keratin, type II cytoskeletal 73	MULTI-MSMS	DP1141_9	4	414.571533203125	2	414.218529	826.422505	0.11504	4.7652E-05	0.29917	0.00012392	0.41421	0.00017157	414.2186153084358	17.987	0.79926	17.987	17.338	18.137	0					9	7	2	0	0	0	0.0025646	2	10649	10649;10758		115.46	58.006	1	89847000		+	636	20;10;101;18;22;27	404	419	855;856	855		9606
FEEEFIK	7	Unmodified	_FEEEFIK_			0	0	0	Q9Y5X1	Q9Y5X1	Q9Y5X1	SNX9	Sorting nexin-9	MSMS	DP1141_8	3	471.2010803222656	2	471.234376	940.454199	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.182	1	18.182	17.682	18.682	0								0	0	0	5.205E-20	1	11084	11084		162.07	96.804	1				637	622	405	420	857	857		9606
FEEEGNPYYSSAR	13	Unmodified	_FEEEGNPYYSSAR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	774.8341064453125	2	774.833702	1547.65285	0.25841	0.00020023	0.32335	0.00025054	0.58177	0.00045077	774.8339428273905	17.123	0.27271	17.123	16.9	17.173	0					6	2	3	0	0	0	5.695099999999999E-40	1	9405	9405		184.24	116.02	1	86589000			638	567	406	421	858	858		9606
FEIVYNLLSLR	11	Unmodified	_FEIVYNLLSLR_			0	0	0	O75489	O75489	O75489	NDUFS3	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial	MULTI-SECPEP	DP1141_10	5	684.3116455078125	2	683.890095	1365.76564	0.70072	0.00047922	-0.86031	-0.00058836	-0.15959	-0.00010914	684.3904204642383	23.423	0.32817	23.423	23.151	23.479	0					5	4	2	0	0	0	0.016849	1	19586	19586		91.469	50.475	1	2541100			639	77	407	422	859	859		9606
FELQHGTEEQQEEVR	15	Unmodified	_FELQHGTEEQQEEVR_			0	0	0	O94906	O94906	O94906	PRPF6	Pre-mRNA-processing factor 6	MULTI-MSMS	DP1141_7	2	620.301513671875	3	620.290383	1857.84932	0.53092	0.00032932	1.6063	0.0009964	2.1373	0.0013257	620.2915130668423	16.034	0.5	16.034	15.815	16.315	0					6	4	2	0	0	0	0.00042899	1	7683	7683		145.49	114.85	1	7908600			640	86	408	423	860	860		9606
FELTGIPPAPR	11	Unmodified	_FELTGIPPAPR_			0	0	0	P11142	P11142	P11142	HSPA8	Heat shock cognate 71 kDa protein	MULTI-MSMS	DP1141_8	3	599.3353271484375	2	599.334956	1196.65536	0.58708	0.00035186	-0.08865	-5.3131E-05	0.49843	0.00029873	599.3349169812633	19.225	0.80074	19.225	18.976	19.777	0					25	7	4	0	0	0	0.020727	1	12681	12681		82.279	6.5406	1	530720000			641	140	409	424	861	861		9606
FEPPQSDSDGQR	12	Unmodified	_FEPPQSDSDGQR_			0	0	0	O15042	O15042	O15042	U2SURP	U2 snRNP-associated SURP motif-containing protein	MULTI-MSMS	DP1141_7	2	681.8185424804688	2	681.799662	1361.58477	0.1945	0.00013261	0.087686	5.9784E-05	0.28219	0.00019239	681.7997983790034	14.959	0.40093	14.959	14.708	15.109	0					7	3	3	0	0	0	0.00474	2	5795	5795;6021		118.03	105.53	1	51603000			642	49	410	425	862;863	862		9606
FEPPQSDSDGQR	12	Unmodified	_FEPPQSDSDGQR_			0	0	0	O15042	O15042	O15042	U2SURP	U2 snRNP-associated SURP motif-containing protein	MULTI-MSMS	DP1141_8	3	682.3277587890625	2	681.799662	1361.58477	0.76524	0.00052174	-0.56031	-0.00038202	0.20493	0.00013972	682.3005327739165	14.923	0.49533	14.923	14.577	15.072	0					5	4	2	0	0	0	0.0019358	1	5918	5918		125.48	99.096	1	7937000			643	49	410	425	864	864		9606
FEPYANPTKR	10	Unmodified	_FEPYANPTKR_			0	0	1	P52272	P52272	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	MULTI-SECPEP	DP1141_10	5	408.8819580078125	3	408.212017	1221.61422	0.36426	0.00014869	-1.1005	-0.00044923	-0.73622	-0.00030053	408.2111662818644	15.133	0.48396	15.133	14.884	15.368	0					6	5	2	0	0	0	0.0198	1	6615	6615		77.533	26.187	1	10761000			644	263	411	426	865	865		9606
FEPYANPTKR	10	Unmodified	_FEPYANPTKR_			0	0	1	P52272	P52272	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	MULTI-MSMS	DP1141_8	3	408.98712158203125	3	408.212017	1221.61422	0.67502	0.00027555	-0.15084	-6.1575E-05	0.52417	0.00021397	408.2119598836431	15.221	0.49858	15.221	14.772	15.271	0					7	4	3	0	0	0	0.0080297	1	6163	6163		91.658	60.972	1	24947000			645	263	411	426	866	866		9606
FEPYANPTKR	10	Unmodified	_FEPYANPTKR_			0	0	1	P52272	P52272	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	MULTI-SECPEP	DP1141_9	4	407.7339172363281	3	408.212017	1221.61422	0.3777	0.00015418	-0.30253	-0.0001235	0.075168	3.0684E-05	408.21185236258145	15.224	0.39185	15.224	14.98	15.372	0					10	3	4	0	0	0	0.034251	1	6103	6103		72.243	42.692	1	10743000			646	263	411	426	867	867		9606
FESPEVAER	9	Unmodified	_FESPEVAER_			0	0	0	P52272	P52272	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	MULTI-MSMS	DP1141_10	5	532.7758178710938	2	532.256371	1062.49819	0.11019	5.8647E-05	0.65022	0.00034608	0.76041	0.00040473	532.2566466774313	15.92	0.45724	15.92	15.609	16.066	0					7	4	2	0	0	0	0.028595	1	7836	7836		76.679	32.284	1	28517000			647	263	412	427	868	868		9606
FESPEVAER	9	Unmodified	_FESPEVAER_			0	0	0	P52272	P52272	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	MULTI-MSMS	DP1141_8	3	532.7723999023438	2	532.256371	1062.49819	0.082184	4.3743E-05	0.63221	0.0003365	0.71439	0.00038024	532.2566906267317	15.926	1.1034	15.926	14.972	16.076	0					12	10	2	0	0	0	0.0043648	2	7363	7363;7461		104.44	51.651	1	36539000			648	263	412	427	869;870	869		9606
FESPEVAER	9	Unmodified	_FESPEVAER_			0	0	0	P52272	P52272	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	MULTI-MSMS	DP1141_9	4	532.7577514648438	2	532.256371	1062.49819	0.39362	0.00020951	-0.15872	-8.4477E-05	0.23491	0.00012503	532.2563371792744	15.922	0.48541	15.922	15.573	16.058	0					10	4	3	0	0	0	0.024757	1	7400	7400		80.438	27.722	1	15393000			649	263	412	427	871	871		9606
FFVAPFPEVFGK	12	Unmodified	_FFVAPFPEVFGK_			0	0	0	CON__P02662	CON__P02662	CON__P02662			MULTI-MSMS	DP1141_10	5	692.869140625	2	692.868631	1383.72271	0.94759	0.00065655	-0.37038	-0.00025662	0.57721	0.00039993	692.8683252357696	23.106	0.35888	23.106	22.942	23.301	0					13	4	5	0	0	0	0.0057687	1	19076	19076		102.06	73.98	1	54682000		+	650	11	413	428	872	872		
FFVAPFPEVFGK	12	Unmodified	_FFVAPFPEVFGK_			0	0	0	CON__P02662	CON__P02662	CON__P02662			MULTI-MSMS	DP1141_7	2	692.8690185546875	2	692.868631	1383.72271	0.82627	0.0005725	0.37125	0.00025722	1.1975	0.00082972	692.8687254000312	23.103	0.34482	23.103	22.853	23.198	0					12	4	4	0	0	0	0.0023229	2	18664	18664;18698		129.85	99.287	1	56310000		+	651	11	413	428	873;874	873		
FFVAPFPEVFGK	12	Unmodified	_FFVAPFPEVFGK_			0	0	0	CON__P02662	CON__P02662	CON__P02662			MULTI-MSMS	DP1141_8	3	692.8693237304688	2	692.868631	1383.72271	0.80327	0.00055656	0.1296	8.9796E-05	0.93287	0.00064636	692.86866755388	23.092	0.28448	23.092	22.953	23.238	0					11	3	5	0	0	0	0.0017265	2	18476	18476;18484		125.97	94.098	1	45065000		+	652	11	413	428	875;876	875		
FFVAPFPEVFGK	12	Unmodified	_FFVAPFPEVFGK_			0	0	0	CON__P02662	CON__P02662	CON__P02662			MULTI-MSMS	DP1141_9	4	692.8690795898438	2	692.868631	1383.72271	0.50632	0.00035081	0.12407	8.5964E-05	0.63039	0.00043678	692.8686682572118	23.085	0.32024	23.085	22.939	23.259	0					14	4	5	0	0	0	0.002555	2	18505	18505;18508		131.12	110.79	1	54971000		+	653	11	413	428	877;878	877		
FGALTAEK	8	Unmodified	_FGALTAEK_			0	0	0	O95372	O95372	O95372	LYPLA2	Acyl-protein thioesterase 2	MSMS	DP1141_10	5	418.571533203125	2	418.729261	835.443968	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.921	1	15.921	15.421	16.421	0								0	0	0	0.014746	1	7851	7851		107.9	50.718	1				654	90	414	429	879	879		9606
FGAYIVDGLR	10	Unmodified	_FGAYIVDGLR_			0	0	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	555.9750366210938	2	555.800749	1109.58694	0.25585	0.0001422	0.11229	6.2413E-05	0.36815	0.00020462	555.8012726464034	20.04	0.58396	20.04	19.806	20.39	0					13	5	3	0	0	0	0.013538	2	13570	13337;13570		90.601	47.306	1	1071399999.9999999			655	367;40	415	430	880;881	881		9606
FGFAIGSQTTK	11	Unmodified	_FGFAIGSQTTK_			0	0	0	Q8WW12	Q8WW12	Q8WW12	PCNP	PEST proteolytic signal-containing nuclear protein	MULTI-MSMS	DP1141_10	5	579.3064575195312	2	578.803488	1155.59242	0.55611	0.00032188	0.37208	0.00021536	0.92819	0.00053724	578.8034838798168	18.727	0.38987	18.727	18.487	18.877	0					5	3	2	0	0	0	8.9351E-09	1	12552	12552		157.34	105.49	1	24999000			656	486	416	431	882	882		9606
FGIQAQMVTTDFQKIFPMGDR	21	2 Oxidation (M)	_FGIQAQM(Oxidation (M))VTTDFQKIFPM(Oxidation (M))GDR_	FGIQAQM(1)VTTDFQKIFPM(1)GDR	FGIQAQM(44)VTTDFQKIFPM(44)GDR	0	2	1	P49720	P49720	P49720	PSMB3	Proteasome subunit beta type-3	MULTI-MSMS	DP1141_7	2	821.73291015625	3	821.39961	2461.177	0.22763	0.00018697	-1.1397	-0.00093618	-0.91211	-0.00074921	821.7329590483533	15.459	0.30464	15.459	15.309	15.614	0					4	2	2	0	0	0	0.032001	1	6941	6941		43.955	15.344	1	22797000			657	249	417	432	883	883	201;202	9606
FGQGGAGPVGGQGPR	15	Unmodified	_FGQGGAGPVGGQGPR_			0	0	0	P23246	P23246	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	MSMS	DP1141_7	2	671.82421875	2	671.33655	1340.65855	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.451	1	15.451	14.951	15.951	0								0	0	0	2.8054E-225	1	6738	6738		237.51	176.68	1				658	181	418	433	884	884		9606
FGQGVHHAAGQAGNEAGR	18	Unmodified	_FGQGVHHAAGQAGNEAGR_			0	0	0	Q6UWP8	Q6UWP8	Q6UWP8	SBSN	Suprabasin	MULTI-MSMS	DP1141_10	5	441.7134094238281	4	441.713471	1762.82478	0.24546	0.00010842	-0.014959	-6.6075E-06	0.2305	0.00010182	441.96420327419486	13.448	0.69123	13.448	12.979	13.67	0					20	8	4	0	0	0	5.0544E-05	2	3975	3975;4068		109.48	98.37	1	2973900			659	435	419	434	885;886	885		9606
FGQGVHHAAGQAGNEAGR	18	Unmodified	_FGQGVHHAAGQAGNEAGR_			0	0	0	Q6UWP8	Q6UWP8	Q6UWP8	SBSN	Suprabasin	MULTI-MSMS	DP1141_10	5	588.9503784179688	3	588.615535	1762.82478	0.89326	0.00052578	-0.18372	-0.00010814	0.70953	0.00041764	588.6153461124894	13.484	0.7012	13.484	12.879	13.581	0					17	7	3	0	0	0	0.0046068	1	4069	4069		103.01	82.226	1	3909800			660	435	419	434	887	887		9606
FGQGVHHAAGQAGNEAGR	18	Unmodified	_FGQGVHHAAGQAGNEAGR_			0	0	0	Q6UWP8	Q6UWP8	Q6UWP8	SBSN	Suprabasin	MULTI-MSMS	DP1141_6	1	441.7137756347656	4	441.713471	1762.82478	1.2057	0.00053256	-0.93554	-0.00041324	0.27014	0.00011932	441.71310961517327	13.617	0.62386	13.617	13.112	13.736	0					16	6	3	0	0	0	0.0087329	2	3590	3464;3590		51.265	34.526	1	612220			661	435	419	434	888;889	889		9606
FGQGVHHAAGQAGNEAGR	18	Unmodified	_FGQGVHHAAGQAGNEAGR_			0	0	0	Q6UWP8	Q6UWP8	Q6UWP8	SBSN	Suprabasin	MULTI-MSMS	DP1141_6	1	588.61572265625	3	588.615535	1762.82478	0.92054	0.00054185	-0.73547	-0.00043291	0.18507	0.00010894	588.6150271556486	13.617	0.69923	13.617	13.112	13.811	0					11	7	2	0	0	0	0.024604	1	3591	3591		72.433	49.942	1	430230			662	435	419	434	890	890		9606
FGQGVHHAAGQAGNEAGR	18	Unmodified	_FGQGVHHAAGQAGNEAGR_			0	0	0	Q6UWP8	Q6UWP8	Q6UWP8	SBSN	Suprabasin	MULTI-MSMS	DP1141_7	2	441.96417236328125	4	441.713471	1762.82478	0.40115	0.00017719	0.31124	0.00013748	0.71239	0.00031467	441.7138043033359	12.873	0.90422	12.873	12.624	13.528	0					19	8	3	0	0	0	0.015706	2	3374	3213;3374		39.338	20.068	1	981090			663	435	419	434	891;892	892		9606
FGQGVHHAAGQAGNEAGR	18	Unmodified	_FGQGVHHAAGQAGNEAGR_			0	0	0	Q6UWP8	Q6UWP8	Q6UWP8	SBSN	Suprabasin	MULTI-MSMS	DP1141_7	2	588.9503173828125	3	588.615535	1762.82478	0.53351	0.00031403	-0.0099706	-5.8689E-06	0.52354	0.00030816	588.9496966791728	12.873	0.6029	12.873	12.724	13.327	0					8	5	2	0	0	0	0.022134	2	3365	3230;3365		54.768	33.169	1	867280			664	435	419	434	893;894	894		9606
FGQGVHHAAGQAGNEAGR	18	Unmodified	_FGQGVHHAAGQAGNEAGR_			0	0	0	Q6UWP8	Q6UWP8	Q6UWP8	SBSN	Suprabasin	MULTI-MSMS	DP1141_8	3	441.9643859863281	4	441.713471	1762.82478	-0.092844	-4.101E-05	-0.052702	-2.3279E-05	-0.14555	-6.429E-05	441.7136488935406	13.595	0.44126	13.595	13.288	13.729	0					13	5	4	0	0	0	0.032167	1	3916	3916		32.55	2.2419	1	1324200			665	435	419	434	895	895		9606
FGQGVHHAAGQAGNEAGR	18	Unmodified	_FGQGVHHAAGQAGNEAGR_			0	0	0	Q6UWP8	Q6UWP8	Q6UWP8	SBSN	Suprabasin	MULTI-MSMS	DP1141_9	4	588.6163330078125	3	588.615535	1762.82478	0.41047	0.00024161	0.17766	0.00010458	0.58813	0.00034618	588.6157553368461	13.438	0.69752	13.438	12.903	13.601	0					13	7	2	0	0	0	0.0045611	1	3589	3589		86.005	57.278	1	1343900			666	435	419	434	896	896		9606
FGVSSESKPEEVKK	14	Unmodified	_FGVSSESKPEEVKK_			0	0	2	P49790	P49790	P49790	NUP153	Nuclear pore complex protein Nup153	MULTI-MSMS	DP1141_7	2	517.6070556640625	3	517.606872	1549.79879	0.44867	0.00023224	-0.20715	-0.00010722	0.24152	0.00012501	517.6068345979688	13.99	0.34092	13.99	13.78	14.121	0					12	3	4	0	0	0	4.019E-30	3	4539	4414;4539;4625		179.59	141.14	1	188380000			667	252	420	435	897;898;899	898		9606
FGVSSESKPEEVKK	14	Unmodified	_FGVSSESKPEEVKK_			0	0	2	P49790	P49790	P49790	NUP153	Nuclear pore complex protein Nup153	MULTI-MSMS	DP1141_8	3	517.6065673828125	3	517.606872	1549.79879	0.027715	1.4346E-05	0.16241	8.4063E-05	0.19012	9.8409E-05	517.6068966554491	14.013	0.30378	14.013	13.805	14.109	0					9	3	3	0	0	0	3.5698E-14	1	4479	4479		164.48	118.1	1	53420000			668	252	420	435	900	900		9606
FGVSSESKPEEVKK	14	Unmodified	_FGVSSESKPEEVKK_			0	0	2	P49790	P49790	P49790	NUP153	Nuclear pore complex protein Nup153	MULTI-MSMS	DP1141_9	4	517.9412841796875	3	517.606872	1549.79879	0.07508	3.8862E-05	0.079798	4.1304E-05	0.15488	8.0166E-05	517.6069199059906	14.02	0.23692	14.02	13.877	14.114	0					5	3	2	0	0	0	0.0054978	1	4353	4353		114.87	114.87	1	7005000			669	252	420	435	901	901		9606
FHSPPDKDEAEAPSQK	16	Unmodified	_FHSPPDKDEAEAPSQK_			0	0	1	P18887	P18887	P18887	XRCC1	DNA repair protein XRCC1	MULTI-MSMS	DP1141_8	3	595.2821044921875	3	594.947957	1781.82204	0.13967	8.3099E-05	-0.43915	-0.00026127	-0.29948	-0.00017817	594.9477060238894	13.805	1.0437	13.805	13.006	14.05	0					35	12	4	0	0	0	0.010982	1	3647	3647		113.52	98.726	1	4196600			670	170	421	436	902	902		9606
FIDTSQFILNR	11	Unmodified	_FIDTSQFILNR_			0	0	0	O60220	O60220	O60220	TIMM8A	Mitochondrial import inner membrane translocase subunit Tim8 A	MULTI-MSMS	DP1141_10	5	677.3621215820312	2	677.361702	1352.70885	0.78206	0.00052974	-0.92498	-0.00062654	-0.14292	-9.6807E-05	677.360878890124	20.526	1.1993	20.526	19.576	20.775	0					13	11	2	0	0	0	0.0055635	1	15415	15415		112.41	71.331	1	16281000			671	62	422	437	903	903		9606
FIGPSPEVVR	10	Unmodified	_FIGPSPEVVR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_10	5	550.8087768554688	2	550.808574	1099.60259	-0.0010065	-5.5439E-07	0.51774	0.00028517	0.51673	0.00028462	550.8087832332019	17.672	0.39981	17.672	17.488	17.887	0					7	3	3	0	0	0	0.0023473	1	10892	10892		105.1	74.304	1	61257000			672	142	423	438	904	904		9606
FIGPSPEVVR	10	Unmodified	_FIGPSPEVVR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	550.7913208007812	2	550.808574	1099.60259	0.44385	0.00024448	0.019528	1.0756E-05	0.46338	0.00025523	550.8085501698077	17.755	0.50063	17.755	17.404	17.905	0					9	4	3	0	0	0	0.0068683	4	9790	9790;9803;9874;9890		117.81	76.817	1	119970000			673	142	423	438	905;906;907;908	905		9606
FIGPSPEVVR	10	Unmodified	_FIGPSPEVVR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MSMS	DP1141_7	2	550.80859375	2	550.808574	1099.60259	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.704	1	17.704	17.204	18.204	0								0	0	0	0.014641	1	10429	10429		126.24	62.709	1				674	142	423	438	909	909		9606
FIGPSPEVVR	10	Unmodified	_FIGPSPEVVR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	550.808837890625	2	550.808574	1099.60259	0.61563	0.0003391	-0.05329	-2.9353E-05	0.56234	0.00030974	550.8084419650463	17.724	0.40013	17.724	17.474	17.874	0					9	3	4	0	0	0	0.011863	1	10374	10374		94.309	61.895	1	139050000			675	142	423	438	910	910		9606
FIGPSPEVVR	10	Unmodified	_FIGPSPEVVR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_9	4	550.8087158203125	2	550.808574	1099.60259	0.52585	0.00028964	-0.0002753	-1.5164E-07	0.52558	0.00028949	550.8085548881285	17.688	0.59946	17.688	17.437	18.037	0					11	5	4	0	0	0	0.0028289	2	10303	10219;10303		109.48	63.022	1	100280000			676	142	423	438	911;912	912		9606
FIGPSPEVVRK	11	Unmodified	_FIGPSPEVVRK_			0	0	1	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MSMS	DP1141_6	1	410.23980712890625	3	410.239796	1227.69756	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.187	1	16.187	15.687	16.687	0								0	0	0	1.5734E-06	1	7275	7275		139.15	77.388	1				677	142	424	439	913	913		9606
FIGPSPEVVRK	11	Unmodified	_FIGPSPEVVRK_			0	0	1	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	410.23980712890625	3	410.239796	1227.69756	0.40693	0.00016694	-0.27433	-0.00011254	0.1326	5.4397E-05	410.2396855378709	16.162	0.60007	16.162	15.815	16.415	0					10	5	4	0	0	0	6.8679E-22	2	7908	7795;7908		173.24	113.07	1	106920000			678	142	424	439	914;915	915		9606
FIIGSVSEDNSEDEISNLVK	20	Unmodified	_FIIGSVSEDNSEDEISNLVK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	1098.541259765625	2	1098.03934	2194.06412	0.41912	0.00046021	0.024633	2.7048E-05	0.44375	0.00048725	1098.5409814661737	21.51	0.81051	21.51	21.126	21.936	0					19	9	3	0	0	0	6.0739E-111	2	15855	15855;16383		257.76	208.48	1	107190000			679	367	425	440	916;917	916		9606
FKEQEQDDSTVACR	14	Unmodified	_FKEQEQDDSTVACR_			0	0	1	Q7LBC6	Q7LBC6	Q7LBC6	KDM3B	Lysine-specific demethylase 3B	MULTI-SECPEP	DP1141_7	2	571.768310546875	3	571.589664	1711.74716	0.62357	0.00035643	-0.0991	-5.6645E-05	0.52447	0.00029978	571.5895927775249	14.171	0.46148	14.171	13.947	14.408	0					7	3	3	0	0	0	4.6017E-49	1	4823	4823		199.13	166.69	1	11042000			680	447	426	441	918	918		9606
FLAVGLVDNTVR	12	Unmodified	_FLAVGLVDNTVR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	652.3695068359375	2	652.372069	1302.72959	0.36725	0.00023958	-0.10448	-6.8157E-05	0.26277	0.00017143	652.3719828781292	20.241	0.48697	20.241	19.998	20.485	0					11	4	4	0	0	0	0.0050804	1	13822	13822		135.43	87.826	1	99878000			681	402	427	442	919	919		9606
FLAVGLVDNTVR	12	Unmodified	_FLAVGLVDNTVR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_7	2	652.3726196289062	2	652.372069	1302.72959	0.099981	6.5225E-05	-0.017235	-1.1244E-05	0.082746	5.3981E-05	652.3720858915568	20.2	0.50077	20.2	19.95	20.451	0					6	4	2	0	0	0	0.027532	1	14462	14462		90.108	43.217	1	428590000			682	402	427	442	920	920		9606
FLEQQNQVLETK	12	Unmodified	_FLEQQNQVLETK_			0	0	0	CON__Q14CN4-1;CON__Q6IME9;Q14CN4;CON__Q3SY84;CON__Q7RTS7;CON__Q32MB2;Q3SY84;Q7RTS7;Q86Y46	CON__Q14CN4-1	CON__Q14CN4-1	KRT72;KRT71;KRT74;KRT73	Keratin, type II cytoskeletal 72;Keratin, type II cytoskeletal 71;Keratin, type II cytoskeletal 74;Keratin, type II cytoskeletal 73	MULTI-MSMS	DP1141_7	2	739.01708984375	2	738.888281	1475.76201	0.57028	0.00042137	0.63127	0.00046644	1.2015	0.0008878	739.3899129982784	17.557	0.69977	17.557	17.349	18.049	0					11	6	3	0	0	0	0.0063967	1	10293	10293		102.07	11.466	1	12300000		+	683	22	428	443	921	921		9606
FLFENQTPAHVYYR	14	Unmodified	_FLFENQTPAHVYYR_			0	0	0	O15042	O15042	O15042	U2SURP	U2 snRNP-associated SURP motif-containing protein	MSMS	DP1141_7	2	893.1632690429688	2	892.941379	1783.8682	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.135	1	19.135	18.635	19.635	0								0	0	0	0.0089885	1	12705	12705		113.22	62.132	1				684	49	429	444	922	922		9606
FLHKHDLDLICR	12	Unmodified	_FLHKHDLDLICR_			0	0	1	P62136;P36873	P62136;P36873	P62136	PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MSMS	DP1141_10	5	522.9453125	3	522.945165	1565.81367	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.174	1	17.174	16.674	17.674	0								0	0	0	0.0090568	1	9958	9958		158.06	110.09	1				685	286;212	430	445	923	923		9606
FLHKHDLDLICR	12	Unmodified	_FLHKHDLDLICR_			0	0	1	P62136;P36873	P62136;P36873	P62136	PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_8	3	783.7115478515625	2	783.91411	1565.81367	0.29037	0.00022762	0.34197	0.00026808	0.63234	0.0004957	783.9143193610793	17.123	0.37296	17.123	16.9	17.273	0					5	3	2	0	0	0	1.5256E-39	1	9317	9317		187.42	157.64	1	125240000			686	286;212	430	445	924	924		9606
FLHKHDLDLICR	12	Unmodified	_FLHKHDLDLICR_			0	0	1	P62136;P36873	P62136;P36873	P62136	PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_8	3	522.9453735351562	3	522.945165	1565.81367	0.090908	4.754E-05	0.026161	1.3681E-05	0.11707	6.1221E-05	522.9454753108262	17.123	1.7474	17.123	16.828	18.575	0					32	17	5	0	0	0	0.0086694	2	9407	9335;9407		177.83	145.95	1	1234000000			687	286;212	430	445	925;926	926		9606
FLHKHDLDLICR	12	Unmodified	_FLHKHDLDLICR_			0	0	1	P62136;P36873	P62136;P36873	P62136	PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_9	4	523.2794799804688	3	522.945165	1565.81367	0.24189	0.00012649	-0.039879	-2.0855E-05	0.20201	0.00010564	522.9453673356903	17.188	0.68377	17.188	16.854	17.537	0					20	7	5	0	0	0	0.0087671	2	9437	9360;9437		184.87	152.58	1	601750000			688	286;212	430	445	927;928	928		9606
FLILPDMLK	9	Unmodified	_FLILPDMLK_			0	0	0	P62318	P62318	P62318	SNRPD3	Small nuclear ribonucleoprotein Sm D3	MULTI-MSMS	DP1141_10	5	545.3233032226562	2	545.322471	1088.63039	0.43907	0.00023944	0.34406	0.00018763	0.78314	0.00042706	545.3226462909374	22.481	0.2595	22.481	22.259	22.518	0					4	2	2	0	0	0	0.019894	1	18158	18158		84.568	49.13	1	8596200			689	299	431	446	929	929		9606
FLNLNLR	7	Unmodified	_FLNLNLR_			0	0	0	O75342	O75342	O75342	ALOX12B	Arachidonate 12-lipoxygenase, 12R-type	MSMS	DP1141_9	4	445.5752868652344	2	445.266345	888.518136	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.171	1	18.171	17.671	18.671	0								0	0	0	0.014168	1	11014	11014		109.88	32.132	1				690	71	432	447	930	930		9606
FLNVLSPR	8	Unmodified	_FLNVLSPR_			0	0	0	P17936	P17936	P17936	IGFBP3	Insulin-like growth factor-binding protein 3	MULTI-MSMS	DP1141_10	5	473.279296875	2	473.279452	944.544351	0.60652	0.00028706	0.03594	1.7009E-05	0.64246	0.00030406	473.27941306255786	19.027	0.69	19.027	18.487	19.177	0					13	6	3	0	0	0	0.018002	1	12887	12887		98.418	49.321	1	65142000			691	164	433	448	931	931		9606
FLNVLSPR	8	Unmodified	_FLNVLSPR_			0	0	0	P17936	P17936	P17936	IGFBP3	Insulin-like growth factor-binding protein 3	MULTI-MSMS	DP1141_7	2	473.27960205078125	2	473.279452	944.544351	0.27973	0.00013239	0.29597	0.00014008	0.5757	0.00027247	473.2795359344309	19	0.50041	19	18.65	19.15	0					7	4	2	0	0	0	0.030318	1	12532	12532		86.472	4.2318	1	81828000			692	164	433	448	932	932		9606
FLNVLSPR	8	Unmodified	_FLNVLSPR_			0	0	0	P17936	P17936	P17936	IGFBP3	Insulin-like growth factor-binding protein 3	MULTI-MSMS	DP1141_9	4	473.27947998046875	2	473.279452	944.544351	0.33702	0.00015951	0.10934	5.1746E-05	0.44636	0.00021125	473.27943653177806	18.987	0.70075	18.987	18.437	19.138	0					11	6	3	0	0	0	0.016579	1	12354	12354		94.662	37.941	1	62812000			693	164	433	448	933	933		9606
FLSDVYPDGFK	11	Unmodified	_FLSDVYPDGFK_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_6	1	644.9559936523438	2	644.316428	1286.6183	0.58455	0.00037663	0.17275	0.0001113	0.7573	0.00048794	644.3165096325553	20.04	0.48506	20.04	19.806	20.291	0					10	4	3	0	0	0	3.2385E-31	2	13471	13471;13568		182.39	136.42	1	41619000			694	110	434	449	934;935	934		9606
FLSDVYPDGFK	11	Unmodified	_FLSDVYPDGFK_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MSMS	DP1141_7	2	643.82861328125	2	644.316428	1286.6183	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.994	1	19.994	19.494	20.494	0								0	0	0	6.9546E-07	1	14019	14019		143.03	91.038	1				695	110	434	449	936	936		9606
FLSDVYPDGFK	11	Unmodified	_FLSDVYPDGFK_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_8	3	644.3407592773438	2	644.316428	1286.6183	0.87476	0.00056362	0.13447	8.6642E-05	1.0092	0.00065027	644.3164667144893	20.026	0.40018	20.026	19.877	20.277	0					7	3	3	0	0	0	3.0232E-52	1	13874	13874		191.45	136.08	1	183550000			696	110	434	449	937	937		9606
FLSSAAAVSK	10	Unmodified	_FLSSAAAVSK_			0	0	0	P27708	P27708	P27708	CAD	CAD protein;Glutamine-dependent carbamoyl-phosphate synthase;Aspartate carbamoyltransferase;Dihydroorotase	MULTI-MSMS	DP1141_6	1	491.290283203125	2	490.7742	979.533846	0.22199	0.00010895	0.63306	0.00031069	0.85505	0.00041964	490.77429530114057	15.795	0.39177	15.795	15.613	16.005	0					5	3	2	0	0	0	0.022524	1	6707	6707		81.95	35.998	1	1279400			697	191	435	450	938	938		9606
FLYECPWR	8	Unmodified	_FLYECPWR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	585.7740478515625	2	585.773677	1169.5328	0.87029	0.00050979	-0.54112	-0.00031698	0.32916	0.00019281	585.7734497895649	20.14	0.5792	20.14	19.906	20.485	0					13	5	4	0	0	0	2.3108000000000002E-29	1	13644	13644		178.84	131.77	1	60927000			698	142	436	451	939	939		9606
FLYECPWR	8	Unmodified	_FLYECPWR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	585.7738647460938	2	585.773677	1169.5328	0.79522	0.00046582	-0.72907	-0.00042707	0.066147	3.8747E-05	585.7734361415286	20.1	0.50071	20.1	19.85	20.351	0					14	4	4	0	0	0	2.3108000000000002E-29	2	14186	14186;14243		178.84	142.96	1	617560000			699	142	436	451	940;941	940		9606
FLYECPWR	8	Unmodified	_FLYECPWR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MSMS	DP1141_8	3	585.7741088867188	2	585.773677	1169.5328	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.149	1	20.149	19.649	20.649	0								0	0	0	0.0169	1	14061	14061		110.63	63.639	1				700	142	436	451	942	942		9606
FLYIWPNAR	9	Unmodified	_FLYIWPNAR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_10	5	590.3195190429688	2	590.319109	1178.62366	0.98586	0.00058197	-0.32663	-0.00019282	0.65923	0.00038916	590.3189355290542	21.409	0.38307	21.409	21.176	21.559	0					5	3	2	0	0	0	0.02388	1	16691	16691		81.297	38.173	1	173320000			701	567	437	452	943	943		9606
FLYIWPNAR	9	Unmodified	_FLYIWPNAR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	590.3198852539062	2	590.319109	1178.62366	0.33862	0.00019989	0.30041	0.00017734	0.63902	0.00037723	590.3196676816013	21.429	1.0009	21.429	21.178	22.179	0					13	9	2	0	0	0	0.021166	1	16092	16092		83.801	58.064	1	2071299999.9999998			702	567	437	452	944	944		9606
FLYIWPNAR	9	Unmodified	_FLYIWPNAR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	590.3071899414062	2	590.319109	1178.62366	0.37171	0.00021943	0.059731	3.526E-05	0.43144	0.00025469	590.3191311766161	21.388	1.1818	21.388	20.937	22.119	0					17	11	2	0	0	0	0.010374	2	16079	16079;16257		97.068	53.525	1	191590000			703	567	437	452	945;946	945		9606
FNADEFEDMVAEKR	14	Oxidation (M)	_FNADEFEDM(Oxidation (M))VAEKR_	FNADEFEDM(1)VAEKR	FNADEFEDM(61)VAEKR	0	1	1	P27635	P27635	P27635	RPL10	60S ribosomal protein L10	MULTI-SECPEP	DP1141_10	5	573.3190307617188	3	572.922643	1715.7461	0.3385	0.00019393	0.030098	1.7244E-05	0.3686	0.00021118	573.2567562613772	18.291	0.39943	18.291	18.087	18.487	0					10	3	4	0	0	0	0.0043724	1	11925	11925		61.409	24.465	1	8688400			704	190	438	453	947	947	165	9606
FNEQIEPIYALLR	13	Unmodified	_FNEQIEPIYALLR_			0	0	0	P29083	P29083	P29083	GTF2E1	General transcription factor IIE subunit 1	MULTI-MSMS	DP1141_8	3	803.9374389648438	2	803.435398	1604.85624	0.77699	0.00062426	0.14589	0.00011721	0.92287	0.00074147	803.9370602249336	22.738	0.38828	22.738	22.565	22.953	0					5	4	2	0	0	0	0.011614	2	17944	17813;17944		85.958	25.468	1	4906400			705	194	439	454	948;949	949		9606
FPGQLNADLR	10	Unmodified	_FPGQLNADLR_			0	0	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	MULTI-MSMS	DP1141_10	5	565.801513671875	2	565.80128	1129.58801	0.62043	0.00035104	-0.1254	-7.095E-05	0.49504	0.00028009	565.8012015447346	18.237	0.7893	18.237	18.087	18.877	0					14	7	2	0	0	0	0.015276	1	11864	11864		89.029	50.726	1	114530000			706	122;323;381;376	440	455	950	950		9606
FPGQLNADLR	10	Unmodified	_FPGQLNADLR_			0	0	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	MULTI-MSMS	DP1141_7	2	565.819580078125	2	565.80128	1129.58801	0.20031	0.00011334	0.38709	0.00021902	0.5874	0.00033235	565.8017472792576	18.299	0.70046	18.299	18.149	18.85	0					12	6	3	0	0	0	0.0019585	1	11331	11331		134.26	84.837	1	42456000			707	122;323;381;376	440	455	951	951		9606
FPGQLNADLR	10	Unmodified	_FPGQLNADLR_			0	0	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	MULTI-MSMS	DP1141_8	3	565.8014526367188	2	565.80128	1129.58801	-0.069195	-3.915E-05	0.74536	0.00042173	0.67617	0.00038258	565.8015518715932	18.268	0.80086	18.268	18.075	18.876	0					39	7	6	0	0	0	0.0047273	2	11303	11303;12053		123.21	77.236	1	291230000			708	122;323;381;376	440	455	952;953	952		9606
FPGQLNADLR	10	Unmodified	_FPGQLNADLR_			0	0	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	MULTI-MSMS	DP1141_9	4	565.8013916015625	2	565.80128	1129.58801	0.17675	0.0001	-0.002562	-1.4496E-06	0.17418	9.8553E-05	565.8013027150826	18.287	1.0006	18.287	18.037	19.037	0					25	9	4	0	0	0	0.0065872	2	11361	11361;11862		120.31	67.824	1	252320000			709	122;323;381;376	440	455	954;955	954		9606
FPGQLNADLRK	11	Unmodified	_FPGQLNADLRK_			0	0	1	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	MULTI-MSMS	DP1141_8	3	420.235107421875	3	420.234933	1257.68297	0.050426	2.1191E-05	0.15839	6.6563E-05	0.20882	8.7754E-05	420.2350336868583	16.689	0.71089	16.689	16.562	17.273	0					28	7	4	0	0	0	0.0038215	1	8821	8821		100.82	40.98	1	83855000			710	122;323;381;376	441	456	956	956		9606
FPGQLNADLRK	11	Unmodified	_FPGQLNADLRK_			0	0	1	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	MULTI-SECPEP	DP1141_8	3	629.3516845703125	2	629.848761	1257.68297	0.2714	0.00017094	1.3808	0.0008697	1.6522	0.0010406	629.8497809059434	17.038	1.1117	17.038	16.562	17.674	0					16	11	2	0	0	0	0.011942	1	8748	8748		79.986	45.183	1	16064000			711	122;323;381;376	441	456	957	957		9606
FPGQLNADLRK	11	Unmodified	_FPGQLNADLRK_			0	0	1	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	MULTI-MSMS	DP1141_9	4	419.7750244140625	3	420.234933	1257.68297	0.23441	9.8509E-05	0.17815	7.4863E-05	0.41256	0.00017337	420.23498464392964	16.742	0.81715	16.742	16.62	17.437	0					23	9	3	0	0	0	0.028856	1	8685	8685		72.2	33.418	1	167400000			712	122;323;381;376	441	456	958	958		9606
FPGQLNADLRK	11	Unmodified	_FPGQLNADLRK_			0	0	1	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	MSMS	DP1141_9	4	629.85302734375	2	629.848761	1257.68297	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.728	1	16.728	16.228	17.228	0								0	0	0	0.032796	1	8657	8657		131.12	55.464	1				713	122;323;381;376	441	456	959	959		9606
FPNRPQMVK	9	Unmodified	_FPNRPQMVK_			0	0	1	Q8IZF0	Q8IZF0	Q8IZF0	NALCN	Sodium leak channel non-selective protein	MULTI-SECPEP	DP1141_10	5	558.97119140625	2	558.802768	1115.59098	1.3592	0.00075954	3.816	0.0021324	5.1752	0.0028919	558.8051793851992	21.126	0.40062	21.126	20.875	21.276	0					5	3	2	0	0	0	0.022381	1	16162	16162		97.602	1.7868	1	14471000			714	466	442	457	960	960		9606
FPSLLTHNENMVAK	14	Oxidation (M)	_FPSLLTHNENM(Oxidation (M))VAK_	FPSLLTHNENM(1)VAK	FPSLLTHNENM(93)VAK	0	1	0	P62906	P62906	P62906	RPL10A	60S ribosomal protein L10a	MULTI-SECPEP	DP1141_10	5	539.8167114257812	3	539.608219	1615.80283	-0.68763	-0.00037105	1.1618	0.00062691	0.47415	0.00025585	539.6090173039369	17.637	0.6005	17.637	17.187	17.788	0					11	5	3	0	0	0	0.0032695	1	10732	10732		92.792	54.554	1	53392000			715	311	443	458	961	961	242	9606
FPVAPLIPYPLITK	14	Unmodified	_FPVAPLIPYPLITK_			0	0	0	P49756	P49756	P49756	RBM25	RNA-binding protein 25	MULTI-MSMS	DP1141_7	2	785.4776000976562	2	784.97617	1567.93779	0.64694	0.00050783	-0.060745	-4.7683E-05	0.5862	0.00046015	785.4771917455237	23.027	0.22617	23.027	22.906	23.132	0					6	2	3	0	0	0	0.0074057	1	18650	18650		90.653	51.939	1	13367000			716	251	444	459	962	962		9606
FQDELESGK	9	Unmodified	_FQDELESGK_			0	0	0	O15042	O15042	O15042	U2SURP	U2 snRNP-associated SURP motif-containing protein	MULTI-MSMS	DP1141_7	2	527.7437744140625	2	526.748379	1051.4822	0.24738	0.00013031	-2.6511	-0.0013965	-2.4037	-0.0012662	526.747066658774	15.954	0.60023	15.954	15.714	16.315	0					9	5	3	0	0	0	0.010269	1	7516	7516		90.37	29.398	1	8270000			717	49	445	460	963	963		9606
FQRPGDPQSAQDK	13	Unmodified	_FQRPGDPQSAQDK_			0	0	1	Q15637	Q15637	Q15637	SF1	Splicing factor 1	MULTI-MSMS	DP1141_8	3	491.90765380859375	3	491.907545	1472.7008	0.24751	0.00012175	-0.08969	-4.4119E-05	0.15782	7.7631E-05	491.9075782102287	14.013	0.76631	14.013	13.587	14.354	0					22	9	4	0	0	0	0.014533	2	4450	4353;4450		125.84	99.086	1	45681000			718	407	446	461	964;965	965		9606
FRNMVQTAVVPVKK	14	Oxidation (M)	_FRNM(Oxidation (M))VQTAVVPVKK_	FRNM(1)VQTAVVPVKK	FRNM(88)VQTAVVPVKK	0	1	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-SECPEP	DP1141_8	3	544.2444458007812	3	544.979987	1631.91813	0.96824	0.00052767	-0.45552	-0.00024825	0.51272	0.00027942	544.9797680346717	14.929	0.29967	14.929	14.772	15.072	0					8	2	4	0	0	0	0.0085999	1	5932	5932		88.224	71.651	1	24825000			719	365	447	462	966	966	264	9606
FRNMVQTAVVPVKK	14	Oxidation (M)	_FRNM(Oxidation (M))VQTAVVPVKK_	FRNM(1)VQTAVVPVKK	FRNM(66)VQTAVVPVKK	0	1	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-SECPEP	DP1141_9	4	544.78369140625	3	544.979987	1631.91813	0.83404	0.00045453	-0.80826	-0.00044048	0.025784	1.4052E-05	545.3136496171676	14.933	0.27979	14.933	14.795	15.075	0					6	2	3	0	0	0	0.018172	1	5770	5770		65.895	52.31	1	9150900			720	365	447	462	967	967	264	9606
FSAVLVEPPPMSLPGAGLSSQELSGGPGDGP	31	Oxidation (M)	_FSAVLVEPPPM(Oxidation (M))SLPGAGLSSQELSGGPGDGP_	FSAVLVEPPPM(1)SLPGAGLSSQELSGGPGDGP	FSAVLVEPPPM(56)SLPGAGLSSQELSGGPGDGP	0	1	0	Q13263	Q13263	Q13263	TRIM28	Transcription intermediary factor 1-beta	MULTI-MSMS	DP1141_7	2	990.4800415039062	3	989.486578	2965.4379	0.46347	0.0004586	-0.82227	-0.00081362	-0.3588	-0.00035502	989.8205831580655	22.703	0.33336	22.703	22.572	22.906	0					9	4	3	0	0	0	3.0785E-07	1	18060	18060		56.332	39.235	1	11576000			721	372	448	463	968	968	290	9606
FSAVLVEPPPMSLPGAGLSSQELSGGPGDGP	31	Unmodified	_FSAVLVEPPPMSLPGAGLSSQELSGGPGDGP_			0	0	0	Q13263	Q13263	Q13263	TRIM28	Transcription intermediary factor 1-beta	MULTI-MSMS	DP1141_7	2	984.8248291015625	3	984.154939	2949.44299	0.41325	0.0004067	-0.30157	-0.00029679	0.11168	0.00010991	984.4890137982147	23.914	0.35108	23.914	23.733	24.084	0					13	4	4	0	0	0	0.0020491	1	19873	19873		43.732	30.03	1	4048700			722	372	448	464	969	969		9606
FSEILETSSTK	11	Unmodified	_FSEILETSSTK_			0	0	0	Q6W2J9	Q6W2J9	Q6W2J9	BCOR	BCL-6 corepressor	MSMS	DP1141_7	2	620.9656982421875	2	621.316625	1240.6187	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.322	1	17.322	16.822	17.822	0								0	0	0	0.032334	1	9803	9803		94.692	45.896	1				723	438	449	465	970	970		9606
FTQDTQPHYIYSPR	14	Unmodified	_FTQDTQPHYIYSPR_			0	0	0	Q14204	Q14204	Q14204	DYNC1H1	Cytoplasmic dynein 1 heavy chain 1	MULTI-MSMS	DP1141_6	1	585.2671508789062	3	584.949521	1751.82673	0.34174	0.0001999	-0.18659	-0.00010915	0.15514	9.075E-05	585.2834312269313	16.914	0.27498	16.914	16.729	17.004	0					7	3	3	0	0	0	0.012679	1	8398	8398		73.415	46.085	1	7730900			724	384	450	466	971	971		9606
FVADGIFK	8	Unmodified	_FVADGIFK_			0	0	0	P23396	P23396	P23396	RPS3	40S ribosomal protein S3	MULTI-SECPEP	DP1141_10	5	448.20379638671875	2	448.747453	895.480354	0.35963	0.00016138	0.3438	0.00015428	0.70343	0.00031566	448.74750004333384	19.227	0.29978	19.227	18.977	19.277	0					6	2	3	0	0	0	0.0070811	1	13240	13240		106.42	65.495	1	10609000			725	182	451	467	972	972		9606
FVIATSTK	8	Unmodified	_FVIATSTK_			0	0	0	Q02878	Q02878	Q02878	RPL6	60S ribosomal protein L6	MULTI-MSMS	DP1141_9	4	434.2505187988281	2	433.752736	865.490919	0.030876	1.3392E-05	0.44511	0.00019307	0.47598	0.00020646	433.7528716908595	16.208	0.29993	16.208	16.058	16.358	0					6	2	3	0	0	0	0.015399	1	7840	7840		93.195	47.244	1	22823000			726	343	452	468	973	973		9606
FVINYDYPNSSEDYIHR	17	Unmodified	_FVINYDYPNSSEDYIHR_			0	0	0	P17844	P17844	P17844	DDX5	Probable ATP-dependent RNA helicase DDX5	MULTI-MSMS	DP1141_8	3	711.3783569335938	3	711.328838	2130.96468	0.55922	0.00039779	0.074993	5.3345E-05	0.63421	0.00045113	711.3287634553127	19.426	0.40114	19.426	19.275	19.676	0					8	3	3	0	0	0	9.8831E-16	2	12980	12980;13145		196.18	176.76	1	50305000			727	163	453	469	974;975	974		9606
FVINYDYPNSSEDYVHR	17	Unmodified	_FVINYDYPNSSEDYVHR_			0	0	0	Q92841	Q92841	Q92841	DDX17	Probable ATP-dependent RNA helicase DDX17	MULTI-MSMS	DP1141_8	3	707.5740966796875	3	706.656954	2116.94903	0.80272	0.00056724	-0.04257	-3.0082E-05	0.76015	0.00053716	706.6572635887301	19.125	0.4994	19.125	18.876	19.375	0					8	4	3	0	0	0	0.0019928	2	12579	12579;12732		117	98.983	1	19859000			728	496	454	470	976;977	976		9606
FVKEPAFEDITLESER	16	Unmodified	_FVKEPAFEDITLESER_			0	0	1	O75400	O75400	O75400	PRPF40A	Pre-mRNA-processing factor 40 homolog A	MULTI-SECPEP	DP1141_7	2	636.8507690429688	3	637.322913	1908.94691	-0.048452	-3.088E-05	0.7868	0.00050144	0.73835	0.00047056	637.6578003187343	19.3	0.40063	19.3	19.05	19.451	0					5	3	2	0	0	0	6.6333E-42	1	12984	12984		185.86	151.36	1	87675000			729	74	455	471	978	978		9606
FVMEVEVDGQK	11	Oxidation (M)	_FVM(Oxidation (M))EVEVDGQK_	FVM(1)EVEVDGQK	FVM(86)EVEVDGQK	0	1	0	Q96SI9;Q12906	Q96SI9	Q96SI9	STRBP;ILF3	Spermatid perinuclear RNA-binding protein;Interleukin enhancer-binding factor 3	MSMS	DP1141_8	3	648.8096923828125	2	648.810653	1295.60675	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.542	1	16.542	16.042	17.042	0								0	0	0	0.029218	1	8423	8423		85.862	47.112	1				730	362	456	472	979	979	262	9606
FVPDKEFSGSDRR	13	Unmodified	_FVPDKEFSGSDRR_			0	0	2	Q13573	Q13573	Q13573	SNW1	SNW domain-containing protein 1	MULTI-MSMS	DP1141_9	4	514.2949829101562	3	513.923195	1538.74776	0.21887	0.00011248	0.65452	0.00033637	0.87339	0.00044885	513.9233356362793	15.124	0.54038	15.124	14.634	15.174	0					8	5	3	0	0	0	0.032942	1	5905	5905		69.721	44.543	1	8830600			731	377	457	473	980	980		9606
FVTLSATNAK	10	Unmodified	_FVTLSATNAK_			0	0	0	Q96S55	Q96S55	Q96S55	WRNIP1	ATPase WRNIP1	MSMS	DP1141_8	3	525.8689575195312	2	526.292756	1050.57096	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.598	1	16.598	16.098	17.098	0								0	0	0	4.2368E-85	1	8517	8517		199.29	161.15	1				732	522	458	474	981	981		9606
FVTPSEPVAHSR	12	Unmodified	_FVTPSEPVAHSR_			0	0	0	O14654	O14654	O14654	IRS4	Insulin receptor substrate 4	MULTI-MSMS	DP1141_6	1	442.9211730957031	3	442.89821	1325.6728	0.49816	0.00022063	-0.2285	-0.0001012	0.26967	0.00011943	442.89813725722394	15.358	0.50222	15.358	15.008	15.51	0					9	4	3	0	0	0	0.0027147	3	5975	5716;5856;5975		117.09	87.324	1	23093000			733	44	459	475	982;983;984	984		9606
FVVMVTPEDLK	11	Oxidation (M)	_FVVM(Oxidation (M))VTPEDLK_	FVVM(1)VTPEDLK	FVVM(150)VTPEDLK	0	1	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	648.3446044921875	2	647.341589	1292.66863	0.46004	0.0002978	0.23306	0.00015087	0.6931	0.00044867	647.3417754097579	19.355	1.1854	19.355	19.105	20.291	0					26	11	3	0	0	0	0.0027105	3	12447	12221;12431;12447		146.69	81.228	1	338220000			734	367;40	460	476	985;986;987	987	34	9606
FVVMVTPEDLK	11	Oxidation (M)	_FVVM(Oxidation (M))VTPEDLK_	FVVM(1)VTPEDLK	FVVM(110)VTPEDLK	0	1	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	647.3426513671875	2	647.341589	1292.66863	-0.18995	-0.00012296	1.6267	0.001053	1.4367	0.00093004	647.3426497737873	19.292	0.7005	19.292	18.95	19.65	0					13	6	4	0	0	0	0.027916	1	13121	13121		112.11	64.148	1	66851000			735	367;40	460	476	988	988	34	9606
FVVMVTPEDLK	11	Oxidation (M)	_FVVM(Oxidation (M))VTPEDLK_	FVVM(1)VTPEDLK	FVVM(100)VTPEDLK	0	1	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_9	4	647.3418579101562	2	647.341589	1292.66863	0.80323	0.00051996	-0.10381	-6.7204E-05	0.69941	0.00045276	647.341510050978	19.288	0.30057	19.288	19.138	19.438	0					4	2	2	0	0	0	0.032446	1	12963	12963		100.25	70.472	1	15823000			736	367;40	460	476	989	989	34	9606
FVVMVTPEDLK	11	Unmodified	_FVVMVTPEDLK_			0	0	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	639.3446655273438	2	639.344132	1276.67371	0.83405	0.00053325	-0.39711	-0.00025389	0.43694	0.00027936	639.344014006883	20.341	0.48697	20.341	19.998	20.485	0					10	4	3	0	0	0	1.144E-95	2	13944	13944;13975		211.45	157.67	1	279420000			737	367;40	460	477	990;991	990		9606
FWEVISDEHGIDPTGTYHGDSDLQLDR	27	Unmodified	_FWEVISDEHGIDPTGTYHGDSDLQLDR_			0	0	0	P07437	P07437	P07437	TUBB	Tubulin beta chain	MULTI-MSMS	DP1141_8	3	777.4614868164062	4	776.357345	3101.40027	0.3365	0.00026124	0.38258	0.00029701	0.71907	0.00055826	776.6085750358105	20.427	0.50158	20.427	20.176	20.678	0					15	4	5	0	0	0	0.0059744	1	14448	14448		41.087	17.175	1	41547000			738	122	461	478	992	992		9606
GADEDDEKEWGDDEEEQPSKR	21	Unmodified	_GADEDDEKEWGDDEEEQPSKR_			0	0	2	Q15020	Q15020	Q15020	SART3	Squamous cell carcinoma antigen recognized by T-cells 3	MSMS	DP1141_7	2	821.88671875	3	822.005476	2462.9946	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.289	1	15.289	14.789	15.789	0								0	0	0	1.8721E-44	1	6480	6480		166.47	154.55	1				739	398	462	479	993	993		9606
GAEIIVCTPGR	11	Unmodified	_GAEIIVCTPGR_			0	0	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-MSMS	DP1141_6	1	586.7901611328125	2	586.808248	1171.60194	0.49949	0.00029311	0.18445	0.00010824	0.68395	0.00040135	586.8083924057592	17.153	0.31236	17.153	16.891	17.204	0					5	3	2	0	0	0	2.7242999999999998E-21	1	8853	8853		169.44	107.76	1	4500500			740	445	463	480	994	994		9606
GAFSPFGNIIDLSMDPPR	18	Oxidation (M)	_GAFSPFGNIIDLSM(Oxidation (M))DPPR_	GAFSPFGNIIDLSM(1)DPPR	GAFSPFGNIIDLSM(170)DPPR	0	1	0	P18615	P18615	P18615	NELFE	Negative elongation factor E	MULTI-MSMS	DP1141_9	4	975.1929931640625	2	975.474925	1948.9353	0.55294	0.00053938	0.29741	0.00029011	0.85035	0.0008295	975.4755032575247	22.853	0.35421	22.853	22.713	23.067	0					10	4	4	0	0	0	4.0873E-23	3	18189	18189;18217;18224		172.58	138.07	1	8124300			741	168	464	481	995;996;997	995	153	9606
GANAVGYTNYPDNVVFK	17	Unmodified	_GANAVGYTNYPDNVVFK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MSMS	DP1141_7	2	914.9473876953125	2	914.946858	1827.87916	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.425	1	19.425	18.925	19.925	0								0	0	0	3.0804E-28	1	13148	13148		158.01	112.1	1				742	142	465	482	998	998		9606
GASQAGMTGYGMPR	14	Oxidation (M)	_GASQAGM(Oxidation (M))TGYGMPR_	GASQAGM(0.997)TGYGM(0.003)PR	GASQAGM(26)TGYGM(-26)PR	0	1	0	P37802;Q9UI15	P37802	P37802	TAGLN2;TAGLN3	Transgelin-2;Transgelin-3	MULTI-MSMS	DP1141_10	5	701.1175537109375	2	700.308286	1398.60202	0.86715	0.00060727	-0.24106	-0.00016882	0.62609	0.00043846	700.3077356121657	15.724	0.2485	15.724	15.533	15.781	0					6	2	3	0	0	0	0.019373	1	7573	7573		99.283	74.157	2	23969000			743	213	466	483	999	999	178	9606
GATYGKPVHHGVNQLK	16	Unmodified	_GATYGKPVHHGVNQLK_			0	0	1	P61313	P61313	P61313	RPL15	60S ribosomal protein L15	MULTI-MSMS	DP1141_10	5	569.3095703125	3	569.309272	1704.90599	1.331	0.00075774	-1.0348	-0.00058912	0.29619	0.00016862	569.3087386155455	12.746	0.4882	12.746	12.591	13.079	0					10	4	4	0	0	0	0.0081338	1	3247	3247		124.07	104.89	1	3452300			744	282	467	484	1000	1000		9606
GAVEIIFK	8	Unmodified	_GAVEIIFK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_10	5	438.91961669921875	2	438.763104	875.511654	0.49283	0.00021624	0.1372	6.0198E-05	0.63003	0.00027644	438.76301610597875	19.127	0.59915	19.127	18.977	19.576	0					6	5	2	0	0	0	5.7085E-06	1	13174	13174		133.81	9.2184	1	57111000			745	111	468	485	1001	1001		9606
GAVEIIFK	8	Unmodified	_GAVEIIFK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	438.9188537597656	2	438.763104	875.511654	0.32844	0.00014411	0.16761	7.354E-05	0.49605	0.00021765	438.7630901289438	19.125	0.60007	19.125	18.976	19.576	0					10	5	3	0	0	0	8.7016E-06	1	12562	12562		143.85	9.7969	1	136760000			746	111	468	485	1002	1002		9606
GAWSNVLR	8	Unmodified	_GAWSNVLR_			0	0	0	P05141;P12236;P12235	P05141	P05141	SLC25A5;SLC25A6;SLC25A4	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed;ADP/ATP translocase 3;ADP/ATP translocase 3, N-terminally processed;ADP/ATP translocase 1	MULTI-SECPEP	DP1141_10	5	452.2344055175781	2	451.745776	901.477	-0.33246	-0.00015019	0.93127	0.0004207	0.5988	0.00027051	451.7460255993679	18.537	0.29976	18.537	18.287	18.587	0					4	2	2	0	0	0	0.018587	1	12052	12052		101.21	56.681	1	8105600			747	109	469	486	1003	1003		9606
GCGTVLLSGPR	11	Unmodified	_GCGTVLLSGPR_			0	0	0	Q07020	Q07020	Q07020	RPL18	60S ribosomal protein L18	MULTI-MSMS	DP1141_10	5	558.2880249023438	2	558.79514	1115.57573	0.50372	0.00028148	-0.53583	-0.00029942	-0.032109	-1.7942E-05	558.7950194760684	17.029	0.50946	17.029	16.878	17.387	0					8	4	3	0	0	0	3.5814E-30	1	9831	9831		176.6	115.84	1	15024000			748	349	470	487	1004	1004		9606
GCTATLGNFAK	11	Unmodified	_GCTATLGNFAK_			0	0	0	P15880	P15880	P15880	RPS2	40S ribosomal protein S2	MULTI-MSMS	DP1141_9	4	570.2217407226562	2	570.279323	1138.54409	0.12678	7.2303E-05	0.33472	0.00019088	0.4615	0.00026319	570.2795176410298	17.007	0.38412	17.007	16.854	17.238	0					6	4	2	0	0	0	0.0076954	1	9190	9190		96.034	51.639	1	125250000			749	155	471	488	1005	1005		9606
GDGPICLVLAPTR	13	Unmodified	_GDGPICLVLAPTR_			0	0	0	Q92841;P17844	Q92841;P17844	P17844	DDX17;DDX5	Probable ATP-dependent RNA helicase DDX17;Probable ATP-dependent RNA helicase DDX5	MULTI-MSMS	DP1141_8	3	684.869384765625	2	684.868837	1367.72312	0.61795	0.00042321	0.13415	9.1878E-05	0.7521	0.00051509	684.8689557412088	20.327	0.3007	20.327	20.076	20.377	0					6	2	3	0	0	0	0.0070423	2	14362	14272;14362		89.9	53.402	1	30481000			750	163;496	472	489	1006;1007	1007		9606
GDGPICLVLAPTR	13	Unmodified	_GDGPICLVLAPTR_			0	0	0	Q92841;P17844	Q92841;P17844	P17844	DDX17;DDX5	Probable ATP-dependent RNA helicase DDX17;Probable ATP-dependent RNA helicase DDX5	MULTI-MSMS	DP1141_9	4	684.77880859375	2	684.868837	1367.72312	0.031699	2.171E-05	-0.3836	-0.00026272	-0.3519	-0.00024101	684.8683053953547	20.287	0.2995	20.287	20.037	20.337	0					4	2	2	0	0	0	0.0061691	1	14288	14288		90.653	53.96	1	7170500			751	163;496	472	489	1008	1008		9606
GDGVVLVAPPLR	12	Unmodified	_GDGVVLVAPPLR_			0	0	0	P62310	P62310	P62310	LSM3	U6 snRNA-associated Sm-like protein LSm3	MULTI-MSMS	DP1141_10	5	596.6685180664062	2	596.856055	1191.69756	1.3704	0.00081793	0.082863	4.9457E-05	1.4533	0.00086739	596.8557459929115	19.227	0.29937	19.227	19.077	19.376	0					4	2	2	0	0	0	0.0063936	1	13301	13301		91.265	46.888	1	16932000			752	297	473	490	1009	1009		9606
GDNITLLQSVSN	12	Unmodified	_GDNITLLQSVSN_			0	0	0	P62304	P62304	P62304	SNRPE	Small nuclear ribonucleoprotein E	MSMS	DP1141_10	5	630.8515014648438	2	630.825149	1259.63574	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.491	1	20.491	19.991	20.991	0								0	0	0	0.020797	1	15184	15184		105.17	50.443	1				753	296	474	491	1010	1010		9606
GDNQAGGAAAAAAAPEPPPR	20	Unmodified	_GDNQAGGAAAAAAAPEPPPR_			0	0	0	O14654	O14654	O14654	IRS4	Insulin receptor substrate 4	MSMS	DP1141_6	1	894.9356689453125	2	894.934813	1787.85507	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.612	1	15.612	15.112	16.112	0								0	0	0	0.024847	1	6338	6338		89.506	53.06	1				754	44	475	492	1011	1011		9606
GDNQAGGAAAAAAAPEPPPR	20	Unmodified	_GDNQAGGAAAAAAAPEPPPR_			0	0	0	O14654	O14654	O14654	IRS4	Insulin receptor substrate 4	MSMS	DP1141_8	3	894.9356689453125	2	894.934813	1787.85507	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.674	1	15.674	15.174	16.174	0								0	0	0	0.00079291	1	6993	6993		113.72	81.2	1				755	44	475	492	1012	1012		9606
GDSVIVVLR	9	Unmodified	_GDSVIVVLR_			0	0	0	P62316	P62316	P62316	SNRPD2	Small nuclear ribonucleoprotein Sm D2	MULTI-MSMS	DP1141_10	5	479.2691345214844	2	479.290017	956.565481	0.37281	0.00017869	-0.011284	-5.4085E-06	0.36153	0.00017328	479.2899776839727	18.603	0.29479	18.603	18.387	18.682	0					6	2	3	0	0	0	3.1037E-05	2	12214	12214;12240		147.69	108.03	1	16821000			756	298	476	493	1013;1014	1013		9606
GDVAEGDLIEHFSQFGTVEK	20	Unmodified	_GDVAEGDLIEHFSQFGTVEK_			0	0	0	Q13151	Q13151	Q13151	HNRNPA0	Heterogeneous nuclear ribonucleoprotein A0	MSMS	DP1141_9	4	726.8600463867188	3	726.683169	2177.02768	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.915	1	20.915	20.415	21.415	0								0	0	0	1.2455E-10	1	15240	15240		137.45	112.78	1				757	369	477	494	1015	1015		9606
GEAAAERPGEAAVASSPSK	19	Unmodified	_GEAAAERPGEAAVASSPSK_			0	0	1	P29966	P29966	P29966	MARCKS	Myristoylated alanine-rich C-kinase substrate	MULTI-MSMS	DP1141_8	3	596.4733276367188	3	595.630628	1783.87006	0.047474	2.8277E-05	-0.30796	-0.00018343	-0.26049	-0.00015515	595.6303580944577	14.131	0.21047	14.131	13.968	14.179	0					6	2	3	0	0	0	0.0072415	2	4682	4597;4682		96.153	74.312	1	4999200			758	195	478	495	1016;1017	1017		9606
GEAAAERPGEAAVASSPSK	19	Unmodified	_GEAAAERPGEAAVASSPSK_			0	0	1	P29966	P29966	P29966	MARCKS	Myristoylated alanine-rich C-kinase substrate	MSMS	DP1141_8	3	595.6303100585938	3	595.630628	1783.87006	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.194	1	14.194	13.694	14.694	0								0	0	0	0.018104	1	4711	4711		88.486	51.716	1				759	195	478	495	1018	1018		9606
GEATVSFDDPPSAK	14	Unmodified	_GEATVSFDDPPSAK_			0	0	0	P35637;Q92804	P35637	P35637	FUS;TAF15	RNA-binding protein FUS;TATA-binding protein-associated factor 2N	MULTI-MSMS	DP1141_8	3	710.833740234375	2	710.833171	1419.65179	0.24035	0.00017085	0.36388	0.00025866	0.60423	0.00042951	710.8333665769311	16.923	0.34167	16.923	16.731	17.073	0					11	3	4	0	0	0	3.189E-30	1	9112	9112		180.66	154.62	1	121060000			760	209	479	496	1019	1019		9606
GEEGHDPKEPEQLR	14	Unmodified	_GEEGHDPKEPEQLR_			0	0	1	P51991	P51991	P51991	HNRNPA3	Heterogeneous nuclear ribonucleoprotein A3	MULTI-MSMS	DP1141_9	4	405.9458923339844	4	405.945767	1619.75396	0.041626	1.6898E-05	0.33154	0.00013459	0.37316	0.00015148	405.9459032019879	13.706	0.33617	13.706	13.474	13.81	0					7	4	2	0	0	0	0.025867	1	3908	3908		109.6	90.931	1	2599600			761	262	480	497	1020	1020		9606
GEENLMDAQVK	11	Oxidation (M)	_GEENLM(Oxidation (M))DAQVK_	GEENLM(1)DAQVK	GEENLM(110)DAQVK	0	1	0	P50990	P50990	P50990	CCT8	T-complex protein 1 subunit theta	MULTI-MSMS	DP1141_8	3	625.7844848632812	2	625.290085	1248.56562	0.65136	0.00040729	0.33299	0.00020821	0.98434	0.0006155	625.2904917933954	15.022	0.39803	15.022	14.873	15.271	0					5	3	2	0	0	0	0.026702	1	6043	6043		110.53	50.136	1	14519000			762	257	481	498	1021	1021	205	9606
GENLVSMTVEGPPPK	15	Unmodified	_GENLVSMTVEGPPPK_			0	0	0	P63162;P14678	P63162	P63162	SNRPN;SNRPB	Small nuclear ribonucleoprotein-associated protein N;Small nuclear ribonucleoprotein-associated proteins B and B	MULTI-MSMS	DP1141_10	5	778.0370483398438	2	777.895248	1553.77594	0.52953	0.00041192	-0.20633	-0.0001605	0.3232	0.00025142	778.396324997911	18.637	0.29479	18.637	18.387	18.682	0					4	2	2	0	0	0	0.0065232	1	12239	12239		114.24	84.181	1	7759200			763	152	482	499	1022	1022		9606
GENLVSMTVEGPPPKDTGIAR	21	Oxidation (M)	_GENLVSM(Oxidation (M))TVEGPPPKDTGIAR_	GENLVSM(1)TVEGPPPKDTGIAR	GENLVSM(58)TVEGPPPKDTGIAR	0	1	1	P63162;P14678	P63162	P63162	SNRPN;SNRPB	Small nuclear ribonucleoprotein-associated protein N;Small nuclear ribonucleoprotein-associated proteins B and B	MULTI-MSMS	DP1141_10	5	729.3896484375	3	728.703687	2183.08923	0.37949	0.00027653	0.034277	2.4978E-05	0.41376	0.00030151	729.0382043994022	17.237	0.50051	17.237	17.087	17.588	0					11	4	4	0	0	0	0.028144	1	10253	10253		58.339	36.74	1	32128000			764	152	483	500	1023	1023	149	9606
GENLVSMTVEGPPPKDTGIAR	21	Unmodified	_GENLVSMTVEGPPPKDTGIAR_			0	0	1	P63162;P14678	P63162	P63162	SNRPN;SNRPB	Small nuclear ribonucleoprotein-associated protein N;Small nuclear ribonucleoprotein-associated proteins B and B	MULTI-MSMS	DP1141_10	5	724.097900390625	3	723.372049	2167.09432	0.75609	0.00054693	0.083699	6.0545E-05	0.83979	0.00060748	723.7067381421414	18.337	0.2995	18.337	18.187	18.487	0					4	2	2	0	0	0	0.00047988	1	11853	11853		132.87	102.38	1	16755000			765	152	483	501	1024	1024		9606
GFGFVTYATVEEVDAAMNAR	20	Oxidation (M)	_GFGFVTYATVEEVDAAM(Oxidation (M))NAR_	GFGFVTYATVEEVDAAM(1)NAR	GFGFVTYATVEEVDAAM(120)NAR	0	1	0	P09651;A0A2R8Y4L2	P09651	P09651	HNRNPA1	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed	MULTI-MSMS	DP1141_9	4	1082.5047607421875	2	1082.50441	2162.99427	-0.51954	-0.0005624	0.41351	0.00044762	-0.10603	-0.00011478	1082.5054313567805	22.251	0.23526	22.251	22.119	22.354	0					6	2	3	0	0	0	5.1104E-05	2	17354	17354;17361		115.24	91.423	1	8479000			766	130	484	502	1025;1026	1025	124	9606
GFGFVTYATVEEVDAAMNARPHK	23	Oxidation (M)	_GFGFVTYATVEEVDAAM(Oxidation (M))NARPHK_	GFGFVTYATVEEVDAAM(1)NARPHK	GFGFVTYATVEEVDAAM(64)NARPHK	0	1	1	P09651;A0A2R8Y4L2	P09651	P09651	HNRNPA1	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed	MULTI-MSMS	DP1141_10	5	632.5588989257812	4	632.307503	2525.20091	-0.026939	-1.7034E-05	0.61388	0.00038816	0.58694	0.00037112	632.5586398732923	20.384	0.29972	20.384	20.176	20.476	0					8	2	4	0	0	0	0.00091742	1	15123	15123		64.5	42.064	1	14174000			767	130	485	503	1027	1027	124	9606
GFGFVTYATVEEVDAAMNARPHK	23	Oxidation (M)	_GFGFVTYATVEEVDAAM(Oxidation (M))NARPHK_	GFGFVTYATVEEVDAAM(1)NARPHK	GFGFVTYATVEEVDAAM(60)NARPHK	0	1	1	P09651;A0A2R8Y4L2	P09651	P09651	HNRNPA1	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed	MULTI-MSMS	DP1141_9	4	632.5585327148438	4	632.307503	2525.20091	0.48359	0.00030578	-0.27359	-0.00017299	0.21	0.00013278	632.5581330866265	20.387	0.90117	20.387	20.136	21.037	0					18	8	5	0	0	0	0.001347	1	14603	14603		60.032	41.963	1	135840000			768	130	485	503	1028	1028	124	9606
GFGFVTYATVEEVDAAMNARPHK	23	Oxidation (M)	_GFGFVTYATVEEVDAAM(Oxidation (M))NARPHK_	GFGFVTYATVEEVDAAM(1)NARPHK	GFGFVTYATVEEVDAAM(80)NARPHK	0	1	1	P09651;A0A2R8Y4L2	P09651	P09651	HNRNPA1	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed	MULTI-MSMS	DP1141_9	4	843.0758056640625	3	842.740912	2525.20091	-0.034339	-2.8939E-05	0.31465	0.00026517	0.28031	0.00023623	843.0755647112874	20.387	0.49922	20.387	20.037	20.536	0					10	4	4	0	0	0	0.0017703	1	14609	14609		79.511	59.214	1	45610000			769	130	485	503	1029	1029	124	9606
GFMVQTGDPTGTGR	14	Oxidation (M)	_GFM(Oxidation (M))VQTGDPTGTGR_	GFM(1)VQTGDPTGTGR	GFM(120)VQTGDPTGTGR	0	1	0	Q9H2H8	Q9H2H8	Q9H2H8	PPIL3	Peptidyl-prolyl cis-trans isomerase-like 3	MULTI-MSMS	DP1141_10	5	720.3772583007812	2	720.332815	1438.65108	0.9879	0.00071162	3.2194	0.0023191	4.2073	0.0030307	720.8368585967991	16.646	0.26657	16.646	16.46	16.727	0					6	3	2	0	0	0	0.011544	1	8991	8991		123.01	90.148	1	19810000			770	558	486	504	1030	1030	399	9606
GFSSGSAVVSGGSR	14	Unmodified	_GFSSGSAVVSGGSR_			0	0	0	CON__P35908v2;CON__P35908;P35908	CON__P35908v2	CON__P35908v2	KRT2	Keratin, type II cytoskeletal 2 epidermal	MSMS	DP1141_10	5	627.8042602539062	2	627.807291	1253.60003	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.619	1	15.619	15.119	16.119	0								0	0	0	2.5677E-123	1	7337	7337		208.33	174.78	1			+	771	20	487	505	1031	1031		9606
GFSSGSAVVSGGSR	14	Unmodified	_GFSSGSAVVSGGSR_			0	0	0	CON__P35908v2;CON__P35908;P35908	CON__P35908v2	CON__P35908v2	KRT2	Keratin, type II cytoskeletal 2 epidermal	MULTI-MSMS	DP1141_6	1	627.833740234375	2	627.807291	1253.60003	0.72786	0.00045695	0.20025	0.00012572	0.92811	0.00058267	627.8074606198708	15.663	0.49538	15.663	15.309	15.804	0					10	4	3	0	0	0	9.547299999999999E-206	1	6320	6320		247.22	214.23	1	12205000		+	772	20	487	505	1032	1032		9606
GFSSGSAVVSGGSR	14	Unmodified	_GFSSGSAVVSGGSR_			0	0	0	CON__P35908v2;CON__P35908;P35908	CON__P35908v2	CON__P35908v2	KRT2	Keratin, type II cytoskeletal 2 epidermal	MULTI-MSMS	DP1141_7	2	628.33544921875	2	627.807291	1253.60003	0.052809	3.3154E-05	1.1603	0.00072844	1.2131	0.00076159	627.8080588974515	15.564	0.60506	15.564	15.309	15.914	0					10	5	3	0	0	0	1.8394E-14	3	7000	6900;7000;7084		166.86	127.9	1	44668000		+	773	20	487	505	1033;1034;1035	1034		9606
GFVDDIIQPSSTR	13	Unmodified	_GFVDDIIQPSSTR_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MSMS	DP1141_10	5	717.8400268554688	2	717.864805	1433.71506	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.83	1	19.83	19.33	20.33	0								0	0	0	3.952E-144	1	14187	14187		217.66	162.2	1				774	111	488	506	1036	1036		9606
GFVDDIIQPSSTR	13	Unmodified	_GFVDDIIQPSSTR_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_6	1	717.8638916015625	2	717.864805	1433.71506	0.84112	0.00060381	-0.027483	-1.9729E-05	0.81363	0.00058408	717.8641309428195	19.831	0.8839	19.831	19.506	20.39	0					21	8	4	0	0	0	0.018535	1	13229	13229		80.24	25.176	1	19987000			775	111	488	506	1037	1037		9606
GFVDDIIQPSSTR	13	Unmodified	_GFVDDIIQPSSTR_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	717.8653564453125	2	717.864805	1433.71506	0.23631	0.00016964	0.49047	0.00035209	0.72677	0.00052173	717.8651448125711	19.827	0.5008	19.827	19.476	19.976	0					13	4	4	0	0	0	0	3	13594	13485;13594;13643		279.77	223.34	1	314400000			776	111	488	506	1038;1039;1040	1039		9606
GFVDDIIQPSSTR	13	Unmodified	_GFVDDIIQPSSTR_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-SECPEP	DP1141_9	4	717.33837890625	2	717.864805	1433.71506	0.6274	0.00045039	-0.31427	-0.0002256	0.31313	0.00022478	717.8647894970866	19.788	0.39944	19.788	19.539	19.938	0					6	3	2	0	0	0	0.030494	1	13494	13494		90.827	55.675	1	18816000			777	111	488	506	1041	1041		9606
GFVVINQK	8	Unmodified	_GFVVINQK_			0	0	0	Q92526;P40227	Q92526	Q92526	CCT6B;CCT6A	T-complex protein 1 subunit zeta-2;T-complex protein 1 subunit zeta	MULTI-SECPEP	DP1141_8	3	452.2313232421875	2	452.766178	903.517802	-0.019479	-8.8193E-06	0.25162	0.00011392	0.23214	0.00010511	452.76627446199734	17.223	0.64267	17.223	16.731	17.374	0					11	6	3	0	0	0	0.00052368	1	9045	9045		133.99	79.463	1	167400000			778	220	489	507	1042	1042		9606
GGAEQFMEETER	12	Oxidation (M)	_GGAEQFM(Oxidation (M))EETER_	GGAEQFM(1)EETER	GGAEQFM(160)EETER	0	1	0	Q99832	Q99832	Q99832	CCT7	T-complex protein 1 subunit eta	MULTI-MSMS	DP1141_8	3	700.302001953125	2	700.293356	1398.57216	0.77149	0.00054027	-0.045434	-3.1817E-05	0.72605	0.00050845	700.2935745206171	15.726	0.30129	15.726	15.575	15.876	0					6	2	3	0	0	0	1.1514E-13	1	7158	7158		163.38	145.87	1	15996000			779	533	490	508	1043	1043	384	9606
GGAYYPVTVK	10	Unmodified	_GGAYYPVTVK_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_10	5	527.7821044921875	2	527.782025	1053.5495	-0.16396	-8.6537E-05	0.51644	0.00027257	0.35248	0.00018603	527.7822568814199	16.902	0.46014	16.902	16.727	17.187	0					15	6	3	0	0	0	0.023813	1	9465	9465		80.219	57.148	1	92200000			780	567	491	509	1044	1044		9606
GGAYYPVTVK	10	Unmodified	_GGAYYPVTVK_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_6	1	527.7822265625	2	527.782025	1053.5495	0.11732	6.1917E-05	0.24478	0.00012919	0.3621	0.00019111	527.7820979825761	16.956	0.47434	16.956	16.729	17.204	0					16	5	4	0	0	0	0.02848	1	8572	8572		76.1	53.029	1	62532000			781	567	491	509	1045	1045		9606
GGAYYPVTVK	10	Unmodified	_GGAYYPVTVK_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_7	2	528.6266479492188	2	527.782025	1053.5495	0.39186	0.00020682	0.42758	0.00022567	0.81944	0.00043248	527.7819594727117	16.877	0.56941	16.877	16.58	17.149	0					11	6	3	0	0	0	0.025081	1	9220	9220		78.516	37.487	1	50085000			782	567	491	509	1046	1046		9606
GGAYYPVTVK	10	Unmodified	_GGAYYPVTVK_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	527.7818603515625	2	527.782025	1053.5495	-0.10981	-5.7958E-05	-0.1732	-9.1414E-05	-0.28302	-0.00014937	527.7819636264799	16.923	0.54215	16.923	16.731	17.273	0					21	5	6	0	0	0	0.0077711	2	9057	9057;9063		100.02	76.946	1	949610000			783	567	491	509	1047;1048	1047		9606
GGAYYPVTVK	10	Unmodified	_GGAYYPVTVK_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	527.7821044921875	2	527.782025	1053.5495	0.35755	0.00018871	-0.35359	-0.00018662	0.0039569	2.0884E-06	527.7818602026329	16.904	0.55589	16.904	16.782	17.338	0					16	6	4	0	0	0	0.020157	1	8962	8962		84.615	61.543	1	86412000			784	567	491	509	1049	1049		9606
GGDSIGETPTPGASK	15	Unmodified	_GGDSIGETPTPGASK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_10	5	687.3313598632812	2	687.330795	1372.64704	0.41282	0.00028374	0.23699	0.00016289	0.6498	0.00044663	687.8324497005118	14.995	0.31391	14.995	14.806	15.12	0					6	3	2	0	0	0	0.0031443	1	6430	6430		100.93	65.493	1	17357000			785	78	492	510	1050	1050		9606
GGDSIGETPTPGASK	15	Unmodified	_GGDSIGETPTPGASK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_6	1	687.2914428710938	2	687.330795	1372.64704	0.4857	0.00033384	0.27358	0.00018804	0.75928	0.00052187	687.3309168090814	15.058	0.4998	15.058	14.609	15.108	0					7	4	2	0	0	0	1.7589E-21	2	5422	5422;5514		172.21	132.21	1	14965000			786	78	492	510	1051;1052	1051		9606
GGDSIGETPTPGASK	15	Unmodified	_GGDSIGETPTPGASK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	687.3319091796875	2	687.330795	1372.64704	0.88317	0.00060703	0.29592	0.0002034	1.1791	0.00081043	687.3309275074514	15.037	0.7937	15.037	14.577	15.37	0					16	7	3	0	0	0	1.1748E-08	2	6004	5773;6004		155.97	113.68	1	105750000			787	78	492	510	1053;1054	1054		9606
GGDSIGETPTPGASK	15	Unmodified	_GGDSIGETPTPGASK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_9	4	687.3311157226562	2	687.330795	1372.64704	0.33401	0.00022958	0.40528	0.00027856	0.73929	0.00050814	687.3310356438835	15.026	0.46025	15.026	14.714	15.174	0					12	4	4	0	0	0	1.9247E-42	2	5888	5832;5888		189.57	138.51	1	54180000			788	78	492	510	1055;1056	1056		9606
GGDSIGETPTPGASKR	16	Unmodified	_GGDSIGETPTPGASKR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_10	5	510.924560546875	3	510.589993	1528.74815	0.32302	0.00016493	-0.032511	-1.66E-05	0.29051	0.00014833	510.59005733082745	14.183	0.18708	14.183	14.028	14.215	0					4	2	2	0	0	0	0.017973	1	5106	5106		79.81	48.812	1	4660800			789	78	493	511	1057	1057		9606
GGDSIGETPTPGASKR	16	Unmodified	_GGDSIGETPTPGASKR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_6	1	510.9244079589844	3	510.589993	1528.74815	-0.11883	-6.0672E-05	-0.9595	-0.00048991	-1.0783	-0.00055058	510.5895411431824	14.166	0.54034	14.166	13.968	14.509	0					18	5	5	0	0	0	0.0020378	2	4304	4304;4400		143.05	90.021	1	5333500			790	78	493	511	1058;1059	1058		9606
GGDSIGETPTPGASKR	16	Unmodified	_GGDSIGETPTPGASKR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	510.61749267578125	3	510.589993	1528.74815	0.31037	0.00015847	0.049641	2.5346E-05	0.36001	0.00018382	510.5900013125946	14.162	0.54709	14.162	13.861	14.408	0					10	5	2	0	0	0	0.00041245	3	4714	4714;4773;4915		158.31	124.98	1	120170000			791	78	493	511	1060;1061;1062	1060		9606
GGDSIGETPTPGASKR	16	Unmodified	_GGDSIGETPTPGASKR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MSMS	DP1141_7	2	765.3681030273438	2	765.381351	1528.74815	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.187	1	14.187	13.687	14.687	0								0	0	0	9.9712E-17	1	4804	4804		151.13	83.92	1				792	78	493	511	1063	1063		9606
GGDSIGETPTPGASKR	16	Unmodified	_GGDSIGETPTPGASKR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	510.58984375	3	510.589993	1528.74815	0.19076	9.7402E-05	-0.18235	-9.3108E-05	0.0084093	4.2937E-06	510.5899755089008	14.131	0.78465	14.131	13.66	14.445	0					12	9	2	0	0	0	0.00096896	1	4765	4765		133.48	95.284	1	19085000			793	78	493	511	1064	1064		9606
GGDSIGETPTPGASKR	16	Unmodified	_GGDSIGETPTPGASKR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_9	4	510.9244384765625	3	510.589993	1528.74815	-0.08564	-4.3727E-05	0.19164	9.7848E-05	0.106	5.4122E-05	510.59010292112595	14.208	0.59595	14.208	13.877	14.473	0					15	8	4	0	0	0	0.002235	2	4620	4527;4620		140.31	89.848	1	12644000			794	78	493	511	1065;1066	1066		9606
GGGGGGGGTGSRGGGGGGGGSSYVSSSRSATK	32	Unmodified	_GGGGGGGGTGSRGGGGGGGGSSYVSSSRSATK_			0	0	2	CON__Q6IFZ6	CON__Q6IFZ6	CON__Q6IFZ6			MSMS	DP1141_7	2	858.7415161132812	3	858.394292	2572.16105	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.278	1	22.278	21.778	22.778	0								0	0	0	0.016859	1	17396	17396		38.691	23.21	1			+	795	27	494	512	1067	1067		
GGGGNFGPGPGSNFR	15	Unmodified	_GGGGNFGPGPGSNFR_			0	0	0	P22626	P22626	P22626	HNRNPA2B1	Heterogeneous nuclear ribonucleoproteins A2/B1	MULTI-MSMS	DP1141_9	4	689.3178100585938	2	689.318357	1376.62216	0.21371	0.00014731	0.33438	0.0002305	0.54809	0.00037781	689.3186331053719	17.026	0.78396	17.026	16.854	17.638	0					12	4	4	0	0	0	1.3635999999999998E-21	3	9203	9097;9203;9262		173.04	145.73	1	88840000			796	179	495	513	1068;1069;1070	1069		9606
GGKPEPPAMPQPVPTA	16	Oxidation (M)	_GGKPEPPAM(Oxidation (M))PQPVPTA_	GGKPEPPAM(1)PQPVPTA	GGKPEPPAM(100)PQPVPTA	0	1	1	P23396	P23396	P23396	RPS3	40S ribosomal protein S3	MULTI-MSMS	DP1141_10	5	795.403564453125	2	795.40324	1588.79193	0.4817	0.00038315	-0.19019	-0.00015127	0.29152	0.00023188	795.403147174599	15.736	0.34059	15.736	15.533	15.873	0					10	3	4	0	0	0	0.0066181	1	7617	7617		100.02	77.824	1	49443000			797	182	496	514	1071	1071	160	9606
GGPTPQEAIQR	11	Unmodified	_GGPTPQEAIQR_			0	0	0	Q9H444	Q9H444	Q9H444	CHMP4B	Charged multivesicular body protein 4b	MULTI-MSMS	DP1141_9	4	577.2919921875	2	577.301644	1152.58874	0.49436	0.00028539	-1.2018	-0.00069378	-0.7074	-0.00040838	577.3008572702646	15.246	0.68578	15.246	14.887	15.573	0					12	6	3	0	0	0	0.0076954	1	6067	6067		96.034	68.896	1	10945000			798	561	497	515	1072	1072		9606
GGQDNIPVLK	10	Unmodified	_GGQDNIPVLK_			0	0	0	P13637	P13637	P13637	ATP1A3	Sodium/potassium-transporting ATPase subunit alpha-3	MULTI-MSMS	DP1141_10	5	520.7904052734375	2	520.790381	1039.56621	0.0023176	1.207E-06	0.30697	0.00015987	0.30929	0.00016108	520.7907417008406	17.037	0.30909	17.037	16.878	17.187	0					5	3	2	0	0	0	0.025381	1	9836	9836		78.113	29.016	1	12605000			799	147	498	516	1073	1073		9606
GGSGSGPTIEEVD	13	Unmodified	_GGSGSGPTIEEVD_			0	0	0	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-MSMS	DP1141_8	3	602.6376342773438	2	602.770039	1203.52553	0.39113	0.00023576	0.39492	0.00023805	0.78605	0.00047381	602.7703293934755	17.323	0.30099	17.323	17.173	17.474	0					8	2	4	0	0	0	0.0052585	1	9831	9831		107.69	91.022	1	94978000			800	135	499	517	1074	1074		9606
GGSWVVIDSSINPR	14	Unmodified	_GGSWVVIDSSINPR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	743.8865966796875	2	743.886072	1485.75759	-0.073875	-5.4954E-05	1.0342	0.00076935	0.96035	0.00071439	743.8866592925161	19.94	0.98413	19.94	19.406	20.39	0					19	7	4	0	0	0	0.016435	1	13476	13476		80.979	36.63	1	217700000			801	367	500	518	1075	1075		9606
GGSWVVIDSSINPR	14	Unmodified	_GGSWVVIDSSINPR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_9	4	744.3916625976562	2	743.886072	1485.75759	0.51905	0.00038612	0.26381	0.00019625	0.78286	0.00058236	743.8860750061295	19.988	0.39824	19.988	19.639	20.037	0					7	3	3	0	0	0	7.4063E-67	2	13844	13844;13865		199.33	149.14	1	36373000			802	367	500	518	1076;1077	1076		9606
GHAVGDIPGVR	11	Unmodified	_GHAVGDIPGVR_			0	0	0	P62266	P62266	P62266	RPS23	40S ribosomal protein S23	MULTI-MSMS	DP1141_10	5	539.294189453125	2	539.293622	1076.57269	-0.24077	-0.00012985	0.28164	0.00015189	0.040867	2.2039E-05	539.293960682943	15.551	0.41678	15.551	15.28	15.697	0					10	4	4	0	0	0	0.016367	1	7266	7266		85.676	57.663	1	21149000			803	292	501	519	1078	1078		9606
GHENVEAAQAEYIEK	15	Unmodified	_GHENVEAAQAEYIEK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-SECPEP	DP1141_10	5	562.7822265625	3	563.268919	1686.78493	0.94877	0.00053441	-0.78535	-0.00044236	0.16342	9.2049E-05	563.2685755498468	15.92	0.46911	15.92	15.697	16.166	0					7	4	2	0	0	0	0.010683	1	7934	7934		75.018	34.342	1	247350000			804	111	502	520	1079	1079		9606
GHYTEGAELVDSVLDVVR	18	Unmodified	_GHYTEGAELVDSVLDVVR_			0	0	0	P07437;P68371;Q13885;Q9BVA1;Q13509	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB4B;TUBB2A;TUBB2B;TUBB3	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain	MULTI-MSMS	DP1141_9	4	654.0001831054688	3	653.66545	1957.97452	0.78372	0.00051229	-0.18376	-0.00012012	0.59996	0.00039217	653.9995956884285	22.314	0.22466	22.314	22.205	22.43	0					8	2	4	0	0	0	0.0045189	1	17456	17456		62.203	62.203	1	17903000			805	122;323;381;376	503	521	1080	1080		9606
GHYTEGAELVDSVLDVVRK	19	Unmodified	_GHYTEGAELVDSVLDVVRK_			0	0	1	P07437;P68371;Q13885;Q9BVA1;Q13509	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB4B;TUBB2A;TUBB2B;TUBB3	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain	MULTI-MSMS	DP1141_8	3	696.698486328125	3	696.363771	2086.06948	0.80343	0.00055948	0.10746	7.4834E-05	0.91089	0.00063431	696.6979611266432	21.329	0.70132	21.329	21.178	21.879	0					14	6	5	0	0	0	0.00015504	1	15949	15949		116.87	75.547	1	134820000			806	122;323;381;376	504	522	1081	1081		9606
GIEKPPFELPDFIKR	15	Unmodified	_GIEKPPFELPDFIKR_			0	0	2	Q13435	Q13435	Q13435	SF3B2	Splicing factor 3B subunit 2	MULTI-MSMS	DP1141_7	2	595.6571655273438	3	596.001445	1784.98251	0.76687	0.00045706	-0.29845	-0.00017788	0.46842	0.00027918	596.3355294733773	20.045	0.50071	20.045	19.85	20.351	0					11	4	4	0	0	0	0.022424	1	14165	14165		87.447	69.958	1	10375000			807	374	505	523	1082	1082		9606
GILQELFLNK	10	Unmodified	_GILQELFLNK_			0	0	0	Q96QC0	Q96QC0	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	MULTI-MSMS	DP1141_7	2	587.8458862304688	2	587.845156	1173.67576	0.64772	0.00038076	0.57058	0.00033541	1.2183	0.00071617	587.8454406516611	23.103	0.28823	23.103	22.99	23.278	0					7	3	3	0	0	0	0.012356	1	18732	18732		93.195	45.327	1	80859000			808	520	506	524	1083	1083		9606
GILQELFLNK	10	Unmodified	_GILQELFLNK_			0	0	0	Q96QC0	Q96QC0	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	MULTI-MSMS	DP1141_8	3	587.8457641601562	2	587.845156	1173.67576	0.34486	0.00020272	0.78841	0.00046346	1.1333	0.00066619	587.8455666551743	23.095	0.37173	23.095	22.953	23.325	0					9	4	4	0	0	0	0.0027723	2	18477	18477;18495		138.83	84.103	1	34154000			809	520	506	524	1084;1085	1084		9606
GIPAPEEERTR	11	Unmodified	_GIPAPEEERTR_			0	0	1	O95433	O95433	O95433	AHSA1	Activator of 90 kDa heat shock protein ATPase homolog 1	MULTI-MSMS	DP1141_9	4	418.8861999511719	3	418.886081	1253.63641	0.2804	0.00011746	0.066892	2.802E-05	0.3473	0.00014548	418.8860963848113	14.344	0.42023	14.344	14.053	14.473	0					12	5	3	0	0	0	0.01534	2	4872	4781;4872		134.84	100.15	1	9943800			810	92	507	525	1086;1087	1087		9606
GIPHLVTHDAR	11	Unmodified	_GIPHLVTHDAR_			0	0	0	P22090;P62701;Q8TD47	P22090	P22090	RPS4Y1;RPS4X;RPS4Y2	40S ribosomal protein S4, Y isoform 1;40S ribosomal protein S4, X isoform;40S ribosomal protein S4, Y isoform 2	MULTI-MSMS	DP1141_10	5	405.61749267578125	3	405.891278	1214.652	0.3706	0.00015042	-0.071097	-2.8858E-05	0.2995	0.00012157	405.8912938552748	14.924	0.70123	14.924	14.667	15.368	0					11	8	2	0	0	0	0.0040671	2	6084	6084;6340		97.456	58.674	1	53265000			811	177	508	526	1088;1089	1088		9606
GISDLAQHYLMR	12	Oxidation (M)	_GISDLAQHYLM(Oxidation (M))R_	GISDLAQHYLM(1)R	GISDLAQHYLM(140)R	0	1	0	P49368	P49368	P49368	CCT3	T-complex protein 1 subunit gamma	MULTI-MSMS	DP1141_8	3	710.3391723632812	2	710.356093	1418.69763	0.62817	0.00044622	1.2793	0.00090872	1.9074	0.0013549	710.8586399815848	19.325	0.39948	19.325	18.976	19.375	0					7	3	3	0	0	0	0.0090722	1	12817	12817		142.43	114.22	1	19122000			812	246	509	527	1090	1090	198	9606
GISHVIVDEIHER	13	Unmodified	_GISHVIVDEIHER_			0	0	0	Q08211	Q08211	Q08211	DHX9	ATP-dependent RNA helicase A	MULTI-SECPEP	DP1141_6	1	501.5375061035156	3	501.935323	1502.78414	0.36459	0.000183	0.99041	0.00049712	1.355	0.00068012	502.2705101541888	17.396	0.50036	17.396	17.004	17.505	0					6	4	2	0	0	0	0.0072289	1	9269	9269		110.8	85.837	1	4391300			813	357	510	528	1091	1091		9606
GIVEFASKPAAR	12	Unmodified	_GIVEFASKPAAR_			0	0	1	P23246	P23246	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	MULTI-MSMS	DP1141_7	2	415.735107421875	3	415.903183	1244.68772	0.52129	0.00021681	0.14493	6.0278E-05	0.66623	0.00027709	415.9032617097214	16.365	0.30022	16.365	16.114	16.415	0					4	2	2	0	0	0	0.018641	1	8157	8157		130.41	97.222	1	28215000			814	181	511	529	1092	1092		9606
GIVEFSGKPAAR	12	Unmodified	_GIVEFSGKPAAR_			0	0	1	Q15233	Q15233	Q15233	NONO	Non-POU domain-containing octamer-binding protein	MULTI-MSMS	DP1141_8	3	411.60791015625	3	411.2313	1230.67207	0.18744	7.7082E-05	0.93104	0.00038287	1.1185	0.00045996	411.23194236017395	15.926	0.5013	15.926	15.575	16.076	0					6	4	2	0	0	0	0.0065579	1	7423	7423		141.91	93.723	1	104190000			815	401	512	530	1093	1093		9606
GIVEFSGKPAAR	12	Unmodified	_GIVEFSGKPAAR_			0	0	1	Q15233	Q15233	Q15233	NONO	Non-POU domain-containing octamer-binding protein	MULTI-MSMS	DP1141_9	4	616.804931640625	2	616.343312	1230.67207	0.028783	1.774E-05	0.46182	0.00028464	0.49061	0.00030238	616.3435247596815	15.922	0.28573	15.922	15.772	16.058	0					6	2	3	0	0	0	0.020372	1	7254	7254		107.79	69.485	1	45363000			816	401	512	530	1094	1094		9606
GIVEFSGKPAAR	12	Unmodified	_GIVEFSGKPAAR_			0	0	1	Q15233	Q15233	Q15233	NONO	Non-POU domain-containing octamer-binding protein	MULTI-MSMS	DP1141_9	4	411.6078186035156	3	411.2313	1230.67207	0.14206	5.8421E-05	0.12548	5.16E-05	0.26754	0.00011002	411.23140612626327	15.922	0.3855	15.922	15.673	16.058	0					5	3	2	0	0	0	1.6394E-05	1	7324	7324		153.1	108.46	1	47529000			817	401	512	530	1095	1095		9606
GLAPDLPEDLYHLIK	15	Unmodified	_GLAPDLPEDLYHLIK_			0	0	0	P62277	P62277	P62277	RPS13	40S ribosomal protein S13	MULTI-MSMS	DP1141_10	5	565.8555297851562	3	565.310167	1692.90867	1.1527	0.00065162	-0.6018	-0.00034021	0.55087	0.00031141	565.6440944177587	22.009	0.29952	22.009	21.859	22.159	0					6	2	3	0	0	0	0.008997	1	17513	17513		79.744	57.884	1	9644300			818	294	513	531	1096	1096		9606
GLAPVQAYLHIPDIIK	16	Unmodified	_GLAPVQAYLHIPDIIK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_10	5	583.6763916015625	3	583.34169	1747.00324	0.81863	0.00047754	-0.17544	-0.00010234	0.64319	0.0003752	583.341642678826	21.709	0.58325	21.709	21.276	21.859	0					13	5	4	0	0	0	0.00089015	2	17008	16948;17008		98.654	83.02	1	69908000			819	142	514	532	1097;1098	1098		9606
GLAPVQAYLHIPDIIK	16	Unmodified	_GLAPVQAYLHIPDIIK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	583.3423461914062	3	583.34169	1747.00324	1.2598	0.00073491	-0.60112	-0.00035066	0.6587	0.00038425	583.3413632955968	21.749	0.31706	21.749	21.47	21.787	0					11	3	4	0	0	0	0.0067257	2	16090	16090;16143		91.969	78.396	1	6778500			820	142	514	532	1099;1100	1099		9606
GLAPVQAYLHIPDIIK	16	Unmodified	_GLAPVQAYLHIPDIIK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	583.3419189453125	3	583.34169	1747.00324	0.83848	0.00048912	-0.12025	-7.0145E-05	0.71823	0.00041897	583.6758304991066	21.7	0.69813	21.7	21.25	21.948	0					22	6	4	0	0	0	0.0015126	2	16403	16311;16403		112.62	84.305	1	654030000			821	142	514	532	1101;1102	1102		9606
GLAPVQAYLHIPDIIK	16	Unmodified	_GLAPVQAYLHIPDIIK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	875.2201538085938	2	874.508897	1747.00324	0.59532	0.00052061	0.28907	0.00025279	0.88439	0.00077341	875.0106491993134	21.7	0.60003	21.7	21.25	21.85	0					16	5	5	0	0	0	1.2122E-31	3	16429	16429;16548;16574		182.1	156.76	1	164890000			822	142	514	532	1103;1104;1105	1103		9606
GLAPVQAYLHIPDIIK	16	Unmodified	_GLAPVQAYLHIPDIIK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	875.0107421875	2	874.508897	1747.00324	0.59081	0.00051667	0.55575	0.00048601	1.1466	0.0010027	875.0104824946822	21.729	0.40061	21.729	21.379	21.779	0					12	3	5	0	0	0	0.003308	1	16434	16434		140.78	123.61	1	27977000			823	142	514	532	1106	1106		9606
GLAPVQAYLHIPDIIK	16	Unmodified	_GLAPVQAYLHIPDIIK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_9	4	583.6765747070312	3	583.34169	1747.00324	0.29648	0.00017295	0.068228	3.98E-05	0.36471	0.00021275	583.6759939036442	21.689	0.59225	21.689	21.338	21.93	0					15	5	4	0	0	0	0.0027414	2	16449	16449;16549		100.4	82.996	1	29186000			824	142	514	532	1107;1108	1107		9606
GLGTGTLYIAESR	13	Unmodified	_GLGTGTLYIAESR_			0	0	0	P54105	P54105	P54105	CLNS1A	Methylosome subunit pICln	MULTI-MSMS	DP1141_9	4	669.3427124023438	2	669.356616	1336.69868	0.79051	0.00052913	4.1709	0.0027918	4.9614	0.003321	669.8625517283152	18.887	0.30031	18.887	18.737	19.037	0					4	2	2	0	0	0	0.013122	1	12092	12092		84.658	40.281	1	11943000			825	269	515	533	1109	1109		9606
GLLGLPEEETELDNLTEFNTAHNKR	25	Unmodified	_GLLGLPEEETELDNLTEFNTAHNKR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_7	2	711.3863525390625	4	710.85698	2839.39882	0.86864	0.00061748	0.23476	0.00016688	1.1034	0.00078436	711.1077811641893	20.901	0.4994	20.901	20.551	21.05	0					11	4	5	0	0	0	2.8536E-13	2	15389	15389;15529		109.37	93.572	1	25747000			826	365	516	534	1110;1111	1110		9606
GLLGLPEEETELDNLTEFNTAHNKR	25	Unmodified	_GLLGLPEEETELDNLTEFNTAHNKR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	711.1080932617188	4	710.85698	2839.39882	0.43582	0.0003098	-0.14858	-0.00010562	0.28723	0.00020418	711.1077218970363	20.928	0.80072	20.928	20.678	21.479	0					23	7	5	0	0	0	2.9561E-13	2	15357	15118;15357		109.22	93.325	1	568000000			827	365	516	534	1112;1113	1113		9606
GLLGLPEEETELDNLTEFNTAHNKR	25	Unmodified	_GLLGLPEEETELDNLTEFNTAHNKR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	947.8082885742188	3	947.473548	2839.39882	0.2736	0.00025923	0.12957	0.00012276	0.40317	0.000382	947.8079767862198	20.928	0.60059	20.928	20.678	21.279	0					11	5	3	0	0	0	1.008E-08	1	15358	15358		98.562	76.997	1	142300000			828	365	516	534	1114	1114		9606
GLPFGCSK	8	Unmodified	_GLPFGCSK_			0	0	0	P31943;P55795;P31942	P31943;P55795;P31942	P31943	HNRNPH1;HNRNPH2;HNRNPH3	Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H2;Heterogeneous nuclear ribonucleoprotein H3	MULTI-MSMS	DP1141_8	3	433.75830078125	2	433.215463	864.416374	0.0041607	1.8025E-06	0.171	7.4078E-05	0.17516	7.5881E-05	433.2155245011142	17.023	0.37296	17.023	16.9	17.273	0					5	3	2	0	0	0	0.0076816	1	9165	9165		107.32	57.198	1	24061000			829	200;272;199	517	535	1115	1115		9606
GLPFGCSK	8	Unmodified	_GLPFGCSK_			0	0	0	P31943;P55795;P31942	P31943;P55795;P31942	P31943	HNRNPH1;HNRNPH2;HNRNPH3	Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H2;Heterogeneous nuclear ribonucleoprotein H3	MULTI-SECPEP	DP1141_9	4	433.75872802734375	2	433.215463	864.416374	0.196	8.4912E-05	-0.12916	-5.5952E-05	0.066849	2.896E-05	433.2154020910779	17.007	0.44116	17.007	16.896	17.338	0					6	4	2	0	0	0	0.0048057	1	9254	9254		102.77	61.565	1	14120000			830	200;272;199	517	535	1116	1116		9606
GLVMVKPGSIKPHQK	15	Oxidation (M)	_GLVM(Oxidation (M))VKPGSIKPHQK_	GLVM(1)VKPGSIKPHQK	GLVM(68)VKPGSIKPHQK	0	1	2	P49411	P49411	P49411	TUFM	Elongation factor Tu, mitochondrial	MULTI-MSMS	DP1141_9	4	545.9468994140625	3	545.65187	1633.93378	0.70714	0.00038585	-0.42647	-0.0002327	0.28067	0.00015315	545.6516965446784	14.344	0.2261	14.344	14.247	14.473	0					6	2	3	0	0	0	0.029314	1	4893	4893		67.952	60.112	1	4430100			831	247	518	536	1117	1117	200	9606
GLYAAFDCTATMK	13	Unmodified	_GLYAAFDCTATMK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	725.3890380859375	2	724.831062	1447.64757	0.097388	7.059E-05	0.24739	0.00017932	0.34478	0.00024991	724.8312310979541	19.501	0.59991	19.501	19.15	19.75	0					7	5	2	0	0	0	0.029078	1	13401	13401		73.841	51.28	1	83099000			832	142	519	537	1118	1118		9606
GMGGHGYGGAGDASSGFHGGHFVHMR	26	2 Oxidation (M)	_GM(Oxidation (M))GGHGYGGAGDASSGFHGGHFVHM(Oxidation (M))R_	GM(1)GGHGYGGAGDASSGFHGGHFVHM(1)R	GM(43)GGHGYGGAGDASSGFHGGHFVHM(43)R	0	2	0	P31942	P31942	P31942	HNRNPH3	Heterogeneous nuclear ribonucleoprotein H3	MULTI-MSMS	DP1141_9	4	516.220458984375	5	515.820588	2574.06656	0.24965	0.00012878	-0.032799	-1.6918E-05	0.21686	0.00011186	516.0212731692752	15.008	0.46025	15.008	14.714	15.174	0					11	4	4	0	0	0	0.0039116	1	5810	5810		42.831	28.815	1	12896000			833	199	520	538	1119	1119	168;169	9606
GNFHAVYRDDLKK	13	Unmodified	_GNFHAVYRDDLKK_			0	0	2	P05109	P05109	P05109	S100A8	Protein S100-A8;Protein S100-A8, N-terminally processed	MULTI-MSMS	DP1141_10	5	521.942138671875	3	521.607318	1561.80012	0.29731	0.00015508	0.42986	0.00022422	0.72717	0.00037929	521.9419196353807	14.712	0.3597	14.712	14.6	14.96	0					12	4	4	0	0	0	0.015873	1	5980	5980		80.318	37.521	1	21210000			834	108	521	539	1120	1120		9606
GNIPTLNR	8	Unmodified	_GNIPTLNR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	442.7510986328125	2	442.751059	883.487565	0.63103	0.00027939	-0.55722	-0.00024671	0.073806	3.2678E-05	442.7510626075176	16.155	0.69692	16.155	15.708	16.405	0					25	6	5	0	0	0	1.2787E-05	1	7221	7221		138.37	50.338	1	1005699999.9999999			835	367	522	540	1121	1121		9606
GNLANVIR	8	Unmodified	_GNLANVIR_			0	0	0	P05141;P12236;P12235;Q9H0C2	P05141	P05141	SLC25A5;SLC25A6;SLC25A4;SLC25A31	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed;ADP/ATP translocase 3;ADP/ATP translocase 3, N-terminally processed;ADP/ATP translocase 1;ADP/ATP translocase 4;ADP/ATP translocase 4, N-terminally processed	MULTI-SECPEP	DP1141_6	1	428.23486328125	2	428.753601	855.49265	0.38025	0.00016303	2.4419	0.001047	2.8222	0.00121	428.7549073896747	16.68	0.22905	16.68	16.595	16.824	0					6	2	3	0	0	0	0.0019529	1	8240	8240		122.79	76.127	1	75578000			836	109	523	541	1122	1122		9606
GNSRPGTPSAEGGSTSSTLR	20	Unmodified	_GNSRPGTPSAEGGSTSSTLR_			0	0	1	P35269	P35269	P35269	GTF2F1	General transcription factor IIF subunit 1	MULTI-MSMS	DP1141_10	5	640.3113403320312	3	640.311958	1917.91405	-0.54227	-0.00034722	0.89391	0.00057238	0.35164	0.00022516	640.3123035538265	14.123	0.2869	14.123	13.928	14.215	0					6	4	2	0	0	0	0.017974	1	5011	5011		90.882	67.745	1	10277000			837	208	524	542	1123	1123		9606
GNSRPGTPSAEGGSTSSTLR	20	Unmodified	_GNSRPGTPSAEGGSTSSTLR_			0	0	1	P35269	P35269	P35269	GTF2F1	General transcription factor IIF subunit 1	MULTI-MSMS	DP1141_8	3	640.3121337890625	3	640.311958	1917.91405	0.43197	0.0002766	-0.36644	-0.00023464	0.065533	4.1962E-05	640.3117035810218	14.131	0.44948	14.131	13.729	14.179	0					11	5	4	0	0	0	8.3045E-05	1	4629	4629		119.18	94.248	1	21253000			838	208	524	542	1124	1124		9606
GNWAHSGFPEIAFGR	15	Unmodified	_GNWAHSGFPEIAFGR_			0	0	0	P52701	P52701	P52701	MSH6	DNA mismatch repair protein Msh6	MULTI-MSMS	DP1141_7	2	549.8058471679688	3	549.267184	1644.77972	0.40704	0.00022357	0.078052	4.2871E-05	0.48509	0.00026645	549.2671419836959	20.2	0.30056	20.2	20.05	20.351	0					4	2	2	0	0	0	0.0099699	1	14412	14412		76.82	52.306	1	6937200			839	268	525	543	1125	1125		9606
GPASVPSVGK	10	Unmodified	_GPASVPSVGK_			0	0	0	Q13428	Q13428	Q13428	TCOF1	Treacle protein	MULTI-MSMS	DP1141_7	2	450.24212646484375	2	449.753267	897.491981	0.20265	9.1143E-05	-0.31424	-0.00014133	-0.11158	-5.0185E-05	449.75316737869895	14.859	0.89907	14.859	14.21	15.109	0					13	8	3	0	0	0	0.020157	2	5625	5625;5832		84.615	42.548	1	26051000			840	373	526	544	1126;1127	1126		9606
GPASVPSVGK	10	Unmodified	_GPASVPSVGK_			0	0	0	Q13428	Q13428	Q13428	TCOF1	Treacle protein	MULTI-MSMS	DP1141_8	3	450.2560119628906	2	449.753267	897.491981	0.15923	7.1615E-05	0.4148	0.00018656	0.57403	0.00025817	449.7533688651272	14.822	0.52789	14.822	14.445	14.972	0					8	5	2	0	0	0	0.021928	1	5649	5649		82.75	49.393	1	19693000			841	373	526	544	1128	1128		9606
GPFSEISAFK	10	Unmodified	_GPFSEISAFK_			0	0	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-MSMS	DP1141_7	2	541.80908203125	2	541.779482	1081.54441	0.38362	0.00020784	0.13475	7.3005E-05	0.51837	0.00028084	541.7794941586907	20.1	0.30032	20.1	19.85	20.15	0					6	2	3	0	0	0	0.0051706	1	14198	14198		122.52	61.544	1	14660000			842	259	527	545	1129	1129		9606
GPISDALAHHLR	12	Unmodified	_GPISDALAHHLR_			0	0	0	Q9H2P0	Q9H2P0	Q9H2P0	ADNP	Activity-dependent neuroprotector homeobox protein	MULTI-MSMS	DP1141_7	2	429.7558288574219	3	429.570316	1285.68912	0.56058	0.00024081	-0.57961	-0.00024898	-0.019035	-8.1769E-06	429.5701051278171	17.699	0.59974	17.699	17.249	17.849	0					8	5	2	0	0	0	0.010117	1	10480	10480		87.298	58.534	1	19916000			843	559	528	546	1130	1130		9606
GPLPAGTILK	10	Unmodified	_GPLPAGTILK_			0	0	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-MSMS	DP1141_7	2	483.7664489746094	2	483.80276	965.590967	0.42225	0.00020428	-0.41897	-0.0002027	0.0032787	1.5862E-06	483.80248104554227	17.906	0.50013	17.906	17.649	18.149	0					9	4	3	0	0	0	0.034059	1	10641	10641		75.043	53.083	1	25831000			844	259	529	547	1131	1131		9606
GPLQSVQVFGR	11	Unmodified	_GPLQSVQVFGR_			0	0	0	P62249	P62249	P62249	RPS16	40S ribosomal protein S16	MULTI-MSMS	DP1141_10	5	594.3303833007812	2	594.330205	1186.64586	1.2814	0.00076159	0.41694	0.0002478	1.6984	0.0010094	594.3296347780546	19.227	0.59975	19.227	18.777	19.376	0					8	5	2	0	0	0	1.9559E-40	1	13401	13401		185.72	156.55	1	12500000			845	289	530	548	1132	1132		9606
GPLTVEETPR	10	Unmodified	_GPLTVEETPR_			0	0	0	Q14676	Q14676	Q14676	MDC1	Mediator of DNA damage checkpoint protein 1	MULTI-SECPEP	DP1141_7	2	550.3238525390625	2	549.793121	1097.57169	0.43207	0.00023755	0.068671	3.7755E-05	0.50074	0.0002753	549.7930251623467	16.265	0.30042	16.265	16.014	16.315	0					6	2	3	0	0	0	1.5432E-11	1	7977	7977		176.09	140.47	1	69718000			846	388	531	549	1133	1133		9606
GPMNQCLVATGTHEPK	16	Oxidation (M)	_GPM(Oxidation (M))NQCLVATGTHEPK_	GPM(1)NQCLVATGTHEPK	GPM(110)NQCLVATGTHEPK	0	1	0	Q03405	Q03405	Q03405	PLAUR	Urokinase plasminogen activator surface receptor	MULTI-MSMS	DP1141_9	4	586.2894897460938	3	585.943273	1754.80799	0.61982	0.00036318	-0.99965	-0.00058574	-0.37982	-0.00022255	586.2770248943082	14.84	0.25321	14.84	14.634	14.887	0					8	2	4	0	0	0	0.00075578	2	5532	5532;5628		106.14	76.925	1	9441900			847	345	532	550	1134;1135	1134	258	9606
GPPDFSSDEEREPTPVLGSGAAAAGR	26	Unmodified	_GPPDFSSDEEREPTPVLGSGAAAAGR_			0	0	1	P42166	P42166	P42166	TMPO	Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin	MULTI-MSMS	DP1141_8	3	857.7438354492188	3	857.408767	2569.20447	0.74639	0.00063996	0.085482	7.3293E-05	0.83187	0.00071326	857.7431026575101	18.025	0.60114	18.025	17.774	18.375	0					17	5	4	0	0	0	1.2384E-12	2	11008	10877;11008		142.89	132.33	1	220120000			848	225	533	551	1136;1137	1137		9606
GPPDFSSDEEREPTPVLGSGAAAAGR	26	Unmodified	_GPPDFSSDEEREPTPVLGSGAAAAGR_			0	0	1	P42166	P42166	P42166	TMPO	Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin	MSMS	DP1141_8	3	1285.6104736328125	2	1285.60951	2569.20447	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.183	1	18.183	17.683	18.683	0								0	0	0	0.0065609	1	11085	11085		68.944	43.226	1				849	225	533	551	1138	1138		9606
GPPDFSSDEEREPTPVLGSGAAAAGR	26	Unmodified	_GPPDFSSDEEREPTPVLGSGAAAAGR_			0	0	1	P42166	P42166	P42166	TMPO	Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin	MULTI-MSMS	DP1141_9	4	857.4091186523438	3	857.408767	2569.20447	0.20272	0.00017381	0.017393	1.4913E-05	0.22011	0.00018872	857.4087200857872	17.987	0.79974	17.987	17.537	18.337	0					18	7	4	0	0	0	5.9828E-17	2	10885	10885;10905		152.96	140.28	1	69518000			850	225	533	551	1139;1140	1139		9606
GPPPPPGDENREMDDPSVGPK	21	Oxidation (M)	_GPPPPPGDENREM(Oxidation (M))DDPSVGPK_	GPPPPPGDENREM(1)DDPSVGPK	GPPPPPGDENREM(62)DDPSVGPK	0	1	1	Q13435	Q13435	Q13435	SF3B2	Splicing factor 3B subunit 2	MSMS	DP1141_7	2	734.88134765625	3	735.335664	2202.98516	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.885	1	14.885	14.385	15.385	0								0	0	0	0.014526	1	5860	5860		62.203	45.624	1				851	374	534	552	1141	1141	298	9606
GPPPPPGDENREMDDPSVGPK	21	Oxidation (M)	_GPPPPPGDENREM(Oxidation (M))DDPSVGPK_	GPPPPPGDENREM(1)DDPSVGPK	GPPPPPGDENREM(62)DDPSVGPK	0	1	1	Q13435	Q13435	Q13435	SF3B2	Splicing factor 3B subunit 2	MSMS	DP1141_8	3	735.1783447265625	3	735.335664	2202.98516	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.973	1	14.973	14.473	15.473	0								0	0	0	0.014526	1	5904	5904		62.203	39.207	1				852	374	534	552	1142	1142	298	9606
GPPPPPGDENREMDDPSVGPK	21	Unmodified	_GPPPPPGDENREMDDPSVGPK_			0	0	1	Q13435	Q13435	Q13435	SF3B2	Splicing factor 3B subunit 2	MSMS	DP1141_7	2	729.6973876953125	3	730.004025	2186.99025	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.787	1	15.787	15.287	16.287	0								0	0	0	0.010713	1	7272	7272		101.54	64.365	1				853	374	534	553	1143	1143		9606
GPSYGLSAEVK	11	Unmodified	_GPSYGLSAEVK_			0	0	0	Q99439;Q15417	Q99439	Q99439	CNN2;CNN3	Calponin-2;Calponin-3	MULTI-MSMS	DP1141_9	4	554.3001708984375	2	554.287671	1106.56079	0.50782	0.00028148	0.0059098	3.2757E-06	0.51373	0.00028475	554.2876285859669	16.821	0.20393	16.821	16.693	16.896	0					4	2	2	0	0	0	0.021191	1	8880	8880		81.525	52.355	1	35621000			854	403	535	554	1144	1144		9606
GSLGGGFSSGGFSGGSFSR	19	Unmodified	_GSLGGGFSSGGFSGGSFSR_			0	0	0	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_6	1	854.39013671875	2	854.389707	1706.76486	0.90747	0.00077533	-0.22007	-0.00018803	0.6874	0.00058731	854.3895874655311	19.374	0.40025	19.374	19.205	19.606	0					9	3	4	0	0	0	0.011059	1	12613	12613		77.192	61.99	1	12405000		+	855	17	536	555	1145	1145		9606
GSLGQGTAPVLPGK	14	Unmodified	_GSLGQGTAPVLPGK_			0	0	0	Q13428	Q13428	Q13428	TCOF1	Treacle protein	MULTI-MSMS	DP1141_7	2	641.362060546875	2	641.361702	1280.70885	0.2985	0.00019145	0.26545	0.00017025	0.56396	0.0003617	641.3618026267186	16.903	0.313	16.903	16.738	17.051	0					8	3	3	0	0	0	0.014975	1	9196	9196		82.417	35.955	1	49675000			856	373	537	556	1146	1146		9606
GSPLVVISQGK	11	Unmodified	_GSPLVVISQGK_			0	0	0	Q16555	Q16555	Q16555	DPYSL2	Dihydropyrimidinase-related protein 2	MULTI-MSMS	DP1141_10	5	542.7670288085938	2	542.821681	1083.62881	-0.48714	-0.00026443	1.4908	0.00080923	1.0036	0.0005448	542.8221574697669	17.463	0.70047	17.463	17.087	17.788	0					15	6	3	0	0	0	0.028551	1	10812	10812		75.652	48.522	1	27356000			857	409	538	557	1147	1147		9606
GSVLEPEGTVEIK	13	Unmodified	_GSVLEPEGTVEIK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_8	3	679.35205078125	2	679.364107	1356.71366	0.71729	0.0004873	3.7525	0.0025493	4.4698	0.0030366	679.3670929015533	18.285	0.60098	18.285	17.874	18.475	0					13	5	3	0	0	0	0.0057257	1	10973	10973		101.97	41.955	1	71122000			858	367	539	558	1148	1148		9606
GSVLEPEGTVEIK	13	Unmodified	_GSVLEPEGTVEIK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_9	4	679.3645629882812	2	679.364107	1356.71366	-0.074327	-5.0495E-05	1.8879	0.0012826	1.8136	0.0012321	679.3654228511599	18.087	0.99956	18.087	17.738	18.737	0					13	9	3	0	0	0	0.00054854	1	10907	10907		128.81	44.928	1	279490000			859	367	539	558	1149	1149		9606
GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR	39	Unmodified	_GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_9	4	1105.44287109375	3	1104.77423	3311.30085	-0.4995	-0.00055184	0.75615	0.00083537	0.25665	0.00028354	1105.4434696477604	15.722	0.50083	15.722	15.372	15.872	0					9	4	4	0	0	0	9.2853E-34	1	7145	7145		109.71	74.223	1	150330000		+	860	102	540	559	1150	1150		9606
GSYSCEVTHEGSTVTK	16	Unmodified	_GSYSCEVTHEGSTVTK_			0	0	0	CON__Q1RMN8	CON__Q1RMN8	CON__Q1RMN8			MULTI-MSMS	DP1141_10	5	581.5957641601562	3	581.261436	1740.76248	0.29612	0.00017213	0.019821	1.1521E-05	0.31594	0.00018365	581.595768806833	14.924	0.38444	14.924	14.736	15.12	0					9	4	4	0	0	0	0.0025468	1	6230	6230		130.47	116.38	1	59566000		+	861	23	541	560	1151	1151		
GTAYVVYEDIFDAK	14	Unmodified	_GTAYVVYEDIFDAK_			0	0	0	Q9Y3B4	Q9Y3B4	Q9Y3B4	SF3B6	Splicing factor 3B subunit 6	MULTI-MSMS	DP1141_10	5	795.888427734375	2	795.887946	1589.76134	0.79668	0.00063407	-0.020859	-1.6602E-05	0.77582	0.00061747	795.8878179448284	21.95	0.49949	21.95	21.659	22.159	0					13	4	4	0	0	0	1.7883E-30	2	17295	17295;17350		211.64	179.03	1	103550000			862	615	542	561	1152;1153	1152		9606
GTEDITSPHGIPLDLLDR	18	Unmodified	_GTEDITSPHGIPLDLLDR_			0	0	0	Q9Y265	Q9Y265	Q9Y265	RUVBL1	RuvB-like 1	MULTI-MSMS	DP1141_8	3	650.304931640625	3	650.337333	1947.99017	0.9863	0.00064143	-0.94902	-0.00061719	0.037273	2.424E-05	650.6711978653219	20.498	0.30096	20.498	20.277	20.578	0					6	2	3	0	0	0	0.0046533	1	14532	14532		115.87	85.183	1	5293500			863	608	543	562	1154	1154		9606
GTGGASAEGGPTGLAHGR	18	Unmodified	_GTGGASAEGGPTGLAHGR_			0	0	0	Q96F45	Q96F45	Q96F45	ZNF503	Zinc finger protein 503	MULTI-MSMS	DP1141_8	3	518.2536010742188	3	518.253604	1551.73898	0.031438	1.6293E-05	0.36507	0.0001892	0.3965	0.00020549	518.2537581451516	14.226	0.29972	14.226	13.968	14.268	0					6	3	2	0	0	0	6.2371E-07	1	4772	4772		188.39	151.03	1	24915000			864	509	544	563	1155	1155		9606
GTGGASAEGGPTGLAHGR	18	Unmodified	_GTGGASAEGGPTGLAHGR_			0	0	0	Q96F45	Q96F45	Q96F45	ZNF503	Zinc finger protein 503	MULTI-MSMS	DP1141_9	4	518.5887451171875	3	518.253604	1551.73898	0.12771	6.6187E-05	0.47601	0.00024669	0.60372	0.00031288	518.2539117171233	14.213	0.31825	14.213	13.994	14.312	0					7	4	2	0	0	0	9.9115E-05	2	4579	4579;4640		142.57	108.98	1	12852000			865	509	544	563	1156;1157	1156		9606
GTGIVSAPVPK	11	Unmodified	_GTGIVSAPVPK_			0	0	0	P15880	P15880	P15880	RPS2	40S ribosomal protein S2	MULTI-MSMS	DP1141_9	4	513.3033447265625	2	513.303124	1024.5917	-0.13397	-6.8765E-05	0.76768	0.00039405	0.63371	0.00032529	513.3034336230096	16.208	0.39288	16.208	15.965	16.358	0					10	3	4	0	0	0	0.0059105	1	7803	7803		101.46	69.93	1	66436000			866	155	545	564	1158	1158		9606
GTPLDTEVPMER	12	Oxidation (M)	_GTPLDTEVPM(Oxidation (M))ER_	GTPLDTEVPM(1)ER	GTPLDTEVPM(80)ER	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-SECPEP	DP1141_10	5	680.8251342773438	2	680.824292	1359.63403	0.028019	1.9076E-05	-0.17158	-0.00011681	-0.14356	-9.7737E-05	680.8251302346947	16.921	0.29023	16.921	16.797	17.087	0					5	4	2	0	0	0	0.025402	1	9559	9559		80.24	40.935	1	6219500			867	142	546	565	1159	1159	140	9606
GTPLDTEVPMER	12	Oxidation (M)	_GTPLDTEVPM(Oxidation (M))ER_	GTPLDTEVPM(1)ER	GTPLDTEVPM(180)ER	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MSMS	DP1141_6	1	680.823974609375	2	680.824292	1359.63403	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.916	1	16.916	16.416	17.416	0								0	0	0	2.5959E-56	1	8505	8505		183.72	162.04	1				868	142	546	565	1160	1160	140	9606
GTPLDTEVPMER	12	Oxidation (M)	_GTPLDTEVPM(Oxidation (M))ER_	GTPLDTEVPM(1)ER	GTPLDTEVPM(170)ER	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	680.8248901367188	2	680.824292	1359.63403	0.78466	0.00053422	-0.32379	-0.00022045	0.46087	0.00031377	680.8241303763203	16.881	1.3048	16.881	16.644	17.949	0					25	13	3	0	0	0	1.7789E-14	2	9114	9114;9131		167.93	147.03	1	347760000			869	142	546	565	1161;1162	1161	140	9606
GTPLDTEVPMER	12	Oxidation (M)	_GTPLDTEVPM(Oxidation (M))ER_	GTPLDTEVPM(1)ER	GTPLDTEVPM(120)ER	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	680.8246459960938	2	680.824292	1359.63403	0.41198	0.00028048	-0.66142	-0.00045031	-0.24944	-0.00016982	680.8234621976353	16.903	0.64267	16.903	16.731	17.374	0					14	6	4	0	0	0	0.018254	2	9068	9029;9068		121.5	85.055	1	66572000			870	142	546	565	1163;1164	1164	140	9606
GTPLDTEVPMER	12	Oxidation (M)	_GTPLDTEVPM(Oxidation (M))ER_	GTPLDTEVPM(1)ER	GTPLDTEVPM(140)ER	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_9	4	680.8373413085938	2	680.824292	1359.63403	-0.06305	-4.2926E-05	0.32159	0.00021895	0.25854	0.00017602	680.8241966959065	16.88	0.44533	16.88	16.693	17.138	0					13	5	4	0	0	0	0.012801	2	8908	8908;8977		140.17	113.1	1	25093000			871	142	546	565	1165;1166	1165	140	9606
GVAYTLLTPK	10	Unmodified	_GVAYTLLTPK_			0	0	0	Q86XP3	Q86XP3	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	MULTI-MSMS	DP1141_8	3	532.30322265625	2	531.813325	1061.6121	0.36162	0.00019231	0.15433	8.2076E-05	0.51595	0.00027439	531.8134586019398	18.725	0.30068	18.725	18.575	18.876	0					4	2	2	0	0	0	0.0029763	1	12007	12007		139.97	89.267	1	10990000			872	460	547	566	1167	1167		9606
GVISDILDWK	10	Unmodified	_GVISDILDWK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_10	5	573.8154296875	2	573.313689	1144.61282	0.86583	0.00049639	-0.39317	-0.00022541	0.47266	0.00027098	573.3133777647789	23.107	0.28833	23.107	22.942	23.23	0					6	3	2	0	0	0	0.0029763	1	19127	19127		139.97	99.903	1	17353000			873	367	548	567	1168	1168		9606
GVISDILDWK	10	Unmodified	_GVISDILDWK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	573.3140869140625	2	573.313689	1144.61282	0.46911	0.00026894	0.4514	0.00025879	0.92051	0.00052774	573.3138045585441	23.103	0.20802	23.103	22.99	23.198	0					6	2	3	0	0	0	0.0026424	1	18733	18733		127.46	88.894	1	23989000			874	367	548	567	1169	1169		9606
GVISDILDWK	10	Unmodified	_GVISDILDWK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_8	3	573.3139038085938	2	573.313689	1144.61282	0.026822	1.5377E-05	0.16203	9.2892E-05	0.18885	0.00010827	573.3136398017505	23.115	0.20351	23.115	22.953	23.157	0					4	2	2	0	0	0	0.0044315	1	18532	18532		111.95	54.666	1	4253300			875	367	548	567	1170	1170		9606
GVLNVHPAASASKPSADQIR	20	Unmodified	_GVLNVHPAASASKPSADQIR_			0	0	1	Q92576	Q92576	Q92576	PHF3	PHD finger protein 3	MULTI-SECPEP	DP1141_7	2	505.9065246582031	4	505.274898	2017.07049	0.03759	1.8993E-05	-0.2089	-0.00010555	-0.17131	-8.6559E-05	505.525581580976	15.865	0.40283	15.865	15.512	15.914	0					5	3	2	0	0	0	3.5629E-05	1	7354	7354		87.323	62.43	1	8783400			876	491	549	568	1171	1171		9606
GVNLPGAAVDLPAVSEK	17	Unmodified	_GVNLPGAAVDLPAVSEK_			0	0	0	P14618	P14618	P14618	PKM	Pyruvate kinase PKM	MULTI-MSMS	DP1141_6	1	818.8757934570312	2	818.948869	1635.88319	0.63207	0.00051763	1.8004	0.0014744	2.4324	0.0019921	818.9502267650921	19.756	0.48455	19.756	19.606	20.09	0					6	4	2	0	0	0	0.00055144	1	13013	13013		100.22	70.679	1	9093400			877	151	550	569	1172	1172		9606
GVPAGNSDTEGGQPGR	16	Unmodified	_GVPAGNSDTEGGQPGR_			0	0	0	Q9UKV3	Q9UKV3	Q9UKV3	ACIN1	Apoptotic chromatin condensation inducer in the nucleus	MULTI-MSMS	DP1141_8	3	749.8482666015625	2	749.847675	1497.6808	0.52457	0.00039335	0.029256	2.1938E-05	0.55383	0.00041529	749.8477407734034	13.626	0.35141	13.626	13.453	13.805	0					8	4	2	0	0	0	1.2854E-05	1	3924	3924		151.79	134.62	1	1950100			878	599	551	570	1173	1173		9606
GVVMHTFGGYANSK	14	Oxidation (M)	_GVVM(Oxidation (M))HTFGGYANSK_	GVVM(1)HTFGGYANSK	GVVM(93)HTFGGYANSK	0	1	0	Q6UXN9	Q6UXN9	Q6UXN9	WDR82	WD repeat-containing protein 82	MULTI-MSMS	DP1141_9	4	495.28045654296875	3	495.238126	1482.69255	0.054696	2.7088E-05	0.031814	1.5756E-05	0.08651	4.2843E-05	495.23804954071255	15.822	0.29965	15.822	15.573	15.872	0					4	2	2	0	0	0	0.0017963	1	7206	7206		92.906	79.985	1	25480000			879	436	552	571	1174	1174	325	9606
GVVVVIK	7	Unmodified	_GVVVVIK_			0	0	0	P46779	P46779	P46779	RPL28	60S ribosomal protein L28	MULTI-MSMS	DP1141_10	5	713.3524169921875	1	713.491988	712.484711	1.1848	0.00084537	-0.4472	-0.00031908	0.73763	0.00052629	713.491471289649	16.576	0.18863	16.576	16.46	16.649	0					4	2	2	0	0	0	0.0048867	1	8877	8877		109.88	35.032	1	14006000			880	235	553	572	1175	1175		9606
GYLDKLEPSK	10	Unmodified	_GYLDKLEPSK_			0	0	1	P25705	P25705	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	575.278076171875	2	575.311146	1148.60774	-0.1165	-6.7025E-05	0.54423	0.0003131	0.42773	0.00024608	575.3113885091193	17.123	0.4419	17.123	16.731	17.173	0					7	4	2	0	0	0	1.5164E-39	1	9361	9361		183.43	122.95	1	40902000			881	187	554	573	1176	1176		9606
GYLGPPHQGPPMHHASGHDTR	21	Oxidation (M)	_GYLGPPHQGPPM(Oxidation (M))HHASGHDTR_	GYLGPPHQGPPM(1)HHASGHDTR	GYLGPPHQGPPM(59)HHASGHDTR	0	1	0	Q9H0L4	Q9H0L4	Q9H0L4	CSTF2T	Cleavage stimulation factor subunit 2 tau variant	MULTI-MSMS	DP1141_8	3	453.8128356933594	5	453.81315	2264.02937	-0.13393	-6.0778E-05	0.69964	0.00031751	0.56572	0.00025673	453.813333227676	13.573	0.60603	13.573	13.199	13.805	0					16	7	3	0	0	0	0.003608	1	3780	3780		59.252	40.195	1	1617400			882	554	555	574	1177	1177	398	9606
GYLGPPHQGPPMHHVPGHESR	21	Oxidation (M)	_GYLGPPHQGPPM(Oxidation (M))HHVPGHESR_	GYLGPPHQGPPM(1)HHVPGHESR	GYLGPPHQGPPM(45)HHVPGHESR	0	1	0	P33240	P33240	P33240	CSTF2	Cleavage stimulation factor subunit 2	MULTI-SECPEP	DP1141_8	3	462.0239562988281	5	461.423557	2302.0814	-0.11108	-5.1255E-05	0.50678	0.00023384	0.3957	0.00018259	461.4237715579534	14.267	0.245	14.267	14.109	14.354	0					4	2	2	0	0	0	0.017072	1	4814	4814		45.069	17.557	1	2947100			883	204	556	575	1178	1178	174	9606
GYVKDVDDGLQAAEEVGYPVMIK	23	Oxidation (M)	_GYVKDVDDGLQAAEEVGYPVM(Oxidation (M))IK_	GYVKDVDDGLQAAEEVGYPVM(1)IK	GYVKDVDDGLQAAEEVGYPVM(55)IK	0	1	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_7	2	837.9357299804688	3	838.080712	2511.22031	0.73796	0.00061847	0.57657	0.00048321	1.3145	0.0011017	838.4154992208958	20.8	0.29979	20.8	20.651	20.95	0					4	2	2	0	0	0	0.027107	1	15305	15305		55.208	16.452	1	9123200			884	367	557	576	1179	1179	266	9606
HALIIYDDLSK	11	Unmodified	_HALIIYDDLSK_			0	0	0	P25705	P25705	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	644.3507080078125	2	644.350803	1286.68705	1.0231	0.00065923	1.5217	0.00098049	2.5448	0.0016397	644.3506506074253	18.556	0.80064	18.556	18.175	18.976	0					13	7	3	0	0	0	0.023299	1	11508	11508		78.098	48.331	1	35343000			885	187	558	577	1180	1180		9606
HALIIYDDLSK	11	Unmodified	_HALIIYDDLSK_			0	0	0	P25705	P25705	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_9	4	644.8359985351562	2	644.350803	1286.68705	0.69036	0.00044483	0.065116	4.1957E-05	0.75547	0.00048679	644.350494215988	18.387	0.49997	18.387	18.237	18.737	0					7	4	3	0	0	0	0.0038195	1	11354	11354		123.86	94.313	1	24731000			886	187	558	577	1181	1181		9606
HAPHCLSEEEGEQDRPR	17	Unmodified	_HAPHCLSEEEGEQDRPR_			0	0	1	O75190	O75190	O75190	DNAJB6	DnaJ homolog subfamily B member 6	MULTI-SECPEP	DP1141_9	4	513.2348022460938	4	512.481614	2045.89735	-0.095119	-4.8747E-05	0.49094	0.0002516	0.39582	0.00020285	512.4819275100464	13.779	0.40228	13.779	13.538	13.94	0					13	5	4	0	0	0	0.017989	1	3975	3975		64.798	49.56	1	6190000			887	70	559	578	1182	1182		9606
HCNMVLENVK	10	Unmodified	_HCNMVLENVK_			0	0	0	P62316	P62316	P62316	SNRPD2	Small nuclear ribonucleoprotein Sm D2	MULTI-SECPEP	DP1141_10	5	621.8385009765625	2	622.299733	1242.58491	-0.57503	-0.00035784	1.1317	0.00070427	0.5567	0.00034643	622.3006198564141	15.712	0.43533	15.712	15.533	15.968	0					5	4	2	0	0	0	0.023949	1	7492	7492		135.55	107.34	1	6266800			888	298	560	579	1183	1183		9606
HDLDLICR	8	Unmodified	_HDLDLICR_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_10	5	521.2611694335938	2	521.260933	1040.50731	0.10974	5.7201E-05	-0.086098	-4.4879E-05	0.023639	1.2322E-05	521.2610139925877	16.893	1.1605	16.893	16.727	17.887	0					27	13	5	0	0	0	2.1555E-95	2	9491	9457;9491		214.25	166.33	1	572450000			889	286;212;287	561	580	1184;1185	1185		9606
HDLDLICR	8	Unmodified	_HDLDLICR_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MSMS	DP1141_6	1	521.2611083984375	2	521.260933	1040.50731	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.958	1	16.958	16.458	17.458	0								0	0	0	4.4617000000000003E-69	1	8573	8573		192.31	153.5	1				890	286;212;287	561	580	1186	1186		9606
HDLDLICR	8	Unmodified	_HDLDLICR_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MSMS	DP1141_7	2	521.3193359375	2	521.260933	1040.50731	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.872	1	16.872	16.372	17.372	0								0	0	0	1.2866E-30	1	9078	9078		166.78	131.16	1				891	286;212;287	561	580	1187	1187		9606
HDLDLICR	8	Unmodified	_HDLDLICR_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MSMS	DP1141_7	2	521.2611694335938	2	521.260933	1040.50731	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.914	1	16.914	16.414	17.414	0								0	0	0	3.8335E-42	1	9139	9139		176.41	132.02	1				892	286;212;287	561	580	1188	1188		9606
HDLDLICR	8	Unmodified	_HDLDLICR_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_8	3	521.2613525390625	2	521.260933	1040.50731	0.035954	1.8741E-05	0.11892	6.1989E-05	0.15487	8.073E-05	521.2613040547636	16.908	0.74289	16.908	16.731	17.474	0					21	7	4	0	0	0	2.1555E-95	2	9056	9056;9059		214.25	167.25	1	1931199999.9999998			893	286;212;287	561	580	1189;1190	1189		9606
HDLDLICR	8	Unmodified	_HDLDLICR_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_8	3	521.7627563476562	2	521.260933	1040.50731	-0.43047	-0.00022439	0.74403	0.00038783	0.31356	0.00016345	521.2612170116745	36.76	1.2362	36.76	36.717	37.953	0					42	26	2	0	0	0	0.013404	2	34213	34213;34232		101.28	61.283	1	2729000			894	286;212;287	561	580	1191;1192	1191		9606
HDLDLICR	8	Unmodified	_HDLDLICR_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_9	4	521.2612915039062	2	521.260933	1040.50731	0.22809	0.0001189	-0.25375	-0.00013227	-0.025657	-1.3374E-05	521.2611803798674	16.907	1.2551	16.907	16.782	18.037	0					29	13	6	0	0	0	2.7751E-79	4	8958	8958;8960;9347;9450		207.6	158.85	1	1560499999.9999998			895	286;212;287	561	580	1193;1194;1195;1196	1193		9606
HDTPDPSPLR	10	Unmodified	_HDTPDPSPLR_			0	0	0	Q9BRD0	Q9BRD0	Q9BRD0	BUD13	BUD13 homolog	MULTI-MSMS	DP1141_8	3	567.781005859375	2	567.780544	1133.54654	-0.26666	-0.00015141	0.55612	0.00031576	0.28946	0.00016435	567.7808258139994	14.524	0.41871	14.524	14.354	14.772	0					8	4	3	0	0	0	0.0041685	1	5257	5257		124.08	86.986	1	15232000			896	537	562	581	1197	1197		9606
HELQANCYEEVKDR	14	Unmodified	_HELQANCYEEVKDR_			0	0	1	P23528	P23528	P23528	CFL1	Cofilin-1	MULTI-SECPEP	DP1141_10	5	597.8472290039062	3	597.609059	1789.80535	0.58474	0.00034944	0.25692	0.00015354	0.84166	0.00050298	597.9432529271126	14.946	0.23264	14.946	14.806	15.039	0					6	2	3	0	0	0	0.021392	1	6292	6292		94.532	72.205	1	6548200			897	183	563	582	1198	1198		9606
HEPLVLFCESCDTLTCR	17	Unmodified	_HEPLVLFCESCDTLTCR_			0	0	0	Q13263	Q13263	Q13263	TRIM28	Transcription intermediary factor 1-beta	MULTI-MSMS	DP1141_7	2	713.3233642578125	3	712.988553	2135.94383	0.54881	0.00039129	-0.033308	-2.3748E-05	0.5155	0.00036754	713.3231285937404	19.7	0.29953	19.7	19.551	19.85	0					8	2	4	0	0	0	0.0058751	2	13745	13664;13745		86.367	72.739	1	31286000			898	372	564	583	1199;1200	1200		9606
HESGASIKIDEPLEGSEDR	19	Unmodified	_HESGASIKIDEPLEGSEDR_			0	0	1	P61978	P61978	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	MSMS	DP1141_8	3	690.3163452148438	3	690.330907	2067.97089	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.578	1	16.578	16.078	17.078	0								0	0	0	2.3090000000000003E-190	1	8485	8485		222.51	174.14	1				899	284	565	584	1201	1201		9606
HEVNYQNVVHK	11	Unmodified	_HEVNYQNVVHK_			0	0	0	Q5VZL5	Q5VZL5	Q5VZL5	ZMYM4	Zinc finger MYM-type protein 4	MULTI-SECPEP	DP1141_6	1	456.9081115722656	3	456.233592	1365.67895	0.23361	0.00010658	-0.47549	-0.00021694	-0.24189	-0.00011036	456.2328670642657	14.359	0.47568	14.359	14.133	14.609	0					6	4	2	0	0	0	0.0020111	1	4486	4486		107.03	80.057	1	2403500			900	427	566	585	1202	1202		9606
HFSGLEEAVYR	11	Unmodified	_HFSGLEEAVYR_			0	0	0	P50990	P50990	P50990	CCT8	T-complex protein 1 subunit theta	MULTI-MSMS	DP1141_8	3	654.3427124023438	2	654.322576	1306.6306	1.0435	0.0006828	-1.175	-0.00076886	-0.13152	-8.6059E-05	654.3221701632655	17.724	0.501	17.724	17.574	18.075	0					9	4	3	0	0	0	0.0079642	1	10400	10400		110.76	57.82	1	40344000			901	257	567	586	1203	1203		9606
HFSQGSALILHQR	13	Unmodified	_HFSQGSALILHQR_			0	0	0	P17028	P17028	P17028	ZNF24	Zinc finger protein 24	MULTI-MSMS	DP1141_9	4	499.29522705078125	3	498.603908	1492.78989	-0.16872	-8.4124E-05	-0.18076	-9.0127E-05	-0.34948	-0.00017425	498.60380817421435	16.208	0.58584	16.208	15.872	16.458	0					10	5	3	0	0	0	0.015519	1	7823	7823		68.809	40.003	1	8385000			902	160	568	587	1204	1204		9606
HGEEVTPEDVLSAAMYPDVFAHFK	24	Oxidation (M)	_HGEEVTPEDVLSAAM(Oxidation (M))YPDVFAHFK_	HGEEVTPEDVLSAAM(1)YPDVFAHFK	HGEEVTPEDVLSAAM(220)YPDVFAHFK	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	902.424072265625	3	902.423249	2704.24792	0.59202	0.00053426	-0.12876	-0.0001162	0.46326	0.00041806	902.7574444592582	21.8	0.59646	21.8	21.45	22.047	0					21	5	6	0	0	0	1.8026E-139	2	16673	16673;16684		218.74	202.93	1	303810000			903	142	569	588	1205;1206	1205	141	9606
HGEEVTPEDVLSAAMYPDVFAHFK	24	Oxidation (M)	_HGEEVTPEDVLSAAM(Oxidation (M))YPDVFAHFK_	HGEEVTPEDVLSAAM(1)YPDVFAHFK	HGEEVTPEDVLSAAM(160)YPDVFAHFK	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	677.3204345703125	4	677.069256	2704.24792	0.64407	0.00043608	0.0042593	2.8838E-06	0.64833	0.00043896	677.3199566047846	21.8	0.5979	21.8	21.35	21.948	0					16	5	4	0	0	0	4.1372E-17	1	16705	16705		155.16	131.87	1	134350000			904	142	569	588	1207	1207	141	9606
HGEEVTPEDVLSAAMYPDVFAHFK	24	Oxidation (M)	_HGEEVTPEDVLSAAM(Oxidation (M))YPDVFAHFK_	HGEEVTPEDVLSAAM(1)YPDVFAHFK	HGEEVTPEDVLSAAM(48)YPDVFAHFK	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	677.3191528320312	4	677.069256	2704.24792	0.62412	0.00042258	-0.13235	-8.9607E-05	0.49178	0.00033297	677.5707094584632	21.829	0.30029	21.829	21.579	21.879	0					6	2	3	0	0	0	0.004372	1	16605	16605		48.198	22.724	1	23145000			905	142	569	588	1208	1208	141	9606
HGEEVTPEDVLSAAMYPDVFAHFK	24	Oxidation (M)	_HGEEVTPEDVLSAAM(Oxidation (M))YPDVFAHFK_	HGEEVTPEDVLSAAM(1)YPDVFAHFK	HGEEVTPEDVLSAAM(69)YPDVFAHFK	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-SECPEP	DP1141_8	3	902.9904174804688	3	902.423249	2704.24792	0.43706	0.00039441	-0.10498	-9.4735E-05	0.33208	0.00029967	902.7576330386739	21.829	0.30029	21.829	21.579	21.879	0					8	2	4	0	0	0	0.0051649	1	16537	16537		69.272	47.14	1	45713000			906	142	569	588	1209	1209	141	9606
HGEEVTPEDVLSAAMYPDVFAHFK	24	Oxidation (M)	_HGEEVTPEDVLSAAM(Oxidation (M))YPDVFAHFK_	HGEEVTPEDVLSAAM(1)YPDVFAHFK	HGEEVTPEDVLSAAM(110)YPDVFAHFK	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_9	4	903.0884399414062	3	902.423249	2704.24792	0.90123	0.00081329	-0.69415	-0.00062641	0.20709	0.00018688	902.7570227313773	21.782	0.58066	21.782	21.538	22.119	0					11	5	4	0	0	0	3.753E-09	2	16620	16620;16715		113.24	81.485	1	9734100			907	142	569	588	1210;1211	1210	141	9606
HGEEVTPEDVLSAAMYPDVFAHFK	24	Unmodified	_HGEEVTPEDVLSAAMYPDVFAHFK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	897.4258422851562	3	897.091611	2688.253	0.47313	0.00042444	-0.1907	-0.00017107	0.28243	0.00025337	897.7602525748969	22.703	0.66402	22.703	22.241	22.906	0					20	8	4	0	0	0	6.0132000000000004E-33	4	18129	18090;18129;18144;18264		171.29	144.24	1	22855000			908	142	569	589	1212;1213;1214;1215	1213		9606
HGINCFINR	9	Unmodified	_HGINCFINR_			0	0	0	P78371	P78371	P78371	CCT2	T-complex protein 1 subunit beta	MULTI-MSMS	DP1141_8	3	565.806396484375	2	565.779825	1129.5451	-0.6585	-0.00037256	0.93055	0.00052648	0.27205	0.00015392	565.7803067506413	16.326	0.38631	16.326	16.176	16.562	0					5	3	2	0	0	0	2.5605E-40	1	8084	8084		189.62	137.93	1	33532000			909	328	570	590	1216	1216		9606
HGLLLPASPVR	11	Unmodified	_HGLLLPASPVR_			0	0	0	Q96E09	Q96E09	Q96E09	FAM122A	Protein FAM122A	MULTI-MSMS	DP1141_9	4	580.3019409179688	2	580.35094	1158.68733	0.28837	0.00016735	-0.17605	-0.00010217	0.11232	6.5185E-05	580.3507458254873	17.588	0.29998	17.588	17.338	17.638	0					4	2	2	0	0	0	0.023267	1	9948	9948		78.149	58.008	1	3878700			910	506	571	591	1217	1217		9606
HGSLGFLPR	9	Unmodified	_HGSLGFLPR_			0	0	0	P39023	P39023	P39023	RPL3	60S ribosomal protein L3	MULTI-MSMS	DP1141_6	1	492.2747497558594	2	492.274701	982.534849	0.61918	0.0003048	-0.36258	-0.00017849	0.2566	0.00012632	492.27450961867197	17.455	0.40126	17.455	17.204	17.605	0					5	3	2	0	0	0	0.027325	1	9558	9558		77.923	50.96	1	15282000			911	219	572	592	1218	1218		9606
HGVQELEIELQSQLSK	16	Unmodified	_HGVQELEIELQSQLSK_			0	0	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_7	2	613.9664306640625	3	613.326657	1836.95814	0.75525	0.00046322	0.0034851	2.1375E-06	0.75874	0.00046535	613.6610151475675	20.501	0.59994	20.501	20.15	20.75	0					10	5	4	0	0	0	0.030982	1	14919	14919		50.252	17.105	1	37061000		+	912	19	573	593	1219	1219		9606
HGVQELEIELQSQLSK	16	Unmodified	_HGVQELEIELQSQLSK_			0	0	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_7	2	919.4863891601562	2	919.486347	1836.95814	0.70833	0.0006513	-0.73018	-0.00067139	-0.021854	-2.0094E-05	919.4857700518808	20.501	0.39955	20.501	20.351	20.75	0					5	3	2	0	0	0	0.0018118	1	14934	14934		120.9	88.861	1	45062000		+	913	19	573	593	1220	1220		9606
HGVQELEIELQSQLSK	16	Unmodified	_HGVQELEIELQSQLSK_			0	0	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_9	4	919.8045043945312	2	919.486347	1836.95814	0.86354	0.00079401	0.17058	0.00015684	1.0341	0.00095085	919.9875504716979	20.486	0.29976	20.486	20.337	20.636	0					4	2	2	0	0	0	5.1189E-162	1	14719	14719		237.46	192.85	1	3504200		+	914	19	573	593	1221	1221		9606
HGYIGEFEIIDDHR	14	Unmodified	_HGYIGEFEIIDDHR_			0	0	0	P62244	P62244	P62244	RPS15A	40S ribosomal protein S15a	MULTI-MSMS	DP1141_10	5	567.9400634765625	3	567.605754	1699.79543	0.88408	0.00050181	-0.43753	-0.00024835	0.44654	0.00025346	567.60545575495	18.727	0.38987	18.727	18.487	18.877	0					9	3	3	0	0	0	1.8987E-41	1	12562	12562		157.33	133.5	1	168590000			915	288	574	594	1222	1222		9606
HIAEVSQEVTR	11	Unmodified	_HIAEVSQEVTR_			0	0	0	P61764	P61764	P61764	STXBP1	Syntaxin-binding protein 1	MULTI-MSMS	DP1141_10	5	423.21649169921875	3	423.557964	1267.65206	0.10931	4.63E-05	0.66797	0.00028292	0.77728	0.00032922	423.5581627021559	14.719	0.26733	14.719	14.539	14.806	0					10	3	4	0	0	0	0.011476	1	5855	5855		81.017	47.056	1	3226200			916	283	575	595	1223	1223		9606
HIAEVSQEVTR	11	Unmodified	_HIAEVSQEVTR_			0	0	0	P61764	P61764	P61764	STXBP1	Syntaxin-binding protein 1	MULTI-MSMS	DP1141_7	2	423.2170715332031	3	423.557964	1267.65206	0.16325	6.9145E-05	0.54237	0.00022972	0.70561	0.00029887	423.5583322705873	14.759	0.50093	14.759	14.508	15.009	0					7	4	2	0	0	0	0.026824	1	5575	5575		71.555	32.773	1	21089000			917	283	575	595	1224	1224		9606
HIANYISGIQTIGHR	15	Unmodified	_HIANYISGIQTIGHR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	560.9718017578125	3	560.637389	1678.89034	1.0187	0.00057114	-0.53522	-0.00030007	0.48351	0.00027107	560.6372189328519	17.955	0.89942	17.955	17.705	18.604	0					22	8	4	0	0	0	6.4772E-69	2	10210	10210;10359		199.33	179.22	1	115710000			918	402	576	596	1225;1226	1225		9606
HIANYISGIQTIGHR	15	Unmodified	_HIANYISGIQTIGHR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_7	2	560.6377563476562	3	560.637389	1678.89034	0.24702	0.00013849	-0.17715	-9.9317E-05	0.06987	3.9172E-05	560.6373718438826	17.899	1.2004	17.899	17.349	18.55	0					24	11	5	0	0	0	2.2456E-100	3	10756	10551;10756;10878		214.58	202.67	1	169600000			919	402	576	596	1227;1228;1229	1228		9606
HIANYISGIQTIGHR	15	Unmodified	_HIANYISGIQTIGHR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_7	2	560.9719848632812	3	560.637389	1678.89034	0.16497	9.2486E-05	-0.11798	-6.6143E-05	0.046986	2.6342E-05	560.9715964060503	36.77	0.21081	36.77	36.738	36.949	0					7	4	2	0	0	0	0.014755	1	34284	34284		65.038	43.738	1	3306500			920	402	576	596	1230	1230		9606
HIANYISGIQTIGHR	15	Unmodified	_HIANYISGIQTIGHR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-SECPEP	DP1141_7	2	840.6973266601562	2	840.452445	1678.89034	0.52093	0.00043782	0.86114	0.00072374	1.3821	0.0011616	840.4546910500243	17.849	0.39989	17.849	17.549	17.949	0					5	3	2	0	0	0	4.8614E-06	1	10733	10733		158.4	111.56	1	7035500			921	402	576	596	1231	1231		9606
HIANYISGIQTIGHR	15	Unmodified	_HIANYISGIQTIGHR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_8	3	560.6376342773438	3	560.637389	1678.89034	0.10984	6.1578E-05	0.26432	0.00014819	0.37416	0.00020977	560.6374685332967	17.824	0.90127	17.824	17.374	18.275	0					12	8	4	0	0	0	0.0082285	1	10686	10686		81.327	44.696	1	61593000			922	402	576	596	1232	1232		9606
HIDFSLR	7	Unmodified	_HIDFSLR_			0	0	0	P46781	P46781	P46781	RPS9	40S ribosomal protein S9	MULTI-MSMS	DP1141_10	5	444.2405090332031	2	444.240327	886.466101	-0.58812	-0.00026126	1.3997	0.00062179	0.81156	0.00036053	444.24105349042935	17.438	0.98226	17.438	17.005	17.987	0					16	9	3	0	0	0	0.0089105	1	10555	10555		105.2	5.8166	1	239480000			923	236	577	597	1233	1233		9606
HIDFSLR	7	Unmodified	_HIDFSLR_			0	0	0	P46781	P46781	P46781	RPS9	40S ribosomal protein S9	MULTI-SECPEP	DP1141_6	1	443.5887756347656	2	444.240327	886.466101	1.1491	0.0005105	-0.70464	-0.00031303	0.44451	0.00019747	444.23984703116633	17.555	0.40091	17.555	17.304	17.705	0					5	3	2	0	0	0	0.0054064	1	9467	9467		153.88	47.124	1	5069100			924	236	577	597	1234	1234		9606
HIEIQVLGDK	10	Unmodified	_HIEIQVLGDK_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_6	1	576.8265380859375	2	576.324588	1150.63462	0.99589	0.00057396	-0.45163	-0.00026029	0.54425	0.00031367	576.3242369144214	17.442	0.40126	17.442	17.204	17.605	0					9	3	3	0	0	0	0.0020627	1	9405	9405		134.84	94.576	1	30532000			925	110	578	598	1235	1235		9606
HIEIQVLGDK	10	Unmodified	_HIEIQVLGDK_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-SECPEP	DP1141_7	2	575.7926635742188	2	576.324588	1150.63462	0.67221	0.00038741	-0.48239	-0.00027801	0.18982	0.0001094	576.3243612453957	17.4	0.40028	17.4	17.149	17.549	0					6	3	2	0	0	0	0.00023675	1	9878	9878		145.89	87.291	1	25941000			926	110	578	598	1236	1236		9606
HIEIQVLGDK	10	Unmodified	_HIEIQVLGDK_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_8	3	576.3250122070312	2	576.324588	1150.63462	0.018827	1.0851E-05	0.57015	0.00032859	0.58898	0.00033944	576.3249419234844	17.323	0.60088	17.323	17.173	17.774	0					11	5	3	0	0	0	8.3334E-05	2	9876	9876;9897		147.74	101.32	1	207720000			927	110	578	598	1237;1238	1237		9606
HIEIQVLGDK	10	Unmodified	_HIEIQVLGDK_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-SECPEP	DP1141_9	4	575.8366088867188	2	576.324588	1150.63462	0.21989	0.00012673	0.91943	0.00052989	1.1393	0.00065662	576.3249332187168	17.387	0.39955	17.387	17.138	17.537	0					7	3	3	0	0	0	8.411E-17	1	9720	9720		185.08	115.03	1	30675000			928	110	578	598	1239	1239		9606
HIMGQNVADYMR	12	2 Oxidation (M)	_HIM(Oxidation (M))GQNVADYM(Oxidation (M))R_	HIM(1)GQNVADYM(1)R	HIM(64)GQNVADYM(64)R	0	2	0	P46777	P46777	P46777	RPL5	60S ribosomal protein L5	MULTI-SECPEP	DP1141_9	4	490.2537841796875	3	489.555349	1465.64422	0.34346	0.00016814	-0.064676	-3.1663E-05	0.27878	0.00013648	489.555335781831	14.933	0.26582	14.933	14.714	14.98	0					4	2	2	0	0	0	0.01783	1	5626	5626		63.944	42.643	1	2301800			929	233	579	599	1240	1240	185;186	9606
HKKEEEDEELDLNK	14	Unmodified	_HKKEEEDEELDLNK_			0	0	2	Q7Z5K2	Q7Z5K2	Q7Z5K2	WAPAL	Wings apart-like protein homolog	MULTI-SECPEP	DP1141_7	2	586.6189575195312	3	585.951367	1754.83227	0.91312	0.00053504	0.31745	0.00018601	1.2306	0.00072106	585.9513858723225	14.079	0.26339	14.079	13.947	14.21	0					4	2	2	0	0	0	0.013906	1	4654	4654		103.13	69.73	1	9647800			930	451	580	600	1241	1241		9606
HKNMSVHLSPCFR	13	Oxidation (M)	_HKNM(Oxidation (M))SVHLSPCFR_	HKNM(1)SVHLSPCFR	HKNM(55)SVHLSPCFR	0	1	1	P62280	P62280	P62280	RPS11	40S ribosomal protein S11	MULTI-SECPEP	DP1141_10	5	407.894775390625	4	407.950064	1627.77115	0.33933	0.00013843	-0.55784	-0.00022757	-0.2185	-8.9138E-05	407.95011278633785	14.924	0.30317	14.924	14.736	15.039	0					10	3	4	0	0	0	0.025016	1	6249	6249		55.261	28.729	1	12574000			931	295	581	601	1242	1242	235	9606
HLAPPPLLSPLLPSIKPTVR	20	Unmodified	_HLAPPPLLSPLLPSIKPTVR_			0	0	1	Q14676	Q14676	Q14676	MDC1	Mediator of DNA damage checkpoint protein 1	MULTI-MSMS	DP1141_7	2	717.387451171875	3	716.108537	2145.30378	0.73716	0.00052788	-0.019867	-1.4227E-05	0.71729	0.00051366	716.4427654712191	20.601	0.39955	20.601	20.351	20.75	0					10	3	4	0	0	0	0.014946	1	14884	14884		82.121	73.641	1	31935000			932	388	582	602	1243	1243		9606
HLDGEEDGSSDQSQASGTTGGR	22	Unmodified	_HLDGEEDGSSDQSQASGTTGGR_			0	0	0	Q9UNF1	Q9UNF1	Q9UNF1	MAGED2	Melanoma-associated antigen D2	MULTI-MSMS	DP1141_8	3	730.9967041015625	3	730.975851	2189.90572	0.25399	0.00018566	0.017504	1.2795E-05	0.27149	0.00019845	731.3102828587776	13.493	0.97686	13.493	12.907	13.884	0					29	11	4	0	0	0	7.7992E-139	4	3799	3339;3462;3547;3799		167.05	157.63	1	4305700			933	605	583	603	1244;1245;1246;1247	1247		9606
HLILVVNYSCPNHYEDYVHR	20	Unmodified	_HLILVVNYSCPNHYEDYVHR_			0	0	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-MSMS	DP1141_7	2	633.0601806640625	4	632.808942	2527.20666	-0.004639	-2.9356E-06	0.2889	0.00018282	0.28427	0.00017989	633.0599884322617	18.6	0.60044	18.6	18.349	18.95	0					12	5	3	0	0	0	0.014283	1	12045	12045		53.188	28.278	1	58791000			934	445	584	604	1248	1248		9606
HLIPAANTGESK	12	Unmodified	_HLIPAANTGESK_			0	0	0	P62258	P62258	P62258	YWHAE	14-3-3 protein epsilon	MULTI-MSMS	DP1141_6	1	619.9031982421875	2	619.330402	1236.64625	0.31643	0.00019598	0.018767	1.1623E-05	0.3352	0.0002076	619.3304391550696	14.459	0.39338	14.459	14.215	14.609	0					5	3	2	0	0	0	0.0057899	1	4788	4788		101.97	44.927	1	956260			935	290	585	605	1249	1249		9606
HLIPAANTGESK	12	Unmodified	_HLIPAANTGESK_			0	0	0	P62258	P62258	P62258	YWHAE	14-3-3 protein epsilon	MULTI-SECPEP	DP1141_9	4	413.7428894042969	3	413.222693	1236.64625	0.26131	0.00010798	-0.072459	-2.9942E-05	0.18885	7.8038E-05	413.2229071258512	14.514	0.23944	14.514	14.312	14.552	0					4	2	2	0	0	0	0.018313	1	4975	4975		49.466	5.1483	1	1437600			936	290	585	605	1250	1250		9606
HLPSTEPDPHVVR	13	Unmodified	_HLPSTEPDPHVVR_			0	0	0	Q9BUJ2	Q9BUJ2	Q9BUJ2	HNRNPUL1	Heterogeneous nuclear ribonucleoprotein U-like protein 1	MULTI-MSMS	DP1141_7	2	495.2598571777344	3	495.259918	1482.75793	-0.24661	-0.00012214	0.28718	0.00014223	0.04057	2.0093E-05	495.2599854089437	14.894	0.70121	14.894	14.608	15.309	0					17	6	4	0	0	0	0.0032514	2	5980	5965;5980		96.82	74.039	1	47877000			937	540	586	606	1251;1252	1252		9606
HLPSTEPDPHVVR	13	Unmodified	_HLPSTEPDPHVVR_			0	0	0	Q9BUJ2	Q9BUJ2	Q9BUJ2	HNRNPUL1	Heterogeneous nuclear ribonucleoprotein U-like protein 1	MULTI-SECPEP	DP1141_8	3	494.7657775878906	3	495.259918	1482.75793	0.68088	0.00033721	0.046143	2.2853E-05	0.72702	0.00036007	495.2598363711279	14.923	0.59648	14.923	14.674	15.271	0					7	5	2	0	0	0	0.011166	1	5826	5826		74.987	44.811	1	10522000			938	540	586	606	1253	1253		9606
HLQLAIR	7	Unmodified	_HLQLAIR_			0	0	0	Q99878;Q96KK5;Q9BTM1;Q16777;Q93077;Q7L7L0;Q6FI13;P20671;P0C0S8;P04908;Q96QV6;P16104;Q71UI9;P0C0S5	Q99878;Q71UI9	Q99878	HIST1H2AJ;HIST1H2AH;H2AFJ;HIST2H2AC;HIST1H2AC;HIST3H2A;HIST2H2AA3;HIST1H2AD;HIST1H2AG;HIST1H2AB;HIST1H2AA;H2AFX;H2AFV;H2AFZ	Histone H2A type 1-J;Histone H2A type 1-H;Histone H2A.J;Histone H2A type 2-C;Histone H2A type 1-C;Histone H2A type 3;Histone H2A type 2-A;Histone H2A type 1-D;Histone H2A type 1;Histone H2A type 1-B/E;Histone H2A type 1-A;Histone H2AX;Histone H2A.V;Histone H2A.Z	MULTI-MSMS	DP1141_10	5	425.7665710449219	2	425.766512	849.518471	0.35371	0.0001506	-0.12787	-5.4441E-05	0.22584	9.6156E-05	425.76645147519	16.216	0.75875	16.216	15.968	16.727	0					20	8	4	0	0	0	2.4335E-12	1	8350	8350		160.17	56.886	1	505320000			939	105;133	587	607	1254	1254		9606
HLQLAIR	7	Unmodified	_HLQLAIR_			0	0	0	Q99878;Q96KK5;Q9BTM1;Q16777;Q93077;Q7L7L0;Q6FI13;P20671;P0C0S8;P04908;Q96QV6;P16104;Q71UI9;P0C0S5	Q99878;Q71UI9	Q99878	HIST1H2AJ;HIST1H2AH;H2AFJ;HIST2H2AC;HIST1H2AC;HIST3H2A;HIST2H2AA3;HIST1H2AD;HIST1H2AG;HIST1H2AB;HIST1H2AA;H2AFX;H2AFV;H2AFZ	Histone H2A type 1-J;Histone H2A type 1-H;Histone H2A.J;Histone H2A type 2-C;Histone H2A type 1-C;Histone H2A type 3;Histone H2A type 2-A;Histone H2A type 1-D;Histone H2A type 1;Histone H2A type 1-B/E;Histone H2A type 1-A;Histone H2AX;Histone H2A.V;Histone H2A.Z	MULTI-MSMS	DP1141_6	1	425.76654052734375	2	425.766512	849.518471	0.39842	0.00016964	-0.19562	-8.3288E-05	0.20281	8.6348E-05	425.7663936966947	16.255	2.7608	16.255	13.968	16.729	0					55	28	3	0	0	0	0.0060396	2	7568	7525;7568		109.7	32.33	1	73897000			940	105;133	587	607	1255;1256	1256		9606
HMFHVAWVDPEDPYK	15	Oxidation (M)	_HM(Oxidation (M))FHVAWVDPEDPYK_	HM(1)FHVAWVDPEDPYK	HM(160)FHVAWVDPEDPYK	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	629.9579467773438	3	629.622528	1885.84575	1.106	0.00069635	-0.74515	-0.00046917	0.36082	0.00022718	629.6220271877725	18.955	0.60078	18.955	18.705	19.305	0					12	5	4	0	0	0	3.4608E-09	2	11835	11835;11958		155.98	139.8	1	97321000			941	367	588	608	1257;1258	1257	269	9606
HMNLILCDCDEFRK	14	Oxidation (M)	_HM(Oxidation (M))NLILCDCDEFRK_	HM(1)NLILCDCDEFRK	HM(150)NLILCDCDEFRK	0	1	1	P63162;P14678	P63162	P63162	SNRPN;SNRPB	Small nuclear ribonucleoprotein-associated protein N;Small nuclear ribonucleoprotein-associated proteins B and B	MULTI-SECPEP	DP1141_10	5	623.3532104492188	3	622.948029	1865.82226	-1.0551	-0.00065726	1.6635	0.0010362	0.60838	0.00037899	622.9490755760717	17.237	0.48254	17.237	17.005	17.488	0					7	4	3	0	0	0	6.4202E-07	1	9942	9942		145.29	111.99	1	6770200			942	152	589	609	1259	1259	150	9606
HNFCFMEMNTR	11	Oxidation (M)	_HNFCFMEM(Oxidation (M))NTR_	HNFCFM(0.082)EM(0.918)NTR	HNFCFM(-10)EM(10)NTR	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	501.5375061035156	3	501.537301	1501.59007	0.28383	0.00014235	0.048649	2.4399E-05	0.33248	0.00016675	501.53731370105163	17.274	0.4016	17.274	17.103	17.505	0					7	3	3	0	0	0	0.03203	1	9269	9269		54.772	41.186	2	6395900			943	521	590	610	1260	1260	370;371	9606
HNFCFMEMNTR	11	Oxidation (M)	_HNFCFM(Oxidation (M))EMNTR_	HNFCFM(1)EMNTR	HNFCFM(43)EM(-43)NTR	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-SECPEP	DP1141_8	3	501.971923828125	3	501.537301	1501.59007	0.48053	0.000241	-0.5217	-0.00026165	-0.04117	-2.0648E-05	501.537271970268	17.318	0.40122	17.318	17.073	17.474	0					11	3	4	0	0	0	0.00056275	1	9540	9540		95.477	89.395	2	65913000			944	521	590	610	1261	1261	370;371	9606
HNFCFMEMNTR	11	2 Oxidation (M)	_HNFCFM(Oxidation (M))EM(Oxidation (M))NTR_	HNFCFM(1)EM(1)NTR	HNFCFM(57)EM(57)NTR	0	2	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-SECPEP	DP1141_6	1	506.78424072265625	3	506.868939	1517.58499	-0.057669	-2.9231E-05	-0.027075	-1.3723E-05	-0.084744	-4.2954E-05	506.86906881321386	15.955	0.59466	15.955	15.51	16.105	0					8	5	3	0	0	0	0.024891	1	6918	6918		57.175	35.315	1	20985000			945	521	590	611	1262	1262	370;371	9606
HNFCFMEMNTR	11	2 Oxidation (M)	_HNFCFM(Oxidation (M))EM(Oxidation (M))NTR_	HNFCFM(1)EM(1)NTR	HNFCFM(48)EM(48)NTR	0	2	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-SECPEP	DP1141_7	2	507.254150390625	3	506.868939	1517.58499	0.13507	6.8462E-05	0.42193	0.00021386	0.557	0.00028233	506.8690117651644	15.964	0.40007	15.964	15.714	16.114	0					5	3	2	0	0	0	0.031949	1	7502	7502		47.894	40.214	1	13136000			946	521	590	611	1263	1263	370;371	9606
HNFCFMEMNTR	11	2 Oxidation (M)	_HNFCFM(Oxidation (M))EM(Oxidation (M))NTR_	HNFCFM(1)EM(1)NTR	HNFCFM(57)EM(57)NTR	0	2	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MSMS	DP1141_8	3	506.7841796875	3	506.868939	1517.58499	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.932	1	15.932	15.432	16.432	0								0	0	0	0.031225	1	7412	7412		57.225	36.842	1				947	521	590	611	1264	1264	370;371	9606
HNFCFMEMNTR	11	2 Oxidation (M)	_HNFCFM(Oxidation (M))EM(Oxidation (M))NTR_	HNFCFM(1)EM(1)NTR	HNFCFM(45)EM(45)NTR	0	2	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-SECPEP	DP1141_9	4	507.23040771484375	3	506.868939	1517.58499	-0.2119	-0.0001074	-0.15532	-7.8729E-05	-0.36722	-0.00018613	506.8691805160704	15.922	0.28573	15.922	15.772	16.058	0					8	2	4	0	0	0	0.034316	1	7363	7363		44.614	36.306	1	40356000			948	521	590	611	1265	1265	370;371	9606
HNFCFMEMNTR	11	Unmodified	_HNFCFMEMNTR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	496.5723571777344	3	496.205663	1485.59516	0.71667	0.00035561	-0.38583	-0.00019145	0.33084	0.00016417	496.20551489809435	18.625	0.30032	18.625	18.475	18.775	0					4	2	2	0	0	0	1.0047E-09	1	11732	11732		134.75	126.44	1	46581000			949	521	590	612	1266	1266		9606
HPAKPDPSGECNPDLR	16	Unmodified	_HPAKPDPSGECNPDLR_			0	0	1	Q16576	Q16576	Q16576	RBBP7	Histone-binding protein RBBP7	MULTI-MSMS	DP1141_9	4	597.281494140625	3	597.281053	1788.82133	0.099528	5.9446E-05	0.22665	0.00013538	0.32618	0.00019482	597.615549635621	13.91	0.32211	13.91	13.672	13.994	0					16	4	5	0	0	0	5.3336E-14	2	4180	4122;4180		164.53	142.45	1	11010000			950	410	591	613	1267;1268	1268		9606
HPGSFDVVHVK	11	Unmodified	_HPGSFDVVHVK_			0	0	0	P22090;P62701	P22090	P22090	RPS4Y1;RPS4X	40S ribosomal protein S4, Y isoform 1;40S ribosomal protein S4, X isoform	MULTI-MSMS	DP1141_10	5	407.8840026855469	3	407.884012	1220.63021	0.43187	0.00017615	-0.48962	-0.00019971	-0.057753	-2.3557E-05	407.8838971977504	15.511	0.68801	15.511	15.28	15.968	0					10	7	2	0	0	0	0.012127	1	7250	7250		79.036	60.768	1	30050000			951	177	592	614	1269	1269		9606
HQEFDNHINSYDHAHK	16	Unmodified	_HQEFDNHINSYDHAHK_			0	0	0	Q9UKJ3;Q7Z570;A4D1E1	Q9UKJ3	Q9UKJ3	GPATCH8;ZNF804A;ZNF804B	G patch domain-containing protein 8;Zinc finger protein 804A;Zinc finger protein 804B	MULTI-MSMS	DP1141_7	2	498.90484619140625	4	498.724035	1990.86704	0.2546	0.00012697	0.13578	6.7718E-05	0.39038	0.00019469	498.7241684411883	14.162	0.27384	14.162	14.035	14.309	0					4	2	2	0	0	0	0.019378	1	4826	4826		54.393	33.393	1	3674300			952	597	593	615	1270	1270		9606
HQEGEIFDTEKEK	13	Unmodified	_HQEGEIFDTEKEK_			0	0	1	Q02878	Q02878	Q02878	RPL6	60S ribosomal protein L6	MULTI-MSMS	DP1141_9	4	530.9943237304688	3	530.586248	1588.73692	0.54051	0.00028678	-0.55541	-0.00029469	-0.014906	-7.9087E-06	530.9194389506298	14.822	0.25321	14.822	14.634	14.887	0					8	2	4	0	0	0	0.0027535	1	5479	5479		111.72	92.221	1	2281800			953	343	594	616	1271	1271		9606
HQGLPQEVLNENLLR	15	Unmodified	_HQGLPQEVLNENLLR_			0	0	0	CON__P02662	CON__P02662	CON__P02662			MSMS	DP1141_7	2	587.466552734375	3	587.319837	1758.93768	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.299	1	19.299	18.799	19.799	0								0	0	0	0.0024483	1	12959	12959		119.77	53.818	1			+	954	11	595	617	1272	1272		
HQGLPQEVLNENLLR	15	Unmodified	_HQGLPQEVLNENLLR_			0	0	0	CON__P02662	CON__P02662	CON__P02662			MULTI-MSMS	DP1141_9	4	587.93017578125	3	587.319837	1758.93768	0.5174	0.00030388	0.27976	0.00016431	0.79716	0.00046819	587.6542564533559	19.388	0.30057	19.388	19.138	19.438	0					6	2	3	0	0	0	1.3178E-14	1	12884	12884		168.93	139.91	1	15648000		+	955	11	595	617	1273	1273		
HQVIQTVHPVEK	12	Unmodified	_HQVIQTVHPVEK_			0	0	0	Q9H2P0	Q9H2P0	Q9H2P0	ADNP	Activity-dependent neuroprotector homeobox protein	MULTI-MSMS	DP1141_6	1	472.73675537109375	3	472.264892	1413.77285	0.20064	9.4755E-05	1.2448	0.00058785	1.4454	0.00068261	472.2655875014963	14.012	0.72237	14.012	13.886	14.609	0					13	7	3	0	0	0	2.5401999999999996E-66	3	4149	4064;4149;4194		164.81	121.31	1	2635200			956	559	596	618	1274;1275;1276	1275		9606
HQVIQTVHPVEK	12	Unmodified	_HQVIQTVHPVEK_			0	0	0	Q9H2P0	Q9H2P0	Q9H2P0	ADNP	Activity-dependent neuroprotector homeobox protein	MULTI-MSMS	DP1141_7	2	472.5989990234375	3	472.264892	1413.77285	0.84041	0.0003969	3.1673	0.0014958	4.0077	0.0018927	472.2664764658429	14.162	0.43062	14.162	13.78	14.21	0					8	4	2	0	0	0	1.1737999999999999E-80	1	4560	4560		174.9	123.18	1	21987000			957	559	596	618	1277	1277		9606
HQVIQTVHPVEK	12	Unmodified	_HQVIQTVHPVEK_			0	0	0	Q9H2P0	Q9H2P0	Q9H2P0	ADNP	Activity-dependent neuroprotector homeobox protein	MULTI-MSMS	DP1141_8	3	472.26483154296875	3	472.264892	1413.77285	0.053617	2.5321E-05	-0.22913	-0.00010821	-0.17552	-8.289E-05	472.5990288743995	14.013	0.30378	14.013	13.805	14.109	0					5	3	2	0	0	0	2.095E-09	1	4476	4476		138.89	104.71	1	9020000			958	559	596	618	1278	1278		9606
HQVSVEGTNQTDVK	14	Unmodified	_HQVSVEGTNQTDVK_			0	0	0	Q14676	Q14676	Q14676	MDC1	Mediator of DNA damage checkpoint protein 1	MULTI-MSMS	DP1141_6	1	514.5899658203125	3	514.589993	1540.74815	0.28206	0.00014515	-0.049689	-2.5569E-05	0.23237	0.00011958	514.5900213223244	13.847	0.31185	13.847	13.657	13.968	0					5	3	2	0	0	0	0.010772	1	3906	3906		62.081	47.479	1	1112200			959	388	597	619	1279	1279		9606
HQVSVEGTNQTDVK	14	Unmodified	_HQVSVEGTNQTDVK_			0	0	0	Q14676	Q14676	Q14676	MDC1	Mediator of DNA damage checkpoint protein 1	MULTI-MSMS	DP1141_7	2	514.590087890625	3	514.589993	1540.74815	0.35664	0.00018352	0.21529	0.00011079	0.57194	0.00029431	514.5900929806355	13.808	0.59056	13.808	13.62	14.21	0					12	6	4	0	0	0	2.4403E-14	1	4281	4281		136.33	95.851	1	12274000			960	388	597	619	1280	1280		9606
HQVSVEGTNQTDVK	14	Unmodified	_HQVSVEGTNQTDVK_			0	0	0	Q14676	Q14676	Q14676	MDC1	Mediator of DNA damage checkpoint protein 1	MULTI-MSMS	DP1141_7	2	771.3816528320312	2	771.381351	1540.74815	0.97636	0.00075314	-0.20544	-0.00015848	0.77091	0.00059467	771.3812288516987	13.776	0.32717	13.776	13.62	13.947	0					5	3	2	0	0	0	0.0019311	1	4293	4293		137.4	106.11	1	2601700			961	388	597	619	1281	1281		9606
HRPSEADEEELAR	13	Unmodified	_HRPSEADEEELAR_			0	0	1	O14617	O14617	O14617	AP3D1	AP-3 complex subunit delta-1	MULTI-SECPEP	DP1141_6	1	514.2489013671875	3	513.577976	1537.7121	-0.12018	-6.1721E-05	0.61394	0.00031531	0.49376	0.00025359	513.5783279566821	14.262	0.45443	14.262	14.054	14.509	0					8	4	2	0	0	0	4.2016E-31	1	4422	4422		186.51	153.31	1	7004800			962	43	598	620	1282	1282		9606
HRPSEADEEELAR	13	Unmodified	_HRPSEADEEELAR_			0	0	1	O14617	O14617	O14617	AP3D1	AP-3 complex subunit delta-1	MULTI-MSMS	DP1141_7	2	513.9985961914062	3	513.577976	1537.7121	0.34869	0.00017908	-2.063	-0.0010595	-1.7143	-0.00088043	513.5765763363529	14.162	0.50953	14.162	13.701	14.21	0					7	5	2	0	0	0	0.013192	2	4795	4762;4795		119.39	84.425	1	6386700			963	43	598	620	1283;1284	1284		9606
HSAAATALPLSHGAAR	16	Unmodified	_HSAAATALPLSHGAAR_			0	0	0	O75420	O75420	O75420	GIGYF1	PERQ amino acid-rich with GYF domain-containing protein 1	MSMS	DP1141_7	2	511.0599670410156	3	510.942701	1529.80627	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.638	1	14.638	14.138	15.138	0								0	0	0	0.013791	1	5487	5487		98.676	70.292	1				964	75	599	621	1285	1285		9606
HSDELTSLLGYFPNKK	16	Unmodified	_HSDELTSLLGYFPNKK_			0	0	1	Q92878	Q92878	Q92878	RAD50	DNA repair protein RAD50	MULTI-MSMS	DP1141_7	2	616.9165649414062	3	616.987864	1847.94176	0.5254	0.00032417	-1.0139	-0.00062559	-0.48854	-0.00030142	617.6560675133246	20.032	0.59984	20.032	19.551	20.15	0					8	5	3	0	0	0	6.4073E-55	1	14081	14081		170.74	138.46	1	18290000			965	497	600	622	1286	1286		9606
HSGPNSADSANDGFVR	16	Unmodified	_HSGPNSADSANDGFVR_			0	0	0	P52597	P52597	P52597	HNRNPF	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed	MULTI-MSMS	DP1141_10	5	545.2478637695312	3	544.244997	1629.71316	-0.0741	-4.0329E-05	0.48364	0.00026322	0.40954	0.00022289	544.245241091908	14.769	0.34494	14.769	14.539	14.884	0					13	4	4	0	0	0	0.0025777	2	5916	5883;5916		94.454	75.167	1	51303000			966	266	601	623	1287;1288	1288		9606
HSGPNSADSANDGFVR	16	Unmodified	_HSGPNSADSANDGFVR_			0	0	0	P52597	P52597	P52597	HNRNPF	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed	MULTI-MSMS	DP1141_9	4	544.579345703125	3	544.244997	1629.71316	0.77508	0.00042184	-0.67834	-0.00036918	0.096747	5.2654E-05	544.2447586748266	14.75	0.8012	14.75	14.473	15.274	0					21	8	4	0	0	0	1.2598E-100	3	5449	5217;5347;5449		213	199.59	1	105870000			967	266	601	623	1289;1290;1291	1291		9606
HSGPNSADSANDGFVR	16	Unmodified	_HSGPNSADSANDGFVR_			0	0	0	P52597	P52597	P52597	HNRNPF	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed	MULTI-MSMS	DP1141_9	4	816.3660888671875	2	815.863857	1629.71316	-0.17888	-0.00014594	0.78701	0.00064209	0.60813	0.00049615	815.8643105606302	14.75	0.33536	14.75	14.552	14.887	0					6	3	2	0	0	0	6.7383E-287	2	5496	5496;5592		315.41	292.03	1	15595000			968	266	601	623	1292;1293	1292		9606
HSNVNLTIFTAR	12	Unmodified	_HSNVNLTIFTAR_			0	0	0	Q9NRW3;Q8IUX4;Q96AK3	Q9NRW3	Q9NRW3	APOBEC3C;APOBEC3F;APOBEC3D	DNA dC->dU-editing enzyme APOBEC-3C;DNA dC->dU-editing enzyme APOBEC-3F;DNA dC->dU-editing enzyme APOBEC-3D	MULTI-SECPEP	DP1141_7	2	457.96270751953125	3	458.249242	1371.7259	0.66319	0.00030391	-1.7824	-0.00081678	-1.1192	-0.00051288	458.24827847545487	17.299	0.59615	17.299	16.953	17.549	0					6	5	2	0	0	0	0.022958	1	9410	9410		72.289	45.14	1	8586000			969	461	602	624	1294	1294		9606
HTGPITCLQFNPK	13	Unmodified	_HTGPITCLQFNPK_			0	0	0	Q6UXN9	Q6UXN9	Q6UXN9	WDR82	WD repeat-containing protein 82	MULTI-MSMS	DP1141_9	4	505.2491760253906	3	504.925771	1511.75548	-0.24735	-0.00012489	0.72439	0.00036576	0.47705	0.00024087	504.9260716755988	17.487	0.39993	17.487	17.338	17.738	0					5	3	2	0	0	0	0.002989	2	9813	9813;10013		103.46	71.798	1	48499000			970	436	603	625	1295;1296	1295		9606
HTPLVEFEEEESDKR	15	Unmodified	_HTPLVEFEEEESDKR_			0	0	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	615.9878540039062	3	615.626884	1843.85882	0.75213	0.00046303	0.089497	5.5097E-05	0.84162	0.00051813	615.6268774593741	17.354	0.77534	17.354	16.729	17.505	0					22	8	5	0	0	0	6.759000000000001E-69	4	9075	8558;8988;9075;9243		193.45	166.86	1	50076000			971	521	604	626	1297;1298;1299;1300	1299		9606
HTPLVEFEEEESDKR	15	Unmodified	_HTPLVEFEEEESDKR_			0	0	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	615.627197265625	3	615.626884	1843.85882	0.35081	0.00021597	0.0478	2.9427E-05	0.39861	0.0002454	615.9611498672069	17.223	0.74289	17.223	16.731	17.474	0					22	7	4	0	0	0	3.8906999999999996E-240	3	9468	9215;9353;9468		217.2	197.43	1	174900000			972	521	604	626	1301;1302;1303	1303		9606
HTPLVEFEEEESDKR	15	Unmodified	_HTPLVEFEEEESDKR_			0	0	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_9	4	615.9615478515625	3	615.626884	1843.85882	0.013161	8.1025E-06	0.54547	0.00033581	0.55863	0.00034391	615.6271978183829	17.288	0.74115	17.288	16.896	17.638	0					11	7	2	0	0	0	1.982E-211	2	9628	9467;9628		207.64	189.75	1	82197000			973	521	604	626	1304;1305	1305		9606
HTPLVEFEEEESDKRESE	18	Unmodified	_HTPLVEFEEEESDKRESE_			0	0	2	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_10	5	730.666748046875	3	730.665955	2188.97604	0.32486	0.00023736	0.45201	0.00033027	0.77687	0.00056763	731.0005196787281	17.457	0.88235	17.457	17.005	17.887	0					28	8	6	0	0	0	0	3	10447	10289;10353;10447		305.4	278.06	1	76978000			974	521	605	627	1306;1307;1308	1308		9606
HTPLVEFEEEESDKRESE	18	Unmodified	_HTPLVEFEEEESDKRESE_			0	0	2	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	731.0009765625	3	730.665955	2188.97604	0.53997	0.00039454	0.12308	8.9927E-05	0.66304	0.00048446	731.0002891874802	17.555	1.0009	17.555	17.004	18.005	0					37	9	6	0	0	0	5.461699999999999E-296	5	9266	8948;9180;9266;9311;9711		265.43	251.23	1	228260000			975	521	605	627	1309;1310;1311;1312;1313	1311		9606
HTPLVEFEEEESDKRESE	18	Unmodified	_HTPLVEFEEEESDKRESE_			0	0	2	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_7	2	730.666748046875	3	730.665955	2188.97604	0.38296	0.00027982	0.55722	0.00040714	0.94019	0.00068696	731.0007170038629	17.499	0.79791	17.499	17.051	17.849	0					18	7	4	0	0	0	0	2	9987	9865;9987		281.99	262.57	1	139100000			976	521	605	627	1314;1315	1315		9606
HTPLVEFEEEESDKRESE	18	Unmodified	_HTPLVEFEEEESDKRESE_			0	0	2	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	731.0007934570312	3	730.665955	2188.97604	0.44096	0.0003222	0.48973	0.00035783	0.9307	0.00068003	731.0005526326618	17.433	1.0464	17.433	16.828	17.874	0					44	10	7	0	0	0	1.8776E-220	4	9744	9256;9524;9744;9788		253.79	235.64	1	526500000			977	521	605	627	1316;1317;1318;1319	1318		9606
HTPLVEFEEEESDKRESE	18	Unmodified	_HTPLVEFEEEESDKRESE_			0	0	2	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	1095.9991455078125	2	1095.49529	2188.97604	0.96313	0.0010551	-0.29781	-0.00032625	0.66532	0.00072885	1095.996645964168	17.424	0.50121	17.424	17.073	17.574	0					13	4	4	0	0	0	0	2	10001	10001;10076		345.64	331.13	1	22798000			978	521	605	627	1320;1321	1320		9606
HTPLVEFEEEESDKRESE	18	Unmodified	_HTPLVEFEEEESDKRESE_			0	0	2	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_9	4	730.6668090820312	3	730.665955	2188.97604	0.4519	0.00033019	0.41615	0.00030407	0.86805	0.00063426	731.0005074592618	17.49	0.8411	17.49	16.896	17.738	0					29	8	6	0	0	0	0	2	9798	9678;9798		308.04	289.4	1	249380000			979	521	605	627	1322;1323	1323		9606
HTVDDGLDIRK	11	Unmodified	_HTVDDGLDIRK_			0	0	1	Q86VP6	Q86VP6	Q86VP6	CAND1	Cullin-associated NEDD8-dissociated protein 1	MULTI-MSMS	DP1141_10	5	423.55816650390625	3	423.557964	1267.65206	0.10931	4.63E-05	0.66797	0.00028292	0.77728	0.00032922	423.5581627021559	14.719	0.26733	14.719	14.539	14.806	0					10	3	4	0	0	0	0.011617	1	6014	6014		84.198	23.764	1	3226200			980	458	606	628	1324	1324		9606
HTVDDGLDIRK	11	Unmodified	_HTVDDGLDIRK_			0	0	1	Q86VP6	Q86VP6	Q86VP6	CAND1	Cullin-associated NEDD8-dissociated protein 1	MULTI-MSMS	DP1141_7	2	423.5581359863281	3	423.557964	1267.65206	0.16325	6.9145E-05	0.54237	0.00022972	0.70561	0.00029887	423.5583322705873	14.759	0.50093	14.759	14.508	15.009	0					7	4	2	0	0	0	0.003027	1	5721	5721		120.86	45.116	1	21089000			981	458	606	628	1325	1325		9606
HVEASGGSGPGDSGPSDPR	19	Unmodified	_HVEASGGSGPGDSGPSDPR_			0	0	0	Q9UPT8	Q9UPT8	Q9UPT8	ZC3H4	Zinc finger CCCH domain-containing protein 4	MULTI-MSMS	DP1141_8	3	589.2628784179688	3	589.262716	1764.76632	0.24586	0.00014487	0.20698	0.00012197	0.45284	0.00026684	589.2627361164506	12.756	0.59303	12.756	12.606	13.199	0					10	5	3	0	0	0	0.00026534	1	2964	2964		136.35	119.11	1	4636800			982	606	607	629	1326	1326		9606
HVEVQVFGDHHGNAVYLFER	20	Unmodified	_HVEVQVFGDHHGNAVYLFER_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_10	5	588.7747192382812	4	589.042267	2352.13996	1.0152	0.00059798	-0.51469	-0.00030317	0.50049	0.00029481	589.292518695061	19.027	0.30013	19.027	18.877	19.177	0					6	2	3	0	0	0	0.0047442	1	12947	12947		68.088	54.088	1	22122000			983	521	608	630	1327	1327		9606
HVEVQVFGDHHGNAVYLFER	20	Unmodified	_HVEVQVFGDHHGNAVYLFER_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_7	2	589.2933349609375	4	589.042267	2352.13996	0.37026	0.0002181	0.12306	7.2486E-05	0.49332	0.00029058	589.293284902095	19	0.80063	19	18.85	19.65	0					17	7	5	0	0	0	2.5557E-05	1	12658	12658		102.47	85.097	1	89162000			984	521	608	630	1328	1328		9606
HVEVQVFGDHHGNAVYLFER	20	Unmodified	_HVEVQVFGDHHGNAVYLFER_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_7	2	785.0548706054688	3	785.053931	2352.13996	0.35215	0.00027646	0.66347	0.00052086	1.0156	0.00079732	785.054413543912	19	0.60106	19	18.85	19.451	0					10	5	3	0	0	0	0.0019534	1	12676	12676		93.269	77.041	1	36845000			985	521	608	630	1329	1329		9606
HVEVQVFGDHHGNAVYLFER	20	Unmodified	_HVEVQVFGDHHGNAVYLFER_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	589.8079833984375	4	589.042267	2352.13996	0.51524	0.0003035	-0.17382	-0.00010239	0.34142	0.00020111	589.2930190976185	19.026	0.90077	19.026	18.775	19.676	0					26	8	4	0	0	0	8.9961E-06	4	12358	12328;12358;12516;12531		133.95	121.64	1	519190000			986	521	608	630	1330;1331;1332;1333	1331		9606
HVEVQVFGDHHGNAVYLFER	20	Unmodified	_HVEVQVFGDHHGNAVYLFER_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	785.3887329101562	3	785.053931	2352.13996	0.6426	0.00050447	-0.056077	-4.4024E-05	0.58652	0.00046045	785.3882367148033	19.026	0.7	19.026	18.876	19.576	0					8	6	2	0	0	0	3.2966E-07	2	12534	12457;12534		107.09	90.6	1	188330000			987	521	608	630	1334;1335	1335		9606
HVEVQVFGDHHGNAVYLFER	20	Unmodified	_HVEVQVFGDHHGNAVYLFER_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	1177.57861328125	2	1177.07726	2352.13996	1.5492	0.0018235	-1.4623	-0.0017213	0.086868	0.00010225	1177.5769952781252	19.026	0.29939	19.026	18.876	19.175	0					4	2	2	0	0	0	1.9978E-27	1	12595	12595		207.79	182.26	1	18327000			988	521	608	630	1336	1336		9606
HVEVQVFGDHHGNAVYLFER	20	Unmodified	_HVEVQVFGDHHGNAVYLFER_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_9	4	589.2932739257812	4	589.042267	2352.13996	0.54947	0.00032366	-1.0351	-0.00060972	-0.48563	-0.00028605	589.2925013364804	19.055	0.90166	19.055	18.837	19.739	0					13	8	2	0	0	0	3.788E-05	2	12485	12485;12628		122.94	91.056	1	68753000			989	521	608	630	1337;1338	1337		9606
HVEVQVFGDHHGNAVYLFER	20	Unmodified	_HVEVQVFGDHHGNAVYLFER_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_9	4	785.0538330078125	3	785.053931	2352.13996	0.73327	0.00057566	-0.26324	-0.00020666	0.47003	0.000369	785.3877212915661	19.066	0.50106	19.066	18.837	19.338	0					8	4	3	0	0	0	5.1499E-05	1	12524	12524		121.47	107.01	1	16827000			990	521	608	630	1339	1339		9606
HVINFDLPSDIEEYVHR	17	Unmodified	_HVINFDLPSDIEEYVHR_			0	0	0	O15523;O00571	O15523	O15523	DDX3Y;DDX3X	ATP-dependent RNA helicase DDX3Y;ATP-dependent RNA helicase DDX3X	MULTI-MSMS	DP1141_8	3	695.333251953125	3	695.012961	2082.01705	0.77046	0.00053548	0.35497	0.00024671	1.1254	0.00078219	695.347601674275	21.128	0.40011	21.128	20.778	21.178	0					5	3	2	0	0	0	0.0016697	1	15531	15531		110.6	77.237	1	20104000			991	39	609	631	1340	1340		9606
HVLHVQLNRPNK	12	Unmodified	_HVLHVQLNRPNK_			0	0	1	Q13011	Q13011	Q13011	ECH1	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial	MULTI-SECPEP	DP1141_10	5	485.5047912597656	3	485.616148	1453.82661	0.1809	8.7847E-05	-0.099512	-4.8325E-05	0.081386	3.9522E-05	485.6160199230943	14.509	0.32369	14.509	14.276	14.6	0					8	4	2	0	0	0	0.023305	1	5426	5426		107.79	82.446	1	3830800			992	366	610	632	1341	1341		9606
HVLHVQLNRPNK	12	Unmodified	_HVLHVQLNRPNK_			0	0	1	Q13011	Q13011	Q13011	ECH1	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial	MULTI-SECPEP	DP1141_9	4	485.5698547363281	3	485.616148	1453.82661	0.35305	0.00017145	0.18531	8.9992E-05	0.53836	0.00026144	485.61618499185016	14.514	0.48295	14.514	14.312	14.795	0					8	5	2	0	0	0	0.019005	1	5185	5185		93.667	66.914	1	22847000			993	366	610	632	1342	1342		9606
HVNTNPLCDLTPIFK	15	Unmodified	_HVNTNPLCDLTPIFK_			0	0	0	Q9UKX7	Q9UKX7	Q9UKX7	NUP50	Nuclear pore complex protein Nup50	MULTI-SECPEP	DP1141_8	3	885.4251708984375	2	884.956172	1767.89779	0.4583	0.00040557	1.8105	0.0016022	2.2688	0.0020078	885.4589018819681	20.628	0.60106	20.628	20.277	20.878	0					7	5	2	0	0	0	0.009677	1	14844	14844		84.892	52.638	1	7558200			994	600	611	633	1343	1343		9606
HVVFIAQR	8	Unmodified	_HVVFIAQR_			0	0	0	P62081	P62081	P62081	RPS7	40S ribosomal protein S7	MULTI-MSMS	DP1141_10	5	485.7451171875	2	485.285069	968.555585	0.34038	0.00016518	0.044533	2.1611E-05	0.38491	0.00018679	485.28502203807426	15.658	0.41295	15.658	15.46	15.873	0					10	4	3	0	0	0	1.7717E-14	1	7357	7357		167.23	143.05	1	70309000			995	285	612	634	1344	1344		9606
HWPFMVVNDAGRPK	14	Oxidation (M)	_HWPFM(Oxidation (M))VVNDAGRPK_	HWPFM(1)VVNDAGRPK	HWPFM(110)VVNDAGRPK	0	1	1	P11142	P11142	P11142	HSPA8	Heat shock cognate 71 kDa protein	MULTI-MSMS	DP1141_8	3	557.3350830078125	3	557.280437	1668.81948	0.28553	0.00015912	0.014442	8.0483E-06	0.29997	0.00016717	557.6148150822492	17.824	0.60114	17.824	17.574	18.175	0					10	5	3	0	0	0	0.0077523	1	10542	10542		106.26	95.087	1	59389000			996	140	613	635	1345	1345	134	9606
HWPFQVINDGDKPK	14	Unmodified	_HWPFQVINDGDKPK_			0	0	1	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-MSMS	DP1141_8	3	560.9547729492188	3	560.954606	1679.84199	0.14294	8.0182E-05	0.31914	0.00017902	0.46208	0.00025921	560.9547625916856	18.225	0.70047	18.225	17.975	18.675	0					24	6	5	0	0	0	2.5124999999999996E-66	4	11256	11100;11256;11304;11583		193.11	193.11	1	379150000			997	135	614	636	1346;1347;1348;1349	1347		9606
HWPFQVINDGDKPK	14	Unmodified	_HWPFQVINDGDKPK_			0	0	1	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MSMS	DP1141_8	3	840.9097290039062	2	840.928271	1679.84199	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.207	1	18.207	17.707	18.707	0								0	0	0	0.032515	1	11123	11123		121.02	91.477	1				998	135	614	636	1350	1350		9606
HWPFQVINDGDKPK	14	Unmodified	_HWPFQVINDGDKPK_			0	0	1	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-MSMS	DP1141_9	4	561.2892456054688	3	560.954606	1679.84199	0.28497	0.00015986	0.51132	0.00028683	0.79629	0.00044668	560.9549409213182	18.289	0.89961	18.289	17.738	18.637	0					22	8	6	0	0	0	0.012765	1	11247	11247		107.53	91.306	1	46516000			999	135	614	636	1351	1351		9606
HYFIEVNSR	9	Unmodified	_HYFIEVNSR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MSMS	DP1141_7	2	582.793701171875	2	582.793455	1163.57236	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.905	1	16.905	16.405	17.405	0								0	0	0	2.7904E-33	1	9127	9127		171.38	104.7	1				1000	142	615	637	1352	1352		9606
HYFIEVNSR	9	Unmodified	_HYFIEVNSR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	582.793701171875	2	582.793455	1163.57236	0.0015343	8.942E-07	0.47287	0.00027558	0.4744	0.00027648	582.7936668268218	16.878	0.51041	16.878	16.562	17.073	0					14	5	4	0	0	0	0.0056558	1	9064	9064		113.71	63.58	1	148800000			1001	142	615	637	1353	1353		9606
HYFIEVNSR	9	Unmodified	_HYFIEVNSR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MSMS	DP1141_9	4	582.8077392578125	2	582.793455	1163.57236	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.873	1	16.873	16.373	17.373	0								0	0	0	1.9758E-16	1	8903	8903		157.33	102.78	1				1002	142	615	637	1354	1354		9606
HYFIEVNSR	9	Unmodified	_HYFIEVNSR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MSMS	DP1141_9	4	582.7938232421875	2	582.793455	1163.57236	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.912	1	16.912	16.412	17.412	0								0	0	0	0.02291	1	8967	8967		110.12	69.342	1				1003	142	615	637	1355	1355		9606
IAAGEKIPLSQEEITLQGHAFEAR	24	Unmodified	_IAAGEKIPLSQEEITLQGHAFEAR_			0	0	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-SECPEP	DP1141_7	2	652.6566162109375	4	652.848693	2607.36567	-0.37952	-0.00024777	0.72843	0.00047555	0.3489	0.00022778	653.0999803289977	19	0.30037	19	18.75	19.05	0					6	2	3	0	0	0	2.1755E-24	1	12389	12389		134.58	121.31	1	41532000			1004	521	616	638	1356	1356		9606
IAAGEKIPLSQEEITLQGHAFEAR	24	Unmodified	_IAAGEKIPLSQEEITLQGHAFEAR_			0	0	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	652.9915771484375	4	652.848693	2607.36567	1.2299	0.00080296	-0.43851	-0.00028628	0.79142	0.00051668	653.0991287951354	18.926	0.3	18.926	18.775	19.075	0					10	2	5	0	0	0	6.3858E-84	2	12349	12349;12382		201.27	190.87	1	343230000			1005	521	616	638	1357;1358	1357		9606
IAAGEKIPLSQEEITLQGHAFEAR	24	Unmodified	_IAAGEKIPLSQEEITLQGHAFEAR_			0	0	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	870.464111328125	3	870.129165	2607.36567	0.7846	0.00068271	-0.10113	-8.8E-05	0.68347	0.00059471	870.4633340009783	18.926	0.3	18.926	18.775	19.075	0					4	2	2	0	0	0	0.01275	1	12389	12389		58.054	40.11	1	122440000			1006	521	616	638	1359	1359		9606
IAEENIMK	8	Unmodified	_IAEENIMK_			0	0	0	Q14320	Q14320	Q14320	FAM50A	Protein FAM50A	MULTI-MSMS	DP1141_9	4	474.75225830078125	2	474.24696	946.479368	0.34217	0.00016227	1.992	0.00094468	2.3341	0.001107	474.2468951230918	15.922	0.3855	15.922	15.673	16.058	0					10	3	4	0	0	0	0.016466	1	7357	7357		99.375	43.253	1	25087000			1007	386	617	639	1360	1360		9606
IAIYELLFK	9	Unmodified	_IAIYELLFK_			0	0	0	P46783	P46783	P46783	RPS10	40S ribosomal protein S10	MULTI-MSMS	DP1141_10	5	555.3341674804688	2	555.333893	1108.65323	1.0151	0.00056371	-0.13487	-7.4896E-05	0.88021	0.00048881	555.3337679554868	23.265	0.21824	23.265	23.151	23.369	0					6	2	3	0	0	0	0.0040668	1	19417	19417		105.57	89.365	1	14195000			1008	238	618	640	1361	1361		9606
IALTDNALIAR	11	Unmodified	_IALTDNALIAR_			0	0	0	P18124	P18124	P18124	RPL7	60S ribosomal protein L7	MULTI-SECPEP	DP1141_10	5	585.4793701171875	2	585.845687	1169.67682	0.90494	0.00053015	-0.3438	-0.00020141	0.56114	0.00032874	585.8456592642553	19.027	0.49008	19.027	18.587	19.077	0					7	4	3	0	0	0	4.346E-138	1	12921	12921		205.59	120.84	1	31384000			1009	167	619	641	1362	1362		9606
IALTDNALIAR	11	Unmodified	_IALTDNALIAR_			0	0	0	P18124	P18124	P18124	RPL7	60S ribosomal protein L7	MSMS	DP1141_9	4	585.74658203125	2	585.845687	1169.67682	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.018	1	19.018	18.518	19.518	0								0	0	0	0.0047466	1	12364	12364		131.22	58.433	1				1010	167	619	641	1363	1363		9606
IALYGLGSIPDER	13	Unmodified	_IALYGLGSIPDER_			0	0	0	P49959	P49959	P49959	MRE11A	Double-strand break repair protein MRE11A	MSMS	DP1141_8	3	702.3812255859375	2	702.380091	1402.74563	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.671	1	20.671	20.171	21.171	0								0	0	0	0.02101	1	14832	14832		104.43	63.007	1				1011	254	620	642	1364	1364		9606
IAPYVAHNFSK	11	Unmodified	_IAPYVAHNFSK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	624.9884033203125	2	623.83258	1245.65061	0.65382	0.00040788	-0.052178	-3.2551E-05	0.60164	0.00037533	623.8324760765424	16.043	0.30117	16.043	15.804	16.105	0					8	2	4	0	0	0	0.021191	1	6922	6922		81.525	45.13	1	10272000			1012	142	621	643	1365	1365		9606
IAPYVAHNFSK	11	Unmodified	_IAPYVAHNFSK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	416.89093017578125	3	416.224146	1245.65061	0.084643	3.523E-05	0.17301	7.201E-05	0.25765	0.00010724	416.22420035807903	16.043	0.59702	16.043	15.708	16.305	0					13	5	5	0	0	0	0.0021657	2	7041	7041;7064		139.15	104.95	1	39446000			1013	142	621	643	1366;1367	1366		9606
IAPYVAHNFSK	11	Unmodified	_IAPYVAHNFSK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-SECPEP	DP1141_7	2	415.7314758300781	3	416.224146	1245.65061	0.37744	0.0001571	0.39558	0.00016465	0.77302	0.00032175	416.22459843596704	15.964	0.92991	15.964	15.714	16.644	0					12	9	2	0	0	0	0.0014228	1	7669	7669		107.45	83.604	1	1716399999.9999998			1014	142	621	643	1368	1368		9606
IAPYVAHNFSK	11	Unmodified	_IAPYVAHNFSK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_9	4	416.5698547363281	3	416.224146	1245.65061	0.16743	6.969E-05	0.19253	8.0135E-05	0.35996	0.00014983	416.2241403009065	16.008	0.28573	16.008	15.772	16.058	0					4	2	2	0	0	0	0.0042406	1	7432	7432		109.16	86.239	1	20164000			1015	142	621	643	1369	1369		9606
IASSIVAQTAGIPTLPWSGSGLR	23	Unmodified	_IASSIVAQTAGIPTLPWSGSGLR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	1142.13037109375	2	1141.62879	2281.24303	0.37509	0.00042821	-0.22353	-0.00025519	0.15156	0.00017302	1142.1301623279446	22.229	0.36753	22.229	21.936	22.304	0					16	5	5	0	0	0	2.3247E-162	2	16899	16899;16902		294.97	246.34	1	69684000			1016	367	622	644	1370;1371	1370		9606
IASSIVAQTAGIPTLPWSGSGLR	23	Unmodified	_IASSIVAQTAGIPTLPWSGSGLR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	761.7564697265625	3	761.42162	2281.24303	0.29098	0.00022156	0.49661	0.00037813	0.78759	0.00059969	761.7563239025835	22.236	0.2318	22.236	22.072	22.304	0					9	3	4	0	0	0	3.3907000000000005E-161	1	16900	16900		227.57	212.41	1	52288000			1017	367	622	644	1372	1372		9606
IASSIVAQTAGIPTLPWSGSGLR	23	Unmodified	_IASSIVAQTAGIPTLPWSGSGLR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	1142.1302490234375	2	1141.62879	2281.24303	0.51212	0.00058465	0.036452	4.1615E-05	0.54857	0.00062626	1142.130199276503	22.288	0.27226	22.288	22.047	22.319	0					6	2	3	0	0	0	3.1124E-07	1	17432	17432		164.41	124.34	1	9478200			1018	367	622	644	1373	1373		9606
IATGHGQQGVTQVVLK	16	Unmodified	_IATGHGQQGVTQVVLK_			0	0	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-MSMS	DP1141_8	3	545.760009765625	3	545.977411	1634.9104	0.65755	0.00035901	0.0076298	4.1657E-06	0.66518	0.00036317	545.9773356488697	15.926	0.30025	15.926	15.776	16.076	0					4	2	2	0	0	0	0.0041309	1	7420	7420		96.673	72.962	1	87219000			1019	259	623	645	1374	1374		9606
IATGHGQQGVTQVVLK	16	Unmodified	_IATGHGQQGVTQVVLK_			0	0	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-SECPEP	DP1141_9	4	545.7599487304688	3	545.977411	1634.9104	0.64198	0.00035051	-0.2649	-0.00014463	0.37708	0.00020588	545.9772423727832	15.922	0.28573	15.922	15.772	16.058	0					6	2	3	0	0	0	0.006463	1	7348	7348		99.941	77.449	1	27820000			1020	259	623	645	1375	1375		9606
IAVEPVNPSELPK	13	Unmodified	_IAVEPVNPSELPK_			0	0	0	Q15029	Q15029	Q15029	EFTUD2	116 kDa U5 small nuclear ribonucleoprotein component	MULTI-MSMS	DP1141_8	3	697.6919555664062	2	696.890292	1391.76603	0.94273	0.00065698	0.84243	0.00058708	1.7852	0.0012441	697.3926310239038	18.525	0.30011	18.525	18.275	18.575	0					4	2	2	0	0	0	0.029211	1	11531	11531		73.781	29.578	1	3284900			1021	399	624	646	1376	1376		9606
ICCDLDVLASK	11	Unmodified	_ICCDLDVLASK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_10	5	647.8384399414062	2	647.312506	1292.61046	-0.35987	-0.00023295	0.14237	9.2156E-05	-0.2175	-0.00014079	647.3127608065846	18.827	0.48978	18.827	18.387	18.877	0					5	4	2	0	0	0	0.0050893	1	12530	12530		103.26	62.373	1	5344400			1022	111	625	647	1377	1377		9606
ICCDLDVLASK	11	Unmodified	_ICCDLDVLASK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	647.7826538085938	2	647.312506	1292.61046	1.1332	0.00073353	-0.3775	-0.00024436	0.75569	0.00048917	647.3122718285781	18.826	0.30068	18.826	18.575	18.876	0					4	2	2	0	0	0	0.0052018	1	12066	12066		109.83	47.722	1	16919000			1023	111	625	647	1378	1378		9606
ICGDIHGQYYDLLR	14	Unmodified	_ICGDIHGQYYDLLR_			0	0	0	P62136;P36873	P62136;P36873	P62136	PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-SECPEP	DP1141_10	5	575.2990112304688	3	574.947123	1721.81954	1.1344	0.0006522	-0.40101	-0.00023056	0.73336	0.00042165	575.2811957263217	19.227	0.39943	19.227	18.977	19.376	0					5	3	2	0	0	0	0.019821	1	13130	13130		66.989	66.989	1	200070000			1024	286;212	626	648	1379	1379		9606
ICGDIHGQYYDLLR	14	Unmodified	_ICGDIHGQYYDLLR_			0	0	0	P62136;P36873	P62136;P36873	P62136	PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_6	1	575.800048828125	3	574.947123	1721.81954	0.90378	0.00051962	-0.42208	-0.00024267	0.4817	0.00027695	574.946938090039	19.256	0.5005	19.256	19.005	19.506	0					7	4	3	0	0	0	0.01331	1	12225	12225		89.663	69.433	1	55496000			1025	286;212	626	648	1380	1380		9606
ICGDIHGQYYDLLR	14	Unmodified	_ICGDIHGQYYDLLR_			0	0	0	P62136;P36873	P62136;P36873	P62136	PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_8	3	574.947509765625	3	574.947123	1721.81954	0.19734	0.00011346	-0.10822	-6.2222E-05	0.08912	5.1239E-05	574.9474319822324	19.225	0.60007	19.225	18.976	19.576	0					21	5	6	0	0	0	0.0011801	1	12695	12695		149.57	114.49	1	1032999999.9999999			1026	286;212	626	648	1381	1381		9606
ICGDIHGQYYDLLR	14	Unmodified	_ICGDIHGQYYDLLR_			0	0	0	P62136;P36873	P62136;P36873	P62136	PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_8	3	574.9476318359375	3	574.947123	1721.81954	-0.66771	-0.0003839	0.97814	0.00056238	0.31043	0.00017848	575.2819088345399	36.76	0.44472	36.76	36.717	37.162	0					14	9	2	0	0	0	0.025027	1	34211	34211		67.358	35.702	1	6486600			1027	286;212	626	648	1382	1382		9606
IDEMPEAAVK	10	Oxidation (M)	_IDEM(Oxidation (M))PEAAVK_	IDEM(1)PEAAVK	IDEM(91)PEAAVK	0	1	0	P51858	P51858	P51858	HDGF	Hepatoma-derived growth factor	MULTI-SECPEP	DP1141_9	4	559.2650756835938	2	559.773539	1117.53253	0.55103	0.00030845	0.36715	0.00020552	0.91818	0.00051397	559.7735902434366	14.979	0.36102	14.979	14.714	15.075	0					7	3	3	0	0	0	0.018556	1	5683	5683		91.265	91.265	1	5565400			1028	261	627	649	1383	1383	210	9606
IDEPLEGSEDR	11	Unmodified	_IDEPLEGSEDR_			0	0	0	P61978	P61978	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	MULTI-MSMS	DP1141_10	5	630.3324584960938	2	630.291139	1258.56773	-0.42674	-0.00026897	1.181	0.00074438	0.75428	0.00047541	630.2919089569612	16.116	0.48995	16.116	15.873	16.363	0					6	4	2	0	0	0	0.0065705	1	8093	8093		100.02	38.018	1	21588000			1029	284	628	650	1384	1384		9606
IDEPLEGSEDR	11	Unmodified	_IDEPLEGSEDR_			0	0	0	P61978	P61978	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	MULTI-MSMS	DP1141_8	3	630.3189086914062	2	630.291139	1258.56773	0.16608	0.00010468	0.17792	0.00011214	0.344	0.00021682	630.2912605137233	16.126	0.40036	16.126	15.876	16.276	0					5	3	2	0	0	0	0.0030177	1	7896	7896		126.07	46.951	1	72199000			1030	284	628	650	1385	1385		9606
IDLDAEEENIQEGPK	15	Unmodified	_IDLDAEEENIQEGPK_			0	0	0	P13866	P13866	P13866	SLC5A1	Sodium/glucose cotransporter 1	MULTI-MSMS	DP1141_7	2	850.7355346679688	2	850.404689	1698.79482	0.33823	0.00028763	-1.9266	-0.0016384	-1.5883	-0.0013507	850.9048523273374	18.399	0.50039	18.399	17.949	18.449	0					8	4	3	0	0	0	0.02038	1	11481	11481		75.229	20.743	1	24793000			1031	149	629	651	1386	1386		9606
IDPQEPTHSK	10	Unmodified	_IDPQEPTHSK_			0	0	0	Q96P31	Q96P31	Q96P31	FCRL3	Fc receptor-like protein 3	MULTI-MSMS	DP1141_10	5	576.28857421875	2	576.288202	1150.56185	0.39107	0.00022537	-0.0043271	-2.4937E-06	0.38674	0.00022288	576.2882018129412	14.995	0.47395	14.995	14.806	15.28	0					9	5	2	0	0	0	0.02365	1	6350	6350		80.438	6.1372	1	318300000			1032	518	630	652	1387	1387		9606
IDTGWLDR	8	Unmodified	_IDTGWLDR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	488.78631591796875	2	488.248349	974.482145	0.5113	0.00024964	-0.47788	-0.00023333	0.033422	1.6318E-05	488.2483575638409	19.155	0.9013	19.155	18.604	19.506	0					16	8	4	0	0	0	2.2911E-14	1	12159	12159		166.78	70.99	1	908310000			1033	367	631	653	1388	1388		9606
IEDVTPIPSDSTR	13	Unmodified	_IEDVTPIPSDSTR_			0	0	0	P62263	P62263	P62263	RPS14	40S ribosomal protein S14	MULTI-MSMS	DP1141_10	5	715.3624877929688	2	715.362096	1428.70964	0.70788	0.00050639	0.050129	3.586E-05	0.75801	0.00054225	715.3620550814177	17.237	0.60969	17.237	16.878	17.488	0					14	6	3	0	0	0	6.302999999999999E-22	2	10119	10119;10229		175.33	132.98	1	111440000			1034	291	632	654	1389;1390	1389		9606
IEDVTPIPSDSTRR	14	Unmodified	_IEDVTPIPSDSTRR_			0	0	1	P62263	P62263	P62263	RPS14	40S ribosomal protein S14	MULTI-MSMS	DP1141_10	5	529.27734375	3	529.277526	1584.81075	0.2848	0.00015074	2.1594	0.0011429	2.4442	0.0012936	529.2787499662228	16.123	0.58693	16.123	15.873	16.46	0					13	5	3	0	0	0	0.0033947	1	8536	8536		103.44	74.112	1	40548000			1035	291	633	655	1391	1391		9606
IEEDIGELLIPVRRSGDASQELIVICSTR	29	Unmodified	_IEEDIGELLIPVRRSGDASQELIVICSTR_			0	0	2	P0C091	P0C091	P0C091	FREM3	FRAS1-related extracellular matrix protein 3	MULTI-MSMS	DP1141_7	2	818.1888427734375	4	817.935599	3267.71329	0.805	0.00065844	-1.0218	-0.0008358	-0.21684	-0.00017736	818.186025602164	20.8	0.59961	20.8	20.351	20.95	0					12	5	3	0	0	0	0.0056383	1	15054	15054		41.763	16.928	1	11818000			1036	132	634	656	1392	1392		9606
IEGDETSTEAATR	13	Unmodified	_IEGDETSTEAATR_			0	0	0	P52434	P52434	P52434	POLR2H	DNA-directed RNA polymerases I, II, and III subunit RPABC3	MULTI-MSMS	DP1141_10	5	690.318359375	2	690.317885	1378.62122	0.57461	0.00039667	0.16376	0.00011305	0.73838	0.00050971	690.3181798619429	14.123	0.31098	14.123	14.028	14.339	0					7	4	3	0	0	0	4.6655E-14	2	5070	5070;5082		162.38	129.96	1	9593700			1037	265	635	657	1393;1394	1393		9606
IEISELNR	8	Unmodified	_IEISELNR_			0	0	0	P04264;CON__P04264;CON__P35908v2;CON__P35908;P35908	P04264;CON__P35908v2	P04264	KRT1;KRT2	Keratin, type II cytoskeletal 1;Keratin, type II cytoskeletal 2 epidermal	MULTI-SECPEP	DP1141_7	2	487.71087646484375	2	487.269281	972.52401	0.4802	0.00023399	-0.12417	-6.0504E-05	0.35603	0.00017348	487.26919756690955	17.299	0.59988	17.299	17.149	17.749	0					7	5	2	0	0	0	8.9348E-14	1	9760	9760		189.62	55.805	1	418360000		+	1038	102;20	636	658	1395	1395		9606
IENLSNLHQLQMLELGSNR	19	Oxidation (M)	_IENLSNLHQLQM(Oxidation (M))LELGSNR_	IENLSNLHQLQM(1)LELGSNR	IENLSNLHQLQM(62)LELGSNR	0	1	0	Q15435	Q15435	Q15435	PPP1R7	Protein phosphatase 1 regulatory subunit 7	MULTI-MSMS	DP1141_9	4	742.378662109375	3	742.382948	2224.12701	0.51007	0.00037867	-3.6158	-0.0026843	-3.1057	-0.0023056	742.7148408049417	19.689	0.49987	19.689	19.438	19.938	0					6	4	2	0	0	0	0.010591	1	13473	13473		62.002	29.452	1	204360000			1039	404	637	659	1396	1396	310	9606
IENVPTGPNNKPK	13	Unmodified	_IENVPTGPNNKPK_			0	0	1	O43447	O43447	O43447	PPIH	Peptidyl-prolyl cis-trans isomerase H	MULTI-MSMS	DP1141_10	5	469.9247741699219	3	469.924536	1406.75178	0.2346	0.00011025	0.26381	0.00012397	0.49842	0.00023422	469.92463298654565	13.952	0.43303	13.952	13.72	14.153	0					15	7	3	0	0	0	0.0022119	1	4663	4663		137.01	85.027	1	9849200			1040	58	638	660	1397	1397		9606
IESGGGNILIHHSR	14	Unmodified	_IESGGGNILIHHSR_			0	0	0	Q7Z3U7	Q7Z3U7	Q7Z3U7	MON2	Protein MON2 homolog	MULTI-MSMS	DP1141_7	2	497.5987854003906	3	497.267184	1488.77972	-0.28052	-0.00013949	-3.1293	-0.0015561	-3.4098	-0.0016956	497.59979456600456	14.889	0.30071	14.889	14.708	15.009	0					4	2	2	0	0	0	0.02327	1	6030	6030		62.287	43.83	1	5513500			1041	449	639	661	1398	1398		9606
IETIEVMEDR	10	Oxidation (M)	_IETIEVM(Oxidation (M))EDR_	IETIEVM(1)EDR	IETIEVM(120)EDR	0	1	0	P51991	P51991	P51991	HNRNPA3	Heterogeneous nuclear ribonucleoprotein A3	MULTI-MSMS	DP1141_9	4	625.800537109375	2	625.800285	1249.58602	0.25436	0.00015918	0.313	0.00019588	0.56736	0.00035505	625.8004939761696	16.598	0.32355	16.598	16.458	16.782	0					8	3	3	0	0	0	0.023721	2	8520	8492;8520		123.21	70.042	1	68746000			1042	262	640	662	1399;1400	1400	211	9606
IETNENNLESAK	12	Unmodified	_IETNENNLESAK_			0	0	0	Q07065	Q07065	Q07065	CKAP4	Cytoskeleton-associated protein 4	MULTI-MSMS	DP1141_8	3	681.3051147460938	2	681.330795	1360.64704	0.7546	0.00051413	-0.7617	-0.00051897	-0.0070973	-4.8356E-06	681.3305806725539	14.923	0.39757	14.923	14.674	15.072	0					5	3	2	0	0	0	3.4739E-52	1	5790	5790		191.4	116.29	1	16686000			1043	351	641	663	1401	1401		9606
IEVIEIMTDR	10	Unmodified	_IEVIEIMTDR_			0	0	0	P09651;Q32P51;A0A2R8Y4L2	P09651	P09651	HNRNPA1;HNRNPA1L2	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2	MULTI-MSMS	DP1141_9	4	609.9833984375	2	609.823563	1217.63257	-0.16111	-9.8248E-05	0.63368	0.00038643	0.47257	0.00028818	609.8240504862039	20.493	0.29976	20.493	20.337	20.636	0					6	2	3	0	0	0	0.0031002	1	14549	14549		107.57	65.465	1	130180000			1044	130	642	664	1402	1402		9606
IEVIEIMTDR	10	Oxidation (M)	_IEVIEIM(Oxidation (M))TDR_	IEVIEIM(1)TDR	IEVIEIM(180)TDR	0	1	0	P09651;Q32P51;A0A2R8Y4L2	P09651	P09651	HNRNPA1;HNRNPA1L2	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2	MULTI-SECPEP	DP1141_9	4	617.598388671875	2	617.821021	1233.62749	0.062502	3.8615E-05	0.11627	7.1833E-05	0.17877	0.00011045	617.8211653374726	18.487	0.49997	18.487	18.237	18.737	0					8	4	3	0	0	0	7.7932E-12	1	11417	11417		177.3	119.45	1	41984000			1045	130	642	665	1403	1403	125	9606
IFCCHGGLSPDLQSMEQIR	19	Unmodified	_IFCCHGGLSPDLQSMEQIR_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_8	3	750.855712890625	3	750.015102	2247.02348	0.8469	0.00063519	-0.1308	-9.8102E-05	0.7161	0.00053709	750.3494164659194	19.626	0.50126	19.626	19.375	19.877	0					10	4	3	0	0	0	0.015275	1	13631	13631		65.905	47.27	1	658300000			1046	286;212;287	643	666	1404	1404		9606
IFCCHGGLSPDLQSMEQIR	19	Unmodified	_IFCCHGGLSPDLQSMEQIR_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_9	4	750.3499755859375	3	750.015102	2247.02348	0.60919	0.0004569	-0.35167	-0.00026375	0.25752	0.00019315	750.3493017924598	19.589	0.59877	19.589	19.438	20.037	0					18	5	5	0	0	0	3.9267E-09	1	13394	13394		154.49	125.07	1	130070000			1047	286;212;287	643	666	1405	1405		9606
IFCCHGGLSPDLQSMEQIR	19	Oxidation (M)	_IFCCHGGLSPDLQSM(Oxidation (M))EQIR_	IFCCHGGLSPDLQSM(1)EQIR	IFCCHGGLSPDLQSM(210)EQIR	0	1	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_9	4	754.88037109375	3	755.346741	2263.01839	0.59616	0.0004503	-0.95859	-0.00072407	-0.36244	-0.00027376	755.6805816637249	18.088	0.79989	18.088	17.937	18.737	0					25	7	7	0	0	0	7.2548E-90	1	10920	10920		208.38	192.09	1	411800000			1048	286;212;287	643	667	1406	1406	177	9606
IFCCHGGLSPDLQSMEQIRR	20	Unmodified	_IFCCHGGLSPDLQSMEQIRR_			0	0	1	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_8	3	602.03955078125	4	601.788424	2403.12459	0.61154	0.00036802	-0.61231	-0.00036848	-0.00076498	-4.6035E-07	602.0390639606966	18.725	0.40073	18.725	18.475	18.876	0					13	3	5	0	0	0	0.002079	1	11946	11946		90.453	55.803	1	137470000			1049	286;212;287	644	668	1407	1407		9606
IFGYPVGIVGNNGVLFSESAK	21	Unmodified	_IFGYPVGIVGNNGVLFSESAK_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	723.7194213867188	3	723.384395	2167.13136	0.28754	0.000208	0.44626	0.00032282	0.7338	0.00053082	723.719257082117	22.61	0.39766	22.61	22.475	22.872	0					9	4	3	0	0	0	0.01044	1	17855	17855		60.325	44.389	1	25255000			1050	567	645	669	1408	1408		9606
IFGYPVGIVGNNGVLFSESAK	21	Unmodified	_IFGYPVGIVGNNGVLFSESAK_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	1085.0751953125	2	1084.57295	2167.13136	-0.3921	-0.00042526	0.82365	0.00089331	0.43155	0.00046805	1085.0756741815735	22.621	0.20861	22.621	22.504	22.713	0					6	2	3	0	0	0	2.3631E-07	1	17929	17929		114.31	94.986	1	9425000			1051	567	645	669	1409	1409		9606
IFMASEILPPTLR	13	Oxidation (M)	_IFM(Oxidation (M))ASEILPPTLR_	IFM(1)ASEILPPTLR	IFM(54)ASEILPPTLR	0	1	0	P20936	P20936	P20936	RASA1	Ras GTPase-activating protein 1	MSMS	DP1141_9	4	501.7841796875	3	501.946172	1502.81669	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.785	1	20.785	20.285	21.285	0								0	0	0	0.035925	1	15050	15050		54.023	33.596	1				1052	173	646	670	1410	1410	155	9606
IGEEEIQKPEEK	12	Unmodified	_IGEEEIQKPEEK_			0	0	1	Q15459	Q15459	Q15459	SF3A1	Splicing factor 3A subunit 1	MULTI-SECPEP	DP1141_7	2	476.945556640625	3	476.912073	1427.71439	0.39279	0.00018733	-0.071789	-3.4237E-05	0.321	0.00015309	476.9120302846949	14.658	0.5005	14.658	14.408	14.909	0					10	4	3	0	0	0	1.8086E-09	1	5585	5585		160.91	84.581	1	26583000			1053	405	647	671	1411	1411		9606
IGGGIDVPVPR	11	Unmodified	_IGGGIDVPVPR_			0	0	0	Q92945	Q92945	Q92945	KHSRP	Far upstream element-binding protein 2	MULTI-SECPEP	DP1141_7	2	539.7987060546875	2	540.314023	1078.61349	0.15843	8.56E-05	1.2268	0.00066284	1.3852	0.00074844	540.8162338367171	18.299	0.60068	18.299	17.849	18.449	0					6	5	2	0	0	0	0.010595	1	11285	11285		103.55	28.236	1	10334000			1054	500	648	672	1412	1412		9606
IGGGIDVPVPR	11	Unmodified	_IGGGIDVPVPR_			0	0	0	Q92945	Q92945	Q92945	KHSRP	Far upstream element-binding protein 2	MSMS	DP1141_8	3	540.22705078125	2	540.314023	1078.61349	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.155	1	18.155	17.655	18.655	0								0	0	0	0.030456	1	11042	11042		95.358	31.151	1				1055	500	648	672	1413	1413		9606
IGGIGTVPVGR	11	Unmodified	_IGGIGTVPVGR_			0	0	0	P68104;Q5VTE0;Q05639	P68104	P68104	EEF1A1;EEF1A1P5;EEF1A2	Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3;Elongation factor 1-alpha 2	MULTI-MSMS	DP1141_10	5	513.2721557617188	2	513.308741	1024.60293	-0.0794	-4.0757E-05	0.39585	0.00020319	0.31645	0.00016244	513.3090105253037	17.337	0.40057	17.337	17.087	17.488	0					6	3	2	0	0	0	0.004564	1	10192	10192		132.76	67.512	1	51561000			1056	320	649	673	1414	1414		9606
IGGIGTVPVGR	11	Unmodified	_IGGIGTVPVGR_			0	0	0	P68104;Q5VTE0;Q05639	P68104	P68104	EEF1A1;EEF1A1P5;EEF1A2	Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3;Elongation factor 1-alpha 2	MULTI-MSMS	DP1141_6	1	513.7913818359375	2	513.308741	1024.60293	0.26035	0.00013364	0.13124	6.7366E-05	0.39159	0.00020101	513.3088596658188	17.354	0.702	17.354	17.103	17.805	0					11	6	3	0	0	0	1.0156E-08	3	9156	9156;9305;9382		156.75	112.95	1	55240000			1057	320	649	673	1415;1416;1417	1415		9606
IGGIGTVPVGR	11	Unmodified	_IGGIGTVPVGR_			0	0	0	P68104;Q5VTE0;Q05639	P68104	P68104	EEF1A1;EEF1A1P5;EEF1A2	Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3;Elongation factor 1-alpha 2	MULTI-MSMS	DP1141_7	2	513.308837890625	2	513.308741	1024.60293	0.25691	0.00013188	-0.1512	-7.7612E-05	0.10571	5.4263E-05	513.3087476541733	17.299	0.30062	17.299	17.149	17.45	0					6	2	3	0	0	0	0.025535	1	9940	9940		76.221	19.174	1	48241000			1058	320	649	673	1418	1418		9606
IGGIGTVPVGR	11	Unmodified	_IGGIGTVPVGR_			0	0	0	P68104;Q5VTE0;Q05639	P68104	P68104	EEF1A1;EEF1A1P5;EEF1A2	Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3;Elongation factor 1-alpha 2	MULTI-MSMS	DP1141_8	3	513.3092041015625	2	513.308741	1024.60293	0.37949	0.0001948	0.12723	6.5309E-05	0.50672	0.0002601	513.3088453211163	17.323	0.5737	17.323	16.9	17.474	0					8	5	2	0	0	0	2.3605999999999997E-21	2	9656	9656;9883		170.3	105.73	1	63771000			1059	320	649	673	1419;1420	1419		9606
IGLAEEIR	8	Unmodified	_IGLAEEIR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	450.2659912109375	2	450.761092	899.507631	1.15	0.00051836	-1.0618	-0.00047861	0.088186	3.9751E-05	450.76085649233755	17.655	0.70041	17.655	17.505	18.205	0					14	6	3	0	0	0	0.00054136	1	9717	9717		133.81	31.039	1	984300000			1060	367	650	674	1421	1421		9606
IGPYQPNVPVGIDYVIPK	18	Unmodified	_IGPYQPNVPVGIDYVIPK_			0	0	0	P43243	P43243	P43243	MATR3	Matrin-3	MULTI-MSMS	DP1141_7	2	985.5455932617188	2	985.043301	1968.07205	0.61569	0.00060648	-0.062779	-6.184E-05	0.55291	0.00054464	985.544662339708	21.5	0.29983	21.5	21.25	21.55	0					6	2	3	0	0	0	0.00018162	1	16262	16262		105.66	74.063	1	25257000			1061	229	651	675	1422	1422		9606
IGSFGPGEDLLYLR	14	Unmodified	_IGSFGPGEDLLYLR_			0	0	0	O00763	O00763	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	768.9069213867188	2	768.906473	1535.79839	0.31177	0.00023972	0.45852	0.00035256	0.7703	0.00059229	768.9068507881093	21.968	0.42909	21.968	21.711	22.14	0					11	5	4	0	0	0	8.4685E-67	1	16449	16449		198.62	160.32	1	11415000			1062	40	652	676	1423	1423		9606
IGSFGPQEDLLFLR	14	Unmodified	_IGSFGPQEDLLFLR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_10	5	796.39892578125	2	796.427573	1590.84059	0.75847	0.00060407	0.43247	0.00034443	1.1909	0.0009485	796.9294729712848	22.644	0.25166	22.644	22.435	22.687	0					4	2	2	0	0	0	0.010697	1	18403	18403		111.86	86.617	1	10095000			1063	367	653	677	1424	1424		9606
IGSFGPQEDLLFLR	14	Unmodified	_IGSFGPQEDLLFLR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	796.4281616210938	2	796.427573	1590.84059	0.37087	0.00029537	-0.084746	-6.7494E-05	0.28612	0.00022787	796.4274688017396	22.645	0.53083	22.645	22.426	22.957	0					34	9	6	0	0	0	2.9186E-206	3	17374	17374;17380;17850		247.96	228.86	1	373560000			1064	367	653	677	1425;1426;1427	1425		9606
IGSFGPQEDLLFLR	14	Unmodified	_IGSFGPQEDLLFLR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	796.899169921875	2	796.427573	1590.84059	0.66957	0.00053326	-0.19526	-0.00015551	0.47431	0.00037775	796.4272828575298	22.622	0.32799	22.622	22.4	22.728	0					6	3	2	0	0	0	5.0813E-09	1	17973	17973		169.99	134.28	1	158950000			1065	367	653	677	1428	1428		9606
IGVLDEGK	8	Unmodified	_IGVLDEGK_			0	0	0	P46781	P46781	P46781	RPS9	40S ribosomal protein S9	MULTI-MSMS	DP1141_10	5	415.73486328125	2	415.734543	829.454533	0.5301	0.00022038	0.26241	0.00010909	0.79251	0.00032947	415.73456591927265	16.316	0.39442	16.316	16.066	16.46	0					7	3	3	0	0	0	0.0076826	1	8540	8540		107.59	18.224	1	96321000			1066	236	654	678	1429	1429		9606
IHEGCEEPATHNALAK	16	Unmodified	_IHEGCEEPATHNALAK_			0	0	0	Q00610	Q00610	Q00610	CLTC	Clathrin heavy chain 1	MULTI-MSMS	DP1141_6	1	592.9492797851562	3	592.949304	1775.82608	0.58443	0.00034654	-0.068907	-4.0859E-05	0.51553	0.00030568	592.9493657134001	13.847	0.55982	13.847	13.573	14.133	0					14	6	4	0	0	0	2.1888000000000002E-70	1	3885	3885		203.85	138.76	1	9819700			1067	336	655	679	1430	1430		9606
IHEGCEEPATHNALAK	16	Unmodified	_IHEGCEEPATHNALAK_			0	0	0	Q00610	Q00610	Q00610	CLTC	Clathrin heavy chain 1	MULTI-MSMS	DP1141_7	2	593.2838745117188	3	592.949304	1775.82608	0.88648	0.00052564	-0.36534	-0.00021663	0.52114	0.00030901	593.2835226554871	13.752	0.24156	13.752	13.62	13.861	0					6	2	3	0	0	0	0.0049123	1	4286	4286		90.707	69.474	1	4400400			1068	336	655	679	1431	1431		9606
IHFPLATYAPVISAEK	16	Unmodified	_IHFPLATYAPVISAEK_			0	0	0	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_10	5	586.6609497070312	3	586.325929	1755.95596	1.0572	0.00061987	-0.53566	-0.00031407	0.52155	0.0003058	586.3257181493083	20.426	0.79961	20.426	19.776	20.576	0					17	7	3	0	0	0	0.0016073	2	14995	14718;14995		95.067	65.938	1	58302000			1069	321;442;322	656	680	1432;1433	1433		9606
IHFPLATYAPVISAEK	16	Unmodified	_IHFPLATYAPVISAEK_			0	0	0	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_6	1	586.6604614257812	3	586.325929	1755.95596	0.91716	0.00053775	-0.060953	-3.5738E-05	0.85621	0.00050202	586.3258963763259	20.438	0.67587	20.438	19.906	20.582	0					14	6	3	0	0	0	7.4551E-06	2	14142	13983;14142		134.81	111.17	1	11518000			1070	321;442;322	656	680	1434;1435	1435		9606
IHFPLATYAPVISAEK	16	Unmodified	_IHFPLATYAPVISAEK_			0	0	0	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_6	1	878.9847412109375	2	878.985255	1755.95596	0.69268	0.00060886	0.099226	8.7218E-05	0.79191	0.00069607	878.9851165114213	20.438	0.58365	20.438	19.998	20.582	0					7	5	2	0	0	0	0.0023132	1	14201	14201		123.31	75.602	1	3883800			1071	321;442;322	656	680	1436	1436		9606
IHFPLATYAPVISAEK	16	Unmodified	_IHFPLATYAPVISAEK_			0	0	0	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_7	2	586.7756958007812	3	586.325929	1755.95596	0.8783	0.00051497	-0.0036846	-2.1604E-06	0.87462	0.00051281	586.326250072038	20.401	0.7007	20.401	19.85	20.551	0					15	6	3	0	0	0	0.0011098	2	14678	14613;14678		88.108	63.653	1	20729000			1072	321;442;322	656	680	1437;1438	1438		9606
IHFPLATYAPVISAEK	16	Unmodified	_IHFPLATYAPVISAEK_			0	0	0	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_8	3	878.9889526367188	2	878.985255	1755.95596	0.48606	0.00042724	0.23933	0.00021036	0.72538	0.0006376	879.4869752869012	20.427	0.80114	20.427	19.777	20.578	0					25	7	5	0	0	0	0.0034827	3	14076	13764;14076;14088		111.91	79.845	1	142610000			1073	321;442;322	656	680	1439;1440;1441	1440		9606
IHFPLATYAPVISAEK	16	Unmodified	_IHFPLATYAPVISAEK_			0	0	0	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_8	3	585.9623413085938	3	586.325929	1755.95596	0.23981	0.0001406	0.29222	0.00017133	0.53202	0.00031194	586.3261953408572	20.427	1.1021	20.427	19.576	20.678	0					39	10	6	0	0	0	0.00092994	3	14557	14054;14197;14557		123.29	92.202	1	367520000			1074	321;442;322	656	680	1442;1443;1444	1444		9606
IHFPLATYAPVISAEK	16	Unmodified	_IHFPLATYAPVISAEK_			0	0	0	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_9	4	586.6602783203125	3	586.325929	1755.95596	0.45225	0.00026517	-0.039983	-2.3443E-05	0.41227	0.00024172	586.3258990161648	20.387	0.79777	20.387	19.739	20.536	0					19	7	3	0	0	0	0.0019942	3	14323	14028;14168;14323		116.58	79.946	1	88191000			1075	321;442;322	656	680	1445;1446;1447	1447		9606
IHNANPELTDGQIQAMLR	18	Oxidation (M)	_IHNANPELTDGQIQAM(Oxidation (M))LR_	IHNANPELTDGQIQAM(1)LR	IHNANPELTDGQIQAM(120)LR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	1019.5146484375	2	1019.01274	2036.01092	0.28372	0.00028912	0.13852	0.00014116	0.42225	0.00043027	1019.5145271021627	17.555	0.50142	17.555	17.204	17.705	0					6	4	2	0	0	0	0.00063315	1	9723	9723		117.27	103.94	1	18354000			1076	367	657	681	1448	1448	270	9606
IHNANPELTDGQIQAMLR	18	Oxidation (M)	_IHNANPELTDGQIQAM(Oxidation (M))LR_	IHNANPELTDGQIQAM(1)LR	IHNANPELTDGQIQAM(150)LR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	678.9641723632812	3	679.677584	2036.01092	1.4506	0.00098594	-1.0933	-0.00074312	0.35725	0.00024282	680.0112433996059	17.555	0.90212	17.555	17.103	18.005	0					19	8	4	0	0	0	4.0481E-23	1	9527	9527		154.47	133.53	1	179540000			1077	367	657	681	1449	1449	270	9606
IHNANPELTDGQIQAMLR	18	Unmodified	_IHNANPELTDGQIQAMLR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_9	4	675.4087524414062	3	674.345946	2020.01601	0.41828	0.00028207	-0.15475	-0.00010435	0.26353	0.00017771	674.3461411163	19.188	0.60156	19.188	19.037	19.639	0					8	5	3	0	0	0	0.00031857	1	12718	12718		117.13	101.5	1	14730000			1078	367	657	682	1450	1450		9606
IHTGEKPYECVQCGK	15	Unmodified	_IHTGEKPYECVQCGK_			0	0	1	P17028	P17028	P17028	ZNF24	Zinc finger protein 24	MULTI-MSMS	DP1141_9	4	603.3065185546875	3	602.615156	1804.82364	-0.067558	-4.0711E-05	0.62149	0.00037452	0.55394	0.00033381	602.6155746486465	14.28	0.39415	14.28	13.994	14.388	0					8	5	3	0	0	0	0.0094884	1	4686	4686		120.9	1.7272	1	12227000			1079	160	658	683	1451	1451		9606
IIDEVVNK	8	Unmodified	_IIDEVVNK_			0	0	0	O95816	O95816	O95816	BAG2	BAG family molecular chaperone regulator 2	MULTI-MSMS	DP1141_10	5	465.268798828125	2	465.26875	928.522947	0.021022	9.781E-06	0.30255	0.00014077	0.32358	0.00015055	465.268812703794	15.56	0.69816	15.56	15.368	16.066	0					14	7	3	0	0	0	1.8381E-22	1	7257	7257		175.75	57.067	1	106460000			1080	95	659	684	1452	1452		9606
IIDFLSALEGFK	12	Unmodified	_IIDFLSALEGFK_			0	0	0	P52701	P52701	P52701	MSH6	DNA mismatch repair protein Msh6	MULTI-MSMS	DP1141_7	2	676.8772583007812	2	676.876653	1351.73875	0.46151	0.00031238	0.3027	0.00020489	0.7642	0.00051727	676.8768039959906	24.603	0.25546	24.603	24.48	24.735	0					4	2	2	0	0	0	0.028249	1	20955	20955		75.294	24.235	1	7417300			1081	268	660	685	1453	1453		9606
IIDPLPPIDHSEIDYPPFEK	20	Unmodified	_IIDPLPPIDHSEIDYPPFEK_			0	0	0	Q86XP3	Q86XP3	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	MULTI-MSMS	DP1141_7	2	779.401123046875	3	779.066731	2334.17836	0.89245	0.00069528	-0.18801	-0.00014647	0.70444	0.00054881	779.400758452154	21.167	0.79936	21.167	20.85	21.65	0					26	7	5	0	0	0	3.2432E-06	3	15812	15565;15676;15812		113.86	88.032	1	47467000			1082	460	661	686	1454;1455;1456	1456		9606
IIDPLPPIDHSEIDYPPFEK	20	Unmodified	_IIDPLPPIDHSEIDYPPFEK_			0	0	0	Q86XP3	Q86XP3	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	MULTI-MSMS	DP1141_8	3	779.3575439453125	3	779.066731	2334.17836	0.35232	0.00027448	0.80815	0.0006296	1.1605	0.00090408	779.401347100857	21.204	0.60091	21.204	20.878	21.479	0					12	5	4	0	0	0	0.014339	1	15609	15609		61.757	30.242	1	8696600			1083	460	661	686	1457	1457		9606
IIDPLPPIDHSEIDYPPFEK	20	Unmodified	_IIDPLPPIDHSEIDYPPFEK_			0	0	0	Q86XP3	Q86XP3	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	MULTI-MSMS	DP1141_9	4	779.4017944335938	3	779.066731	2334.17836	0.84709	0.00065994	0.091466	7.1258E-05	0.93856	0.0007312	779.4011595155011	21.118	0.50072	21.118	20.937	21.438	0					6	4	2	0	0	0	0.011084	1	15725	15725		65.784	29.741	1	3235100			1084	460	661	686	1458	1458		9606
IIEDQQESLNK	11	Unmodified	_IIEDQQESLNK_			0	0	0	P05455	P05455	P05455	SSB	Lupus La protein	MULTI-MSMS	DP1141_8	3	659.6767578125	2	658.838256	1315.66196	1.1418	0.00075226	-0.773	-0.00050928	0.3688	0.00024298	658.8374567200551	15.221	0.39803	15.221	14.873	15.271	0					5	3	2	0	0	0	4.149E-66	1	6262	6262		200.54	104.05	1	7957800			1085	116	662	687	1459	1459		9606
IIEEAPAPGIK	11	Unmodified	_IIEEAPAPGIK_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	569.7640991210938	2	569.329339	1136.64412	0.21485	0.00012232	0.12844	7.3126E-05	0.3433	0.00019545	569.3293441203969	16.555	0.42397	16.555	16.305	16.729	0					11	4	3	0	0	0	0.0035114	2	7857	7857;7963		128.36	100.14	1	177580000			1086	521	663	688	1460;1461	1460		9606
IIEEAPAPGIK	11	Unmodified	_IIEEAPAPGIK_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-SECPEP	DP1141_7	2	569.2330932617188	2	569.329339	1136.64412	0.62419	0.00035537	-0.43731	-0.00024897	0.18689	0.0001064	569.3290872182841	16.465	0.32968	16.465	16.315	16.644	0					7	3	3	0	0	0	4.8634E-05	1	8464	8464		146.79	110.34	1	135140000			1087	521	663	688	1462	1462		9606
IIEEAPAPGIK	11	Unmodified	_IIEEAPAPGIK_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	569.3294677734375	2	569.329339	1136.64412	-0.50042	-0.00028491	0.46794	0.00026641	-0.032488	-1.8496E-05	569.3295973502962	16.513	0.45487	16.513	16.276	16.731	0					8	4	2	0	0	0	0.0055655	2	8487	8267;8487		115.7	80.343	1	1961599999.9999998			1088	521	663	688	1463;1464	1464		9606
IIEEAPATIATPAVFEHMEQCAVK	24	Oxidation (M)	_IIEEAPATIATPAVFEHM(Oxidation (M))EQCAVK_	IIEEAPATIATPAVFEHM(1)EQCAVK	IIEEAPATIATPAVFEHM(110)EQCAVK	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	891.4435424804688	3	891.108385	2670.30332	0.42418	0.00037799	-0.20763	-0.00018502	0.21656	0.00019297	891.4427496961795	19.355	0.60035	19.355	19.105	19.706	0					14	5	4	0	0	0	1.0337E-10	1	12456	12456		111.44	92.679	1	103050000			1089	367	664	689	1465	1465	271	9606
IIEEAPATIATPAVFEHMEQCAVK	24	Unmodified	_IIEEAPATIATPAVFEHMEQCAVK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	886.1121215820312	3	885.776746	2654.30841	0.70005	0.00062009	0.0085807	7.6006E-06	0.70864	0.00062769	886.1111379307067	20.814	0.46451	20.814	20.582	21.046	0					13	4	5	0	0	0	4.8317E-12	3	14724	14495;14724;14820		151.21	135.69	1	31743000			1090	367	664	690	1466;1467;1468	1467		9606
IIEFVPTK	8	Unmodified	_IIEFVPTK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	473.7723083496094	2	473.784036	945.553519	0.78974	0.00037416	-0.67877	-0.00032159	0.11096	5.2572E-05	473.7838094847417	18.355	1.1004	18.355	18.205	19.305	0					21	10	4	0	0	0	0.00034618	2	10786	10786;11003		126.28	44.897	1	752780000			1091	367	665	691	1469;1470	1469		9606
IIEFVPTK	8	Unmodified	_IIEFVPTK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	946.4990844726562	1	946.560795	945.553519	0.50262	0.00047576	0.0010391	9.8355E-07	0.50366	0.00047674	946.5607882802932	18.355	0.29947	18.355	18.205	18.504	0					4	2	2	0	0	0	9.424800000000001E-30	1	10942	10942		180.93	80.86	1	50393000			1092	367	665	691	1471	1471		9606
IIEFVPTK	8	Unmodified	_IIEFVPTK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_8	3	473.2521667480469	2	473.784036	945.553519	0.52298	0.00024778	-0.20732	-9.8225E-05	0.31566	0.00014956	473.783928151246	18.325	0.49998	18.325	18.175	18.675	0					8	4	3	0	0	0	0.034243	1	11420	11420		96.253	21.918	1	55019000			1093	367	665	691	1472	1472		9606
IIGVHQEDELLECLSPATSR	20	Unmodified	_IIGVHQEDELLECLSPATSR_			0	0	0	Q93009	Q93009	Q93009	USP7	Ubiquitin carboxyl-terminal hydrolase 7	MULTI-MSMS	DP1141_7	2	756.0563354492188	3	756.382725	2266.12635	1.0993	0.00083149	-0.33928	-0.00025662	0.76002	0.00057486	756.3821138350221	20.401	0.50022	20.401	20.15	20.651	0					14	4	4	0	0	0	0.012172	2	14646	14646;14805		64.203	45.247	1	27397000			1094	501	666	692	1473;1474	1473		9606
IIGVHQEDELLECLSPATSR	20	Unmodified	_IIGVHQEDELLECLSPATSR_			0	0	0	Q93009	Q93009	Q93009	USP7	Ubiquitin carboxyl-terminal hydrolase 7	MULTI-MSMS	DP1141_8	3	757.0521850585938	3	756.382725	2266.12635	0.61427	0.00046463	2.0699	0.0015657	2.6842	0.0020303	756.3845687553473	20.327	0.50158	20.327	20.176	20.678	0					9	4	3	0	0	0	0.024313	1	14520	14520		55.763	37.308	1	78545000			1095	501	666	692	1475	1475		9606
IILDLISESPIK	12	Unmodified	_IILDLISESPIK_			0	0	0	P61978	P61978	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	MULTI-MSMS	DP1141_10	5	671.3984985351562	2	670.905411	1339.79627	0.42018	0.0002819	0.23569	0.00015812	0.65587	0.00044003	670.9056398834957	21.909	0.29969	21.909	21.659	21.959	0					4	2	2	0	0	0	0.0035945	1	17171	17171		121.6	75.923	1	10951000			1096	284	667	693	1476	1476		9606
IILDLISESPIK	12	Unmodified	_IILDLISESPIK_			0	0	0	P61978	P61978	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	MULTI-MSMS	DP1141_8	3	671.010498046875	2	670.905411	1339.79627	0.56463	0.00037881	0.16554	0.00011106	0.73017	0.00048987	670.90549620003	21.929	0.39952	21.929	21.679	22.079	0					10	3	4	0	0	0	1.7771E-113	4	16664	16489;16664;16693;16714		221.68	221.68	1	71960000			1097	284	667	693	1477;1478;1479;1480	1478		9606
IILDLISESPIK	12	Unmodified	_IILDLISESPIK_			0	0	0	P61978	P61978	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	MULTI-MSMS	DP1141_9	4	670.9047241210938	2	670.905411	1339.79627	0.52508	0.00035228	1.1889	0.00079764	1.714	0.0011499	670.9060582567122	21.882	0.3896	21.882	21.639	22.029	0					7	3	3	0	0	0	2.0222E-06	2	16795	16795;16846		153.97	96.923	1	10169000			1098	284	667	693	1481;1482	1481		9606
IINEPTAAAIAYGLDKK	17	Unmodified	_IINEPTAAAIAYGLDKK_			0	0	1	P11142;P54652	P11142	P11142	HSPA8;HSPA2	Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2	MULTI-SECPEP	DP1141_8	3	597.3201293945312	3	596.668243	1786.9829	0.5826	0.00034762	0.50424	0.00030087	1.0868	0.00064848	596.6686503406646	19.125	0.2993	19.125	18.976	19.275	0					6	2	3	0	0	0	0.00094455	1	12471	12471		83.253	54.704	1	552210000			1099	140	668	694	1483	1483		9606
IINEPTAAAIAYGLDKK	17	Unmodified	_IINEPTAAAIAYGLDKK_			0	0	1	P11142;P54652	P11142	P11142	HSPA8;HSPA2	Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2	MULTI-MSMS	DP1141_9	4	596.8143310546875	3	596.668243	1786.9829	0.20127	0.00012009	0.40535	0.00024186	0.60663	0.00036196	597.0028722630984	19.161	0.30089	19.161	18.937	19.238	0					8	2	4	0	0	0	0.023006	1	12534	12534		69.188	46.697	1	11048000			1100	140	668	694	1484	1484		9606
IINEPTAAAIAYGLDKR	17	Unmodified	_IINEPTAAAIAYGLDKR_			0	0	1	P11021	P11021	P11021	HSPA5	78 kDa glucose-regulated protein	MSMS	DP1141_8	3	606.0040283203125	3	606.003626	1814.98905	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.43	1	19.43	18.93	19.93	0								0	0	0	0.02068	1	12990	12990		59.606	32.109	1				1101	139	669	695	1485	1485		9606
IINEPTAAAIAYGLDR	16	Unmodified	_IINEPTAAAIAYGLDR_			0	0	0	P0DMV8;P0DMV9;P17066	P0DMV8;P17066	P0DMV8	HSPA1A;HSPA1B;HSPA6	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 6	MULTI-MSMS	DP1141_8	3	844.4649047851562	2	844.454319	1686.89408	0.72082	0.0006087	-0.66966	-0.0005655	0.051153	4.3197E-05	844.9545945656831	20.063	0.50056	20.063	19.877	20.377	0					7	4	3	0	0	0	0.0016315	1	13906	13906		118.37	69.386	1	6211000			1102	135;161	670	696	1486	1486		9606
IINEPTAAAIAYGLDR	16	Unmodified	_IINEPTAAAIAYGLDR_			0	0	0	P0DMV8;P0DMV9;P17066	P0DMV8;P17066	P0DMV8	HSPA1A;HSPA1B;HSPA6	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 6	MULTI-MSMS	DP1141_8	3	563.334716796875	3	563.305305	1686.89408	-0.14025	-7.9004E-05	0.8608	0.0004849	0.72055	0.00040589	563.3058213075132	20.527	0.40074	20.527	20.377	20.778	0					5	3	2	0	0	0	1.4572E-09	2	14665	14577;14665		135.23	109.5	1	535440000			1103	135;161	670	696	1487;1488	1488		9606
IINEPTAAAIAYGLDR	16	Unmodified	_IINEPTAAAIAYGLDR_			0	0	0	P0DMV8;P0DMV9;P17066	P0DMV8;P17066	P0DMV8	HSPA1A;HSPA1B;HSPA6	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 6	MULTI-SECPEP	DP1141_8	3	843.926025390625	2	844.454319	1686.89408	0.68212	0.00057602	-0.045533	-3.845E-05	0.63659	0.00053757	844.454667183959	20.527	1.1021	20.527	20.277	21.379	0					16	10	3	0	0	0	5.3882E-17	1	14758	14758		158.25	82.026	1	2507800000			1104	135;161	670	696	1489	1489		9606
IINEPTAAAIAYGLDR	16	Unmodified	_IINEPTAAAIAYGLDR_			0	0	0	P0DMV8;P0DMV9;P17066	P0DMV8;P17066	P0DMV8	HSPA1A;HSPA1B;HSPA6	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 6	MULTI-MSMS	DP1141_9	4	563.3351440429688	3	563.305305	1686.89408	0.2493	0.00014043	0.35789	0.0002016	0.60719	0.00034203	563.6395006588382	20.486	0.59926	20.486	20.037	20.636	0					8	5	3	0	0	0	0.00091282	2	14606	14579;14606		102.38	70.852	1	8089200			1105	135;161	670	696	1490;1491	1491		9606
IINEPTAAAIAYGLDR	16	Unmodified	_IINEPTAAAIAYGLDR_			0	0	0	P0DMV8;P0DMV9;P17066	P0DMV8;P17066	P0DMV8	HSPA1A;HSPA1B;HSPA6	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 6	MSMS	DP1141_9	4	844.0772094726562	2	844.454319	1686.89408	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.541	1	20.541	20.041	21.041	0								0	0	0	0	1	14681	14681		257.2	165.61	1				1106	135;161	670	696	1492	1492		9606
IIPLYSTLPPQQQQR	15	Unmodified	_IIPLYSTLPPQQQQR_			0	0	0	O43143	O43143	O43143	DHX15	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15	MULTI-MSMS	DP1141_8	3	891.4287719726562	2	891.499061	1780.98357	0.62554	0.00055767	-0.57888	-0.00051607	0.04666	4.1597E-05	891.9998312476025	19.225	0.29982	19.225	19.075	19.375	0					4	2	2	0	0	0	0.029363	1	12769	12769		63.473	20.844	1	6559700			1107	54	671	697	1493	1493		9606
IIQQAGQVWFPDSAFK	16	Unmodified	_IIQQAGQVWFPDSAFK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	918.4934692382812	2	917.977961	1833.94137	0.49373	0.00045323	-0.099423	-9.1268E-05	0.3943	0.00036196	918.4792455197404	21.335	0.66459	21.335	21.046	21.711	0					24	7	6	0	0	0	6.6963E-55	2	15445	15445;15466		239.48	209.34	1	212290000			1108	367	672	698	1494;1495	1494		9606
IIQQAGQVWFPDSAFK	16	Unmodified	_IIQQAGQVWFPDSAFK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	612.3211059570312	3	612.321066	1833.94137	1.1051	0.00067665	-0.50569	-0.00030964	0.59938	0.00036701	612.6550519844558	21.335	0.34422	21.335	21.126	21.47	0					10	3	4	0	0	0	3.201E-31	2	15552	15527;15552		178.67	146.89	1	12663000			1109	367	672	698	1496;1497	1497		9606
IIQQAGQVWFPDSAFK	16	Unmodified	_IIQQAGQVWFPDSAFK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_9	4	917.4706420898438	2	917.977961	1833.94137	0.8164	0.00074944	-0.54252	-0.00049802	0.27389	0.00025142	918.4788672507972	21.388	0.40082	21.388	21.138	21.538	0					6	3	2	0	0	0	1.685E-134	1	15919	15919		287.29	236.81	1	170200000			1110	367	672	698	1498	1498		9606
IITHPNFNGNTLDNDIMLIK	20	Oxidation (M)	_IITHPNFNGNTLDNDIM(Oxidation (M))LIK_	IITHPNFNGNTLDNDIM(1)LIK	IITHPNFNGNTLDNDIM(100)LIK	0	1	0	CON__P00761	CON__P00761	CON__P00761			MULTI-MSMS	DP1141_8	3	767.4306640625	3	767.063215	2298.16782	0.50155	0.00038472	0.022992	1.7637E-05	0.52454	0.00040236	767.3975395099377	20.126	0.40063	20.126	19.976	20.377	0					5	3	2	0	0	0	3.9706E-05	1	14049	14049		101.49	84.777	1	63040000		+	1111	8	673	699	1499	1499	8	
IITHPNFNGNTLDNDIMLIK	20	Unmodified	_IITHPNFNGNTLDNDIMLIK_			0	0	0	CON__P00761	CON__P00761	CON__P00761			MSMS	DP1141_8	3	761.8483276367188	3	761.731577	2282.1729	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.657	1	20.657	20.157	21.157	0								0	0	0	0.0089379	1	14811	14811		104.03	51.096	1			+	1112	8	673	700	1500	1500		
IITITGTQDQIQNAQYLLQNSVK	23	Unmodified	_IITITGTQDQIQNAQYLLQNSVK_			0	0	0	P61978	P61978	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	MULTI-MSMS	DP1141_8	3	864.9669799804688	3	863.800937	2588.38098	0.6774	0.00058514	-0.54427	-0.00047014	0.13312	0.00011499	864.1352144244653	22.129	0.59989	22.129	21.579	22.179	0					9	5	3	0	0	0	7.4527E-09	2	16922	16922;17010		112.57	80.003	1	25118000			1113	284	674	701	1501;1502	1501		9606
IIVGDATEKDASK	13	Unmodified	_IIVGDATEKDASK_			0	0	1	Q96I25	Q96I25	Q96I25	RBM17	Splicing factor 45	MULTI-MSMS	DP1141_8	3	449.5768127441406	3	449.576913	1345.70891	-0.075341	-3.3871E-05	0.52734	0.00023708	0.452	0.00020321	449.5768870094935	14.397	0.72274	14.397	14.05	14.772	0					20	8	4	0	0	0	0.0020796	2	5175	5170;5175		118.76	69.112	1	100170000			1114	513	675	702	1503;1504	1504		9606
IIVGDATEKDASK	13	Unmodified	_IIVGDATEKDASK_			0	0	1	Q96I25	Q96I25	Q96I25	RBM17	Splicing factor 45	MULTI-MSMS	DP1141_9	4	449.5769348144531	3	449.576913	1345.70891	-0.27664	-0.00012437	0.59923	0.0002694	0.32259	0.00014503	449.5770330936498	14.432	0.49894	14.432	14.053	14.552	0					12	6	3	0	0	0	0.0024822	1	4961	4961		165.35	118.95	1	19767000			1115	513	675	702	1505	1505		9606
IKDEPDNAQEYSHGQQQK	18	Unmodified	_IKDEPDNAQEYSHGQQQK_			0	0	1	Q5VZL5	Q5VZL5	Q5VZL5	ZMYM4	Zinc finger MYM-type protein 4	MULTI-MSMS	DP1141_8	3	705.9983520507812	3	705.662768	2113.96647	0.44447	0.00031365	0.5237	0.00036956	0.96818	0.00068321	705.9973308882048	13.493	0.29926	13.493	13.288	13.587	0					9	3	3	0	0	0	0.018553	2	3763	3763;3815		93.427	65.84	1	1187600			1116	427	676	703	1506;1507	1506		9606
IKFEMEQNLR	10	Oxidation (M)	_IKFEM(Oxidation (M))EQNLR_	IKFEM(1)EQNLR	IKFEM(110)EQNLR	0	1	1	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_6	1	662.3405151367188	2	662.339912	1322.66527	0.30792	0.00020395	0.37205	0.00024642	0.67997	0.00045037	662.3402215452828	15.955	0.30117	15.955	15.804	16.105	0					8	2	4	0	0	0	0.026422	1	7058	7058		114.89	80.973	1	46384000		+	1117	19	677	704	1508	1508	18	9606
IKFEMEQNLR	10	Oxidation (M)	_IKFEM(Oxidation (M))EQNLR_	IKFEM(1)EQNLR	IKFEM(54)EQNLR	0	1	1	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-SECPEP	DP1141_6	1	441.7557067871094	3	441.8957	1322.66527	0.69104	0.00030537	-0.43891	-0.00019395	0.25213	0.00011141	441.8955937658172	15.955	0.59702	15.955	15.708	16.305	0					12	5	4	0	0	0	0.0089459	1	6930	6930		53.597	20.407	1	111880000		+	1118	19	677	704	1509	1509	18	9606
IKFEMEQNLR	10	Oxidation (M)	_IKFEM(Oxidation (M))EQNLR_	IKFEM(1)EQNLR	IKFEM(110)EQNLR	0	1	1	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-SECPEP	DP1141_7	2	441.2119140625	3	441.8957	1322.66527	0.55243	0.00024412	-0.039095	-1.7276E-05	0.51333	0.00022684	441.8957118784921	15.964	0.5	15.964	15.815	16.315	0					7	4	3	0	0	0	0.00089408	1	7463	7463		112.11	79.889	1	258300000		+	1119	19	677	704	1510	1510	18	9606
IKFEMEQNLR	10	Oxidation (M)	_IKFEM(Oxidation (M))EQNLR_	IKFEM(1)EQNLR	IKFEM(120)EQNLR	0	1	1	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_8	3	442.24560546875	3	441.8957	1322.66527	-0.063367	-2.8002E-05	0.24754	0.00010939	0.18418	8.1387E-05	441.8958732439866	15.926	0.30025	15.926	15.776	16.076	0					6	2	3	0	0	0	0.0082026	1	7497	7497		117.71	81.798	1	66018000		+	1120	19	677	704	1511	1511	18	9606
IKFEMEQNLR	10	Oxidation (M)	_IKFEM(Oxidation (M))EQNLR_	IKFEM(1)EQNLR	IKFEM(110)EQNLR	0	1	1	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_9	4	441.89581298828125	3	441.8957	1322.66527	-0.12823	-5.6666E-05	0.2843	0.00012563	0.15606	6.8963E-05	441.8958849924798	15.925	0.78535	15.925	15.573	16.358	0					13	7	4	0	0	0	0.0054991	1	7467	7467		112.3	76.643	1	67614000		+	1121	19	677	704	1512	1512	18	9606
IKFEMEQNLR	10	Oxidation (M)	_IKFEM(Oxidation (M))EQNLR_	IKFEM(1)EQNLR	IKFEM(93)EQNLR	0	1	1	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-SECPEP	DP1141_9	4	662.34033203125	2	662.339912	1322.66527	1.0244	0.0006785	-0.52235	-0.00034598	0.50204	0.00033252	662.3396681678922	16.003	0.38572	16.003	15.772	16.158	0					11	3	5	0	0	0	0.018565	1	7480	7480		93.162	62.908	1	34584000		+	1122	19	677	704	1513	1513	18	9606
IKFEMEQNLR	10	Unmodified	_IKFEMEQNLR_			0	0	1	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-SECPEP	DP1141_9	4	437.2679443359375	3	436.564062	1306.67036	0.022163	9.6754E-06	0.31354	0.00013688	0.3357	0.00014656	436.5641266175096	17.588	0.49986	17.588	17.338	17.837	0					10	4	3	0	0	0	0.030082	1	10117	10117		136.52	67.889	1	16064000		+	1123	19	677	705	1514	1514		9606
IKYPENFFLLR	11	Unmodified	_IKYPENFFLLR_			0	0	1	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_10	5	480.6064147949219	3	480.606367	1438.79727	0.83589	0.00040173	-0.25059	-0.00012044	0.5853	0.0002813	480.6062479081958	20.725	0.59937	20.725	20.376	20.975	0					14	5	4	0	0	0	1.0675E-30	2	15608	15608;15683		165.63	148.5	1	217440000			1124	286;212;287	678	706	1515;1516	1515		9606
IKYPENFFLLR	11	Unmodified	_IKYPENFFLLR_			0	0	1	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-SECPEP	DP1141_10	5	720.3618774414062	2	720.405912	1438.79727	1.5031	0.0010829	-0.12158	-8.7588E-05	1.3815	0.00099527	720.406042006083	20.725	0.49956	20.725	20.476	20.975	0					12	4	4	0	0	0	0.0073884	1	15624	15624		98.582	40.336	1	68139000			1125	286;212;287	678	706	1517	1517		9606
IKYPENFFLLR	11	Unmodified	_IKYPENFFLLR_			0	0	1	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_6	1	480.6066589355469	3	480.606367	1438.79727	0.66694	0.00032053	-0.15485	-7.4421E-05	0.51209	0.00024611	480.6062403977227	20.808	0.56461	20.808	20.39	20.954	0					13	5	4	0	0	0	0.014039	1	14678	14678		123.62	101.56	1	18273000			1126	286;212;287	678	706	1518	1518		9606
IKYPENFFLLR	11	Unmodified	_IKYPENFFLLR_			0	0	1	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_7	2	480.6064453125	3	480.606367	1438.79727	0.75108	0.00036097	-0.39395	-0.00018933	0.35713	0.00017164	480.60609728613673	20.7	0.39962	20.7	20.551	20.95	0					13	3	5	0	0	0	0.026172	1	15221	15221		80.737	52.454	1	102210000			1127	286;212;287	678	706	1519	1519		9606
IKYPENFFLLR	11	Unmodified	_IKYPENFFLLR_			0	0	1	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_8	3	480.6069030761719	3	480.606367	1438.79727	0.49904	0.00023984	-0.076067	-3.6558E-05	0.42297	0.00020328	480.6065814721342	20.728	0.9015	20.728	20.477	21.379	0					27	8	6	0	0	0	0.0060553	2	15063	14927;15063		132.17	99.083	1	1252500000			1128	286;212;287	678	706	1520;1521	1521		9606
IKYPENFFLLR	11	Unmodified	_IKYPENFFLLR_			0	0	1	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_8	3	720.40673828125	2	720.405912	1438.79727	0.094822	6.8311E-05	0.69941	0.00050386	0.79423	0.00057217	720.4064063544656	20.728	0.70102	20.728	20.277	20.978	0					19	6	5	0	0	0	0.00023024	1	14949	14949		150.27	150.27	1	509370000			1129	286;212;287	678	706	1522	1522		9606
IKYPENFFLLR	11	Unmodified	_IKYPENFFLLR_			0	0	1	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_9	4	480.6069030761719	3	480.606367	1438.79727	0.35013	0.00016828	0.22639	0.00010881	0.57653	0.00027708	480.606692260777	20.687	0.7011	20.687	20.437	21.138	0					11	6	2	0	0	0	0.00014128	1	15052	15052		141.89	119.1	1	924980000			1130	286;212;287	678	706	1523	1523		9606
ILELLRPDPNTGK	13	Unmodified	_ILELLRPDPNTGK_			0	0	1	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	733.3816528320312	2	733.422291	1464.83003	0.60703	0.00044521	0.12132	8.8982E-05	0.72836	0.00053419	733.4221684453765	18.362	0.39944	18.362	18.205	18.604	0					9	3	4	0	0	0	1.4193999999999999E-39	1	10951	10951		171.49	111.09	1	15091000			1131	402	679	707	1524	1524		9606
ILELLRPDPNTGK	13	Unmodified	_ILELLRPDPNTGK_			0	0	1	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	489.28302001953125	3	489.283953	1464.83003	0.83703	0.00040954	-0.61155	-0.00029922	0.22548	0.00011032	489.2836014735069	18.454	0.59958	18.454	18.105	18.705	0					16	5	4	0	0	0	0.018538	1	10979	10979		103.14	45.095	1	63654000			1132	402	679	707	1525	1525		9606
ILELLRPDPNTGK	13	Unmodified	_ILELLRPDPNTGK_			0	0	1	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_7	2	489.2840881347656	3	489.283953	1464.83003	0.14239	6.9668E-05	0.2458	0.00012027	0.38819	0.00018994	489.2840357345956	18.401	0.50061	18.401	18.049	18.55	0					11	4	4	0	0	0	0.018681	1	11572	11572		102.62	47.581	1	162690000			1133	402	679	707	1526	1526		9606
ILEMNDKYVK	10	Oxidation (M)	_ILEM(Oxidation (M))NDKYVK_	ILEM(1)NDKYVK	ILEM(82)NDKYVK	0	1	1	Q14149	Q14149	Q14149	MORC3	MORC family CW-type zinc finger protein 3	MSMS	DP1141_8	3	423.55804443359375	3	423.556684	1267.64822	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.893	1	14.893	14.393	15.393	0								0	0	0	0.018143	1	5784	5784		81.525	24.376	1				1134	382	680	708	1527	1527	299	9606
ILGADTSVDLEETGR	15	Unmodified	_ILGADTSVDLEETGR_			0	0	0	P25705	P25705	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_10	5	788.8486328125	2	788.396667	1574.77878	0.57181	0.00045081	-0.454	-0.00035793	0.11781	9.2882E-05	788.3962146813686	18.687	0.28973	18.687	18.487	18.777	0					4	2	2	0	0	0	3.0437E-69	1	12393	12393		203.03	159.4	1	6306300			1135	187	681	709	1528	1528		9606
ILGTPDYLAPELLLGR	16	Unmodified	_ILGTPDYLAPELLLGR_			0	0	0	Q96GX5	Q96GX5	Q96GX5	MASTL	Serine/threonine-protein kinase greatwall	MULTI-MSMS	DP1141_10	5	870.9992065429688	2	870.998362	1739.98217	0.43966	0.00038294	0.61343	0.00053429	1.0531	0.00091723	870.9989277465118	23.402	0.17835	23.402	23.301	23.479	0					4	2	2	0	0	0	0.02286	1	19592	19592		74.392	56.058	1	4823800			1136	512	682	710	1529	1529		9606
ILLAELEQLKGQGK	14	Unmodified	_ILLAELEQLKGQGK_			0	0	1	P08670	P08670	P08670	VIM	Vimentin	MULTI-SECPEP	DP1141_8	3	514.3007202148438	3	513.975007	1538.90319	0.52948	0.00027214	-0.15915	-8.1797E-05	0.37034	0.00019034	513.9749067484198	19.526	0.30096	19.526	19.375	19.676	0					4	2	2	0	0	0	0.00079837	1	13153	13153		121.68	78.178	1	75331000			1137	127	683	711	1530	1530		9606
ILMEHIHK	8	Unmodified	_ILMEHIHK_			0	0	0	P84098	P84098	P84098	RPL19	60S ribosomal protein L19	MULTI-SECPEP	DP1141_10	5	510.8963317871094	2	510.786587	1019.55862	0.20728	0.00010588	0.38527	0.00019679	0.59255	0.00030267	510.7866299747886	14.631	0.1968	14.631	14.539	14.736	0					4	2	2	0	0	0	0.027408	1	5808	5808		98.418	31.619	1	2587300			1138	332	684	712	1531	1531		9606
ILNEMRDQYEK	11	Oxidation (M)	_ILNEM(Oxidation (M))RDQYEK_	ILNEM(1)RDQYEK	ILNEM(86)RDQYEK	0	1	1	CON__P02533;P02533;CON__Q6IFX2;CON__Q04695;Q04695	CON__P02533;CON__Q04695	CON__P02533	KRT14;KRT17	Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 17	MULTI-SECPEP	DP1141_9	4	484.8974609375	3	485.569653	1453.68713	0.34655	0.00016827	-0.6882	-0.00033417	-0.34165	-0.0001659	485.56937994241133	14.514	0.5748	14.514	14.312	14.887	0					15	6	4	0	0	0	0.0011455	1	5011	5011		86.463	38.491	1	47302000		+	1139	9;21	685	713	1532	1532	9	9606
ILNVPQELYEK	11	Unmodified	_ILNVPQELYEK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	673.3722534179688	2	673.371735	1344.72892	1.0349	0.00069688	-0.61591	-0.00041474	0.419	0.00028214	673.371358435727	19.355	0.70037	19.355	19.105	19.806	0					12	6	3	0	0	0	1.1794999999999998E-52	2	12430	12430;12433		194.94	144.46	1	299420000			1140	367	686	714	1533;1534	1533		9606
ILSKPIEVQVGGR	13	Unmodified	_ILSKPIEVQVGGR_			0	0	1	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-MSMS	DP1141_6	1	465.9488525390625	3	465.948793	1394.82455	-0.031139	-1.4509E-05	0.46603	0.00021715	0.43489	0.00020264	465.9490551588844	16.68	0.31879	16.68	16.505	16.824	0					7	3	3	0	0	0	1.4055E-13	1	8162	8162		162.93	120.45	1	24089000			1141	445	687	715	1535	1535		9606
ILSMLADSTSTQEK	14	Oxidation (M)	_ILSM(Oxidation (M))LADSTSTQEK_	ILSM(1)LADSTSTQEK	ILSM(88)LADSTSTQEK	0	1	0	Q5VUA4	Q5VUA4	Q5VUA4	ZNF318	Zinc finger protein 318	MSMS	DP1141_7	2	770.3814086914062	2	770.382171	1538.74979	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.657	1	16.657	16.157	17.157	0								0	0	0	0.033365	1	8719	8719		87.713	44.406	1				1142	425	688	716	1536	1536	322	9606
ILSTMDSPST	10	Oxidation (M)	_ILSTM(Oxidation (M))DSPST_	ILSTM(1)DSPST	ILSTM(88)DSPST	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	534.2501831054688	2	534.249897	1066.48524	0.40521	0.00021648	-0.15504	-8.2832E-05	0.25016	0.00013365	534.2498555024723	16.055	0.69692	16.055	15.708	16.405	0					14	6	4	0	0	0	0.028587	1	7063	7063		87.754	60.23	1	105270000			1143	367	689	717	1537	1537	272	9606
ILVVIEPLLIDEDYYAR	17	Unmodified	_ILVVIEPLLIDEDYYAR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	1018.0630493164062	2	1017.56152	2033.10849	0.40796	0.00041513	-0.16175	-0.00016459	0.24621	0.00025054	1018.0628279143585	24.201	0.36518	24.201	23.878	24.243	0					11	4	4	0	0	0	0	2	20266	20185;20266		277.15	250	1	34758000			1144	78	690	718	1538;1539	1539		9606
IMDQAITVGAPVIGLNDSGGAR	22	Unmodified	_IMDQAITVGAPVIGLNDSGGAR_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	1078.0628662109375	2	1078.06243	2154.1103	0.84593	0.00091197	-0.015983	-1.7231E-05	0.82995	0.00089474	1078.061925935393	20.533	0.30087	20.533	20.377	20.678	0					8	2	4	0	0	0	0.0030595	1	14825	14825		77.222	38.922	1	14134000			1145	111	691	719	1540	1540		9606
IMGNLGAADIDHK	13	Oxidation (M)	_IM(Oxidation (M))GNLGAADIDHK_	IM(1)GNLGAADIDHK	IM(72)GNLGAADIDHK	0	1	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	457.58673095703125	3	457.56261	1369.666	0.28656	0.00013112	-0.5633	-0.00025775	-0.27674	-0.00012663	457.56234405551106	15.564	0.50509	15.564	15.409	15.914	0					6	4	2	0	0	0	0.0098333	1	6994	6994		71.933	41.602	1	195800000			1146	78	692	720	1541	1541	65	9606
IMLPWDPTGK	10	Oxidation (M)	_IM(Oxidation (M))LPWDPTGK_	IM(1)LPWDPTGK	IM(110)LPWDPTGK	0	1	0	P23396	P23396	P23396	RPS3	40S ribosomal protein S3	MULTI-MSMS	DP1141_10	5	587.3020629882812	2	587.302267	1172.58998	1.0131	0.00059499	-0.39332	-0.000231	0.61978	0.000364	587.3020869144214	20.814	0.39936	20.814	20.476	20.875	0					9	3	3	0	0	0	0.012419	1	15636	15636		105.52	57.672	1	20379000			1147	182	693	721	1542	1542	161	9606
IMLPWDPTGK	10	Unmodified	_IMLPWDPTGK_			0	0	0	P23396	P23396	P23396	RPS3	40S ribosomal protein S3	MULTI-MSMS	DP1141_10	5	579.6610717773438	2	579.30481	1156.59507	0.77524	0.0004491	-0.013616	-7.8881E-06	0.76162	0.00044121	579.3046770306896	21.509	0.48337	21.509	21.276	21.759	0					7	4	3	0	0	0	0.0030446	1	16655	16655		140.35	97.484	1	15766000			1148	182	693	722	1543	1543		9606
IMNTFSVVPSPK	12	Oxidation (M)	_IM(Oxidation (M))NTFSVVPSPK_	IM(1)NTFSVVPSPK	IM(140)NTFSVVPSPK	0	1	0	P07437;P68371;P04350;Q13509	P07437;P68371;Q13509	P68371	TUBB;TUBB4B;TUBB4A;TUBB3	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-3 chain	MULTI-SECPEP	DP1141_10	5	667.9799194335938	2	668.352488	1334.69042	-0.39645	-0.00026497	1.2109	0.00080929	0.81443	0.00054432	668.3536433073854	18.145	0.59957	18.145	17.688	18.287	0					15	5	4	0	0	0	0.0089156	1	11678	11678		137.98	77.957	1	35963000			1149	122;323;376	694	723	1544	1544	108	9606
IMNTFSVVPSPK	12	Oxidation (M)	_IM(Oxidation (M))NTFSVVPSPK_	IM(1)NTFSVVPSPK	IM(100)NTFSVVPSPK	0	1	0	P07437;P68371;P04350;Q13509	P07437;P68371;Q13509	P68371	TUBB;TUBB4B;TUBB4A;TUBB3	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-3 chain	MULTI-MSMS	DP1141_6	1	668.8571166992188	2	668.352488	1334.69042	1.366	0.00091294	-0.029044	-1.9412E-05	1.3369	0.00089353	668.8541607234433	18.194	0.49993	18.194	17.805	18.305	0					12	4	4	0	0	0	0.031484	2	10437	10437;10580		99.973	46.48	1	7495000			1150	122;323;376	694	723	1545;1546	1545	108	9606
IMNTFSVVPSPK	12	Oxidation (M)	_IM(Oxidation (M))NTFSVVPSPK_	IM(1)NTFSVVPSPK	IM(130)NTFSVVPSPK	0	1	0	P07437;P68371;P04350;Q13509	P07437;P68371;Q13509	P68371	TUBB;TUBB4B;TUBB4A;TUBB3	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-3 chain	MULTI-MSMS	DP1141_8	3	668.3534545898438	2	668.352488	1334.69042	0.68132	0.00045536	-0.050562	-3.3793E-05	0.63076	0.00042157	668.3526038789643	18.221	0.801	18.221	17.674	18.475	0					20	7	5	0	0	0	0.0091622	2	11036	11036;11104		125.74	65.618	1	139170000			1151	122;323;376	694	723	1547;1548	1547	108	9606
IMNTFSVVPSPK	12	Unmodified	_IMNTFSVVPSPK_			0	0	0	P07437;P68371;P04350;Q13509	P07437;P68371;Q13509	P68371	TUBB;TUBB4B;TUBB4A;TUBB3	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-3 chain	MULTI-MSMS	DP1141_8	3	660.3555908203125	2	660.355031	1318.69551	1.0142	0.00066975	-0.54414	-0.00035933	0.47009	0.00031043	660.3548322955838	19.015	0.8002	19.015	18.375	19.175	0					19	7	4	0	0	0	3.1778E-09	3	12425	12256;12425;12467		172.27	97.062	1	106310000			1152	122;323;376	694	724	1549;1550;1551	1550		9606
IMNTFSVVPSPK	12	Unmodified	_IMNTFSVVPSPK_			0	0	0	P07437;P68371;P04350;Q13509	P07437;P68371;Q13509	P68371	TUBB;TUBB4B;TUBB4A;TUBB3	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-3 chain	MULTI-MSMS	DP1141_9	4	660.3554077148438	2	660.355031	1318.69551	1.0562	0.00069744	-0.61895	-0.00040873	0.43721	0.00028871	660.3547054455433	19.088	0.6008	19.088	18.537	19.138	0					12	5	4	0	0	0	0.00041603	3	12493	12253;12493;12536		171.85	111.75	1	53830000			1153	122;323;376	694	724	1552;1553;1554	1553		9606
INEVLADFMGR	11	Oxidation (M)	_INEVLADFM(Oxidation (M))GR_	INEVLADFM(1)GR	INEVLADFM(96)GR	0	1	0	Q07973	Q07973	Q07973	CYP24A1	1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial	MSMS	DP1141_6	1	640.8466186523438	2	640.818812	1279.62307	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.547	1	19.547	19.047	20.047	0								0	0	0	0.010278	1	12733	12733		96.143	56.225	1				1154	354	695	725	1555	1555	260	9606
INTQWLLTSGTTEANAWK	18	Unmodified	_INTQWLLTSGTTEANAWK_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MULTI-MSMS	DP1141_10	5	679.0155639648438	3	678.681211	2033.0218	0.6673	0.00045288	-0.1102	-7.4793E-05	0.55709	0.00037809	679.0154649754124	21.609	0.68303	21.609	21.176	21.859	0					14	5	4	0	0	0	7.476499999999999E-296	1	16928	16928		216.71	160.95	1	1165100000		+	1155	29	696	726	1556	1556		
INTQWLLTSGTTEANAWK	18	Unmodified	_INTQWLLTSGTTEANAWK_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MULTI-MSMS	DP1141_6	1	1018.021240234375	2	1017.51818	2033.0218	0.461	0.00046907	0.32519	0.00033089	0.78619	0.00079996	1017.5183652597636	21.583	0.3323	21.583	21.296	21.628	0					9	3	3	0	0	0	6.444900000000001E-193	3	15811	15523;15661;15811		245.5	190.23	1	13669000		+	1156	29	696	726	1557;1558;1559	1559		
INVYYNEAAGNK	12	Unmodified	_INVYYNEAAGNK_			0	0	0	Q13885	Q13885	Q13885	TUBB2A	Tubulin beta-2A chain	MULTI-MSMS	DP1141_10	5	678.8916015625	2	678.333141	1354.65173	0.1494	0.00010134	-0.81652	-0.00055387	-0.66712	-0.00045253	678.3316312197427	16.762	0.3365	16.762	16.46	16.797	0					6	4	2	0	0	0	4.0691E-21	2	9208	9179;9208		169.65	121.99	1	23270000			1157	381	697	727	1560;1561	1561		9606
INVYYNEATGGK	12	Unmodified	_INVYYNEATGGK_			0	0	0	P68371	P68371	P68371	TUBB4B	Tubulin beta-4B chain	MULTI-SECPEP	DP1141_8	3	665.082275390625	2	664.827692	1327.64083	0.5073	0.00033727	0.41274	0.0002744	0.92003	0.00061166	664.8280444864879	17.023	0.34167	17.023	16.731	17.073	0					5	3	2	0	0	0	8.0223E-31	1	9283	9283		194.12	139.34	1	206690000			1158	323	698	728	1562	1562		9606
INVYYNEATGGK	12	Unmodified	_INVYYNEATGGK_			0	0	0	P68371	P68371	P68371	TUBB4B	Tubulin beta-4B chain	MULTI-MSMS	DP1141_9	4	665.3284301757812	2	664.827692	1327.64083	1.1066	0.0007357	-0.79138	-0.00052613	0.31522	0.00020957	664.8273353594237	17.088	0.28422	17.088	16.854	17.138	0					10	3	4	0	0	0	9.0573E-41	1	9222	9222		188.91	148.13	1	33429000			1159	323	698	728	1563	1563		9606
IPCDSPQSDPVDTPTSTK	18	Unmodified	_IPCDSPQSDPVDTPTSTK_			0	0	0	P46013	P46013	P46013	MKI67	Antigen KI-67	MULTI-MSMS	DP1141_7	2	972.9483032226562	2	972.946395	1943.87824	0.51174	0.0004979	0.90499	0.00088051	1.4167	0.0013784	972.9473371517388	15.964	0.29984	15.964	15.815	16.114	0					4	2	2	0	0	0	0.0087696	1	7790	7790		90.759	68.038	1	16488000			1160	232	699	729	1564	1564		9606
IPDWFLNR	8	Unmodified	_IPDWFLNR_			0	0	0	P62269	P62269	P62269	RPS18	40S ribosomal protein S18	MULTI-MSMS	DP1141_10	5	531.2835083007812	2	530.782359	1059.55016	0.5029	0.00026693	-0.10378	-5.5086E-05	0.39912	0.00021184	530.7822309825946	21.126	0.59216	21.126	20.775	21.368	0					7	5	2	0	0	0	1.0417E-05	2	16062	16062;16283		143.02	61.132	1	60846000			1161	293	700	730	1565;1566	1565		9606
IPGGIIEDSCVLR	13	Unmodified	_IPGGIIEDSCVLR_			0	0	0	P49368	P49368	P49368	CCT3	T-complex protein 1 subunit gamma	MSMS	DP1141_8	3	715.0148315429688	2	714.879401	1427.74425	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.497	1	19.497	18.997	19.997	0								0	0	0	0.016351	1	13091	13091		100.88	59.479	1				1162	246	701	731	1567	1567		9606
IPGGIIEDSCVLR	13	Unmodified	_IPGGIIEDSCVLR_			0	0	0	P49368	P49368	P49368	CCT3	T-complex protein 1 subunit gamma	MULTI-MSMS	DP1141_9	4	715.0145874023438	2	714.879401	1427.74425	0.66997	0.00047895	0.54235	0.00038771	1.2123	0.00086666	714.8800363293659	19.489	0.30092	19.489	19.338	19.639	0					4	2	2	0	0	0	0.014046	1	13124	13124		83.862	41.526	1	15695000			1163	246	701	731	1568	1568		9606
IPGGNIYISPLK	12	Unmodified	_IPGGNIYISPLK_			0	0	0	P06400	P06400	P06400	RB1	Retinoblastoma-associated protein	MULTI-SECPEP	DP1141_6	1	635.8724365234375	2	636.371538	1270.72852	0.86177	0.0005484	1.4392	0.00091584	2.3009	0.0014642	636.372548298618	19.289	0.40043	19.289	19.105	19.506	0					5	3	2	0	0	0	0.014768	1	12454	12454		91.658	33.062	1	6446700			1164	117	702	732	1569	1569		9606
IPLSQEEITLQGHAFEAR	18	Unmodified	_IPLSQEEITLQGHAFEAR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-SECPEP	DP1141_10	5	679.6293334960938	3	680.356728	2038.04835	0.93057	0.00063312	-0.55073	-0.00037469	0.37984	0.00025843	680.3560354281188	19.227	0.39943	19.227	18.977	19.376	0					7	3	3	0	0	0	0.025033	1	13197	13197		67.153	44.08	1	21255000			1165	521	703	733	1570	1570		9606
IPLSQEEITLQGHAFEAR	18	Unmodified	_IPLSQEEITLQGHAFEAR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	680.35595703125	3	680.356728	2038.04835	1.2602	0.00085736	-1.0213	-0.00069488	0.23882	0.00016248	680.6905268242203	19.256	0.40028	19.256	19.005	19.406	0					9	3	4	0	0	0	3.1559E-06	2	12280	12210;12280		150.39	97.863	1	62640000			1166	521	703	733	1571;1572	1572		9606
IPLSQEEITLQGHAFEAR	18	Unmodified	_IPLSQEEITLQGHAFEAR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	680.357177734375	3	680.356728	2038.04835	0.79445	0.00054051	-0.3149	-0.00021425	0.47954	0.00032626	680.6907309563348	19.225	0.90073	19.225	18.675	19.576	0					20	8	5	0	0	0	3.5835999999999997E-296	3	12683	12503;12683;12699		265.27	218.38	1	563210000			1167	521	703	733	1573;1574;1575	1574		9606
IPLSQEEITLQGHAFEAR	18	Unmodified	_IPLSQEEITLQGHAFEAR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_9	4	680.3543701171875	3	680.356728	2038.04835	-0.048806	-3.3205E-05	0.28955	0.000197	0.24075	0.00016379	680.6912106716862	19.188	0.50133	19.188	18.937	19.438	0					12	4	5	0	0	0	0.0016925	2	12745	12745;12788		131.82	91.583	1	355230000			1168	521	703	733	1576;1577	1576		9606
IPSIVSSPLNSPLDR	15	Unmodified	_IPSIVSSPLNSPLDR_			0	0	0	P49790	P49790	P49790	NUP153	Nuclear pore complex protein Nup153	MULTI-SECPEP	DP1141_7	2	798.4691162109375	2	797.943587	1593.87262	0.77704	0.00062003	0.26622	0.00021242	1.0433	0.00083246	797.9435455657758	20.2	0.30053	20.2	19.95	20.251	0					4	2	2	0	0	0	2.5026E-24	1	14281	14281		166.11	125.03	1	16171000			1169	252	704	734	1578	1578		9606
IPVGPETLGR	10	Unmodified	_IPVGPETLGR_			0	0	0	P06576	P06576	P06576	ATP5B	ATP synthase subunit beta, mitochondrial	MULTI-MSMS	DP1141_7	2	520.2659912109375	2	519.800749	1037.58694	0.26795	0.00013928	-0.14993	-7.7936E-05	0.11802	6.1345E-05	519.8006254991529	17.4	0.40028	17.4	17.149	17.549	0					7	3	3	0	0	0	0.0035677	1	9915	9915		109.11	66.241	1	22490000			1170	118	705	735	1579	1579		9606
IPVQAVWAGWGHASENPK	18	Unmodified	_IPVQAVWAGWGHASENPK_			0	0	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	649.6676635742188	3	649.667237	1945.97988	0.36981	0.00024025	0.3961	0.00025733	0.7659	0.00049758	649.6676146731814	19.756	0.40023	19.756	19.506	19.906	0					11	3	4	0	0	0	4.4239000000000004E-105	1	13064	13064		211.49	193.81	1	306210000			1171	367;40	706	736	1580	1580		9606
IPVQAVWAGWGHASENPK	18	Unmodified	_IPVQAVWAGWGHASENPK_			0	0	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	974.1544799804688	2	973.997217	1945.97988	0.1255	0.00012224	-0.23149	-0.00022547	-0.10599	-0.00010323	974.4972922172811	19.756	0.40017	19.756	19.406	19.806	0					9	3	4	0	0	0	9.6397E-11	1	13081	13081		139.77	109.75	1	26742000			1172	367;40	706	736	1581	1581		9606
IQDKEGIPPDQQR	13	Unmodified	_IQDKEGIPPDQQR_			0	0	1	P62987;P62979;P0CG47;P0CG48;A0A2R8Y422	P62987	P62987	UBA52;RPS27A;UBB;UBC	Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Polyubiquitin-B;Ubiquitin;Polyubiquitin-C;Ubiquitin	MULTI-MSMS	DP1141_10	5	762.394287109375	2	762.394261	1522.77397	0.64064	0.00048842	0.24909	0.0001899	0.88973	0.00067832	762.3942510818165	13.913	0.31796	13.913	13.772	14.09	0					13	5	3	0	0	0	0.031589	1	4669	4669		117.86	65.134	1	2811800			1173	134	707	737	1582	1582		9606
IQDKEGIPPDQQR	13	Unmodified	_IQDKEGIPPDQQR_			0	0	1	P62987;P62979;P0CG47;P0CG48;A0A2R8Y422	P62987	P62987	UBA52;RPS27A;UBB;UBC	Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Polyubiquitin-B;Ubiquitin;Polyubiquitin-C;Ubiquitin	MULTI-MSMS	DP1141_6	1	508.59881591796875	3	508.5986	1522.77397	0.1155	5.8742E-05	0.16378	8.3296E-05	0.27927	0.00014204	508.59875354034176	13.93	1.0518	13.93	13.657	14.708	0					48	11	6	0	0	0	0.006793	1	3873	3873		124.47	97.843	1	31693000			1174	134	707	737	1583	1583		9606
IQDKEGIPPDQQR	13	Unmodified	_IQDKEGIPPDQQR_			0	0	1	P62987;P62979;P0CG47;P0CG48;A0A2R8Y422	P62987	P62987	UBA52;RPS27A;UBB;UBC	Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Polyubiquitin-B;Ubiquitin;Polyubiquitin-C;Ubiquitin	MULTI-MSMS	DP1141_6	1	762.8963623046875	2	762.394261	1522.77397	-0.15648	-0.0001193	0.52137	0.00039749	0.36489	0.00027819	762.3946578901163	13.913	0.75234	13.913	13.657	14.409	0					20	8	4	0	0	0	0.014155	1	3970	3970		123.26	79.959	1	2113200			1175	134	707	737	1584	1584		9606
IQDKEGIPPDQQR	13	Unmodified	_IQDKEGIPPDQQR_			0	0	1	P62987;P62979;P0CG47;P0CG48;A0A2R8Y422	P62987	P62987	UBA52;RPS27A;UBB;UBC	Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Polyubiquitin-B;Ubiquitin;Polyubiquitin-C;Ubiquitin	MULTI-MSMS	DP1141_7	2	508.9330139160156	3	508.5986	1522.77397	0.37789	0.0001922	0.074103	3.7689E-05	0.452	0.00022988	508.5987012984077	13.913	0.88849	13.913	13.62	14.508	0					41	9	6	0	0	0	0.019021	3	4285	4255;4285;4398		113.69	88.5	1	60266000			1176	134	707	737	1585;1586;1587	1586		9606
IQDKEGIPPDQQR	13	Unmodified	_IQDKEGIPPDQQR_			0	0	1	P62987;P62979;P0CG47;P0CG48;A0A2R8Y422	P62987	P62987	UBA52;RPS27A;UBB;UBC	Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Polyubiquitin-B;Ubiquitin;Polyubiquitin-C;Ubiquitin	MULTI-MSMS	DP1141_7	2	762.896484375	2	762.394261	1522.77397	1.0769	0.00082102	-0.16393	-0.00012498	0.91297	0.00069604	762.3943652080501	13.877	0.68886	13.877	13.62	14.309	0					17	7	4	0	0	0	0.0018429	1	4411	4411		143.42	81.645	1	5169900			1177	134	707	737	1588	1588		9606
IQDKEGIPPDQQR	13	Unmodified	_IQDKEGIPPDQQR_			0	0	1	P62987;P62979;P0CG47;P0CG48;A0A2R8Y422	P62987	P62987	UBA52;RPS27A;UBB;UBC	Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Polyubiquitin-B;Ubiquitin;Polyubiquitin-C;Ubiquitin	MULTI-MSMS	DP1141_9	4	508.5987854003906	3	508.5986	1522.77397	-0.17588	-8.9452E-05	0.48368	0.000246	0.3078	0.00015655	508.5987930465409	13.948	0.7872	13.948	13.601	14.388	0					26	11	3	0	0	0	0.0023792	1	4176	4176		129.76	113.82	1	12540000			1178	134	707	737	1589	1589		9606
IQDWYDKK	8	Unmodified	_IQDWYDKK_			0	0	1	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_6	1	548.277587890625	2	548.277106	1094.53966	-0.21615	-0.00011851	0.93228	0.00051115	0.71613	0.00039264	548.2774480207316	15.855	0.79224	15.855	15.613	16.405	0					17	7	4	0	0	0	0.021808	1	6777	6777		120.46	57.742	1	18067000		+	1179	19	708	738	1590	1590		9606
IQEAGTEVVK	10	Unmodified	_IQEAGTEVVK_			0	0	0	P40926	P40926	P40926	MDH2	Malate dehydrogenase, mitochondrial	MULTI-MSMS	DP1141_6	1	536.96142578125	2	537.295496	1072.57644	0.060076	3.2278E-05	0.28867	0.0001551	0.34874	0.00018738	537.2955522769811	14.658	0.29941	14.658	14.509	14.808	0					6	2	3	0	0	0	0.0036288	2	4929	4929;5077		124.92	40.424	1	5090700			1180	223	709	739	1591;1592	1591		9606
IQEAGTEVVK	10	Unmodified	_IQEAGTEVVK_			0	0	0	P40926	P40926	P40926	MDH2	Malate dehydrogenase, mitochondrial	MULTI-SECPEP	DP1141_7	2	537.6273193359375	2	537.295496	1072.57644	0.022876	1.2291E-05	0.18061	9.7039E-05	0.20348	0.00010933	537.2953715345245	14.658	0.60114	14.658	14.508	15.109	0					6	5	2	0	0	0	0.031336	1	5507	5507		101.9	28.232	1	10629000			1181	223	709	739	1593	1593		9606
IQEAGTEVVK	10	Unmodified	_IQEAGTEVVK_			0	0	0	P40926	P40926	P40926	MDH2	Malate dehydrogenase, mitochondrial	MULTI-MSMS	DP1141_9	4	538.2813720703125	2	537.295496	1072.57644	0.63496	0.00034116	-1.7787	-0.00095567	-1.1437	-0.00061451	537.294550102944	14.685	0.33536	14.685	14.552	14.887	0					9	3	4	0	0	0	0.02365	1	5353	5353		80.438	14.365	1	12275000			1182	223	709	739	1594	1594		9606
IQLIFER	7	Unmodified	_IQLIFER_			0	0	0	Q15020	Q15020	Q15020	SART3	Squamous cell carcinoma antigen recognized by T-cells 3	MSMS	DP1141_7	2	459.941650390625	2	459.774003	917.533452	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.649	1	19.649	19.149	20.149	0								0	0	0	7.9652E-40	1	13486	13486		173.85	19.964	1				1183	398	710	740	1595	1595		9606
IQQQFSDLKR	10	Unmodified	_IQQQFSDLKR_			0	0	1	O94906	O94906	O94906	PRPF6	Pre-mRNA-processing factor 6	MULTI-MSMS	DP1141_7	2	421.59033203125	3	421.566571	1261.67788	-0.00883	-3.7224E-06	-1.2846	-0.00054156	-1.2935	-0.00054528	421.56541732438313	15.291	0.60275	15.291	14.909	15.512	0					6	5	2	0	0	0	0.013839	1	6710	6710		82.029	46.487	1	2536900			1184	86	711	741	1596	1596		9606
IQREREMEK	9	Oxidation (M)	_IQREREM(Oxidation (M))EK_	IQREREM(1)EK	IQREREM(85)EK	0	1	2	Q9H0G5	Q9H0G5	Q9H0G5	NSRP1	Nuclear speckle splicing regulatory protein 1	MSMS	DP1141_8	3	617.81298828125	2	617.814061	1233.61357	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.318	1	16.318	15.818	16.818	0								0	0	0	0.030828	1	8052	8052		84.568	18.495	1				1185	553	712	742	1597	1597	397	9606
ISEQFTAMFR	10	Oxidation (M)	_ISEQFTAM(Oxidation (M))FR_	ISEQFTAM(1)FR	ISEQFTAM(180)FR	0	1	0	P07437;P68371;P04350;Q13885;Q9BVA1;Q13509	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain	MULTI-SECPEP	DP1141_10	5	622.8655395507812	2	623.300255	1244.58596	-0.59595	-0.00037146	1.0743	0.00066961	0.47835	0.00029815	623.3006162545985	18.637	0.58923	18.637	18.187	18.777	0					6	5	2	0	0	0	7.7932E-12	1	12272	12272		177.3	105.43	1	28304000			1186	122;323;381;376	713	743	1598	1598	109	9606
ISGLIYEETR	10	Unmodified	_ISGLIYEETR_			0	0	0	P62805	P62805	P62805	HIST1H4A	Histone H4	MULTI-MSMS	DP1141_10	5	590.8143310546875	2	590.814053	1179.61355	0.29855	0.00017639	0.28179	0.00016648	0.58034	0.00034287	590.8141953024068	18.235	0.69433	18.235	17.987	18.682	0					19	6	6	0	0	0	6.3371E-96	2	11714	11714;11747		214.96	158.24	1	300620000			1187	303	714	744	1599;1600	1599		9606
ISGLIYEETR	10	Unmodified	_ISGLIYEETR_			0	0	0	P62805	P62805	P62805	HIST1H4A	Histone H4	MULTI-MSMS	DP1141_6	1	590.8143310546875	2	590.814053	1179.61355	1.1375	0.00067205	-0.16117	-9.5224E-05	0.97632	0.00057682	590.8138115672887	18.255	1.7132	18.255	16.891	18.604	0					28	17	4	0	0	0	5.695499999999999E-53	3	10565	10140;10432;10565		193.1	126.67	1	35734000			1188	303	714	744	1601;1602;1603	1603		9606
ISGLIYEETR	10	Unmodified	_ISGLIYEETR_			0	0	0	P62805	P62805	P62805	HIST1H4A	Histone H4	MULTI-MSMS	DP1141_7	2	591.537109375	2	590.814053	1179.61355	0.57841	0.00034173	0.6852	0.00040483	1.2636	0.00074656	590.8144243111258	18.199	0.30014	18.199	17.949	18.249	0					4	2	2	0	0	0	0.0029879	1	11292	11292		107.21	65.329	1	51380000			1189	303	714	744	1604	1604		9606
ISGLIYEETR	10	Unmodified	_ISGLIYEETR_			0	0	0	P62805	P62805	P62805	HIST1H4A	Histone H4	MSMS	DP1141_8	3	590.9669799804688	2	590.814053	1179.61355	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.19	1	18.19	17.69	18.69	0								0	0	0	7.2045E-43	1	11095	11095		174.02	124.31	1				1190	303	714	744	1605	1605		9606
ISLGLPVGAVINCADNTGAK	20	Unmodified	_ISLGLPVGAVINCADNTGAK_			0	0	0	P62829	P62829	P62829	RPL23	60S ribosomal protein L23	MULTI-MSMS	DP1141_10	5	986.0242919921875	2	985.522407	1969.03026	0.58629	0.0005778	-0.23476	-0.00023137	0.35152	0.00034643	986.0235245463123	21.126	0.30084	21.126	20.875	21.176	0					6	2	3	0	0	0	0.033534	1	16155	16155		81.992	59.211	1	67866000			1191	305	715	745	1606	1606		9606
ISLLLDPGSFVESDMFVEHR	20	Oxidation (M)	_ISLLLDPGSFVESDM(Oxidation (M))FVEHR_	ISLLLDPGSFVESDM(1)FVEHR	ISLLLDPGSFVESDM(78)FVEHR	0	1	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_10	5	770.0506591796875	3	769.715704	2306.12528	0.86491	0.00066574	-0.03954	-3.0435E-05	0.82537	0.0006353	770.0500377237727	22.309	0.27647	22.309	22.159	22.435	0					4	2	2	0	0	0	0.0022306	1	17995	17995		77.959	59.505	1	24880000			1192	111	716	746	1607	1607	101	9606
ISLPIEDYFNK	11	Unmodified	_ISLPIEDYFNK_			0	0	0	Q9UBD5	Q9UBD5	Q9UBD5	ORC3	Origin recognition complex subunit 3	MULTI-MSMS	DP1141_8	3	670.3494262695312	2	669.850635	1337.68672	0.56002	0.00037513	-0.097992	-6.564E-05	0.46202	0.00030949	669.8509703941368	21.629	0.50137	21.629	21.178	21.679	0					9	4	3	0	0	0	0.0092731	1	16194	16194		89.886	35.163	1	9749800			1193	587	717	747	1608	1608		9606
ISLPLPNFSSLNLR	14	Unmodified	_ISLPLPNFSSLNLR_			0	0	0	P08670	P08670	P08670	VIM	Vimentin	MULTI-MSMS	DP1141_8	3	785.95166015625	2	785.951215	1569.88788	0.51662	0.00040604	0.084745	6.6605E-05	0.60136	0.00047264	785.9511886565044	22.837	0.47858	22.837	22.475	22.953	0					17	5	4	0	0	0	3.7103E-30	2	17933	17933;17984		172.8	156.58	1	20949000			1194	127	718	748	1609;1610	1609		9606
ISPPIKEEETKGDSVEK	17	Unmodified	_ISPPIKEEETKGDSVEK_			0	0	2	Q6PJT7	Q6PJT7	Q6PJT7	ZC3H14	Zinc finger CCCH domain-containing protein 14	MULTI-MSMS	DP1141_8	3	629.3135986328125	3	629.329956	1884.96804	0.50148	0.0003156	-0.018061	-1.1366E-05	0.48342	0.00030423	629.330010456548	14.722	0.29621	14.722	14.577	14.873	0					6	2	3	0	0	0	0.008965	1	5590	5590		133.87	108.95	1	6763100			1195	433	719	749	1611	1611		9606
ISPPIKEEETKGDSVEK	17	Unmodified	_ISPPIKEEETKGDSVEK_			0	0	2	Q6PJT7	Q6PJT7	Q6PJT7	ZC3H14	Zinc finger CCCH domain-containing protein 14	MULTI-SECPEP	DP1141_8	3	472.5517883300781	4	472.249286	1884.96804	0.38799	0.00018323	-0.4411	-0.00020831	-0.053102	-2.5077E-05	472.2491527074125	14.735	0.42819	14.735	14.445	14.873	0					7	4	3	0	0	0	0.014112	1	5539	5539		71.98	46.813	1	5232300			1196	433	719	749	1612	1612		9606
ISTLTIEEGNLDIQRPK	17	Unmodified	_ISTLTIEEGNLDIQRPK_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MSMS	DP1141_10	5	643.0214233398438	3	643.021345	1926.04221	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.758	1	18.758	18.258	19.258	0								0	0	0	1.7098E-136	1	12538	12538		243.92	210.93	1				1197	365	720	750	1613	1613		9606
ISTLTIEEGNLDIQRPK	17	Unmodified	_ISTLTIEEGNLDIQRPK_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	643.3560180664062	3	643.021345	1926.04221	1.0135	0.00065172	-0.53927	-0.00034676	0.47426	0.00030496	643.355202481807	18.725	0.60073	18.725	18.375	18.976	0					17	5	5	0	0	0	1.4822E-05	2	11928	11928;12012		153.41	115.3	1	5126100000			1198	365	720	750	1614;1615	1614		9606
ISTLTIEEGNLDIQRPK	17	Unmodified	_ISTLTIEEGNLDIQRPK_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	964.530029296875	2	964.028379	1926.04221	0.54299	0.00052346	-0.18301	-0.00017642	0.35998	0.00034704	964.5296557268512	18.725	0.40073	18.725	18.475	18.876	0					8	3	3	0	0	0	0	1	11984	11984		340.88	271.62	1	1091400000			1199	365	720	750	1616	1616		9606
ISTLTIEEGNLDIQRPK	17	Unmodified	_ISTLTIEEGNLDIQRPK_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	643.0220947265625	3	643.021345	1926.04221	0.69626	0.00044771	-0.16587	-0.00010666	0.53039	0.00034105	643.3555239028053	18.687	0.49999	18.687	18.437	18.937	0					16	4	5	0	0	0	1.7402999999999998E-144	2	11934	11934;12003		275.19	232.15	1	656520000			1200	365	720	750	1617;1618	1617		9606
ISTLTIEEGNLDIQRPK	17	Unmodified	_ISTLTIEEGNLDIQRPK_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	964.0286254882812	2	964.028379	1926.04221	0.53855	0.00051918	-0.10226	-9.8586E-05	0.43629	0.00042059	964.028250908041	18.687	0.29992	18.687	18.537	18.837	0					6	2	3	0	0	0	1.5863E-58	2	12006	12006;12007		197.07	173.6	1	101200000			1201	365	720	750	1619;1620	1619		9606
ISVMGGEQAANVLATITK	18	Unmodified	_ISVMGGEQAANVLATITK_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_10	5	901.9278564453125	2	901.987669	1801.96078	0.53025	0.00047828	0.19126	0.00017251	0.72151	0.00065079	902.48941020054	21.709	0.29996	21.709	21.559	21.859	0					4	2	2	0	0	0	1.4598999999999999E-58	1	17058	17058		195.87	136.61	1	11728000			1202	567	721	751	1621	1621		9606
ISVMGGEQAANVLATITK	18	Unmodified	_ISVMGGEQAANVLATITK_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	902.4486083984375	2	901.987669	1801.96078	0.43554	0.00039285	-0.0039585	-3.5705E-06	0.43158	0.00038928	901.9878487967787	21.729	0.40006	21.729	21.579	21.979	0					7	3	3	0	0	0	5.3250999999999995E-248	1	16420	16420		259.27	225.4	1	608830000			1203	567	721	751	1622	1622		9606
ISVMGGEQAANVLATITK	18	Unmodified	_ISVMGGEQAANVLATITK_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-SECPEP	DP1141_9	4	901.4471435546875	2	901.987669	1801.96078	0.91325	0.00082374	-0.36981	-0.00033357	0.54343	0.00049017	901.987433387282	21.782	0.29338	21.782	21.538	21.832	0					4	2	2	0	0	0	0.00011651	1	16562	16562		100.11	74.638	1	17037000			1204	567	721	751	1623	1623		9606
ISVMGGEQAANVLATITK	18	Oxidation (M)	_ISVM(Oxidation (M))GGEQAANVLATITK_	ISVM(1)GGEQAANVLATITK	ISVM(160)GGEQAANVLATITK	0	1	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	910.936279296875	2	909.985126	1817.9557	0.32154	0.0002926	0.069353	6.311E-05	0.3909	0.00035571	909.9853707121795	20.728	0.49998	20.728	20.578	21.078	0					8	4	3	0	0	0	3.9398E-15	1	14808	14808		163.62	107.41	1	1358400000			1205	567	721	752	1624	1624	405	9606
ISVYYNEASSHK	12	Unmodified	_ISVYYNEASSHK_			0	0	0	Q13509	Q13509	Q13509	TUBB3	Tubulin beta-3 chain	MULTI-MSMS	DP1141_7	2	466.9260559082031	3	466.561375	1396.66229	0.29764	0.00013887	-0.483	-0.00022535	-0.18536	-8.6481E-05	466.56109612788623	15.564	0.40501	15.564	15.309	15.714	0					5	3	2	0	0	0	0.035366	1	6951	6951		55.258	21.716	1	9065200			1206	376	722	753	1625	1625		9606
ITADGAHFELR	11	Unmodified	_ITADGAHFELR_			0	0	0	Q8IWX8	Q8IWX8	Q8IWX8	CHERP	Calcium homeostasis endoplasmic reticulum protein	MULTI-MSMS	DP1141_8	3	410.5776062011719	3	410.547288	1228.62004	0.25159	0.00010329	-0.10811	-4.4383E-05	0.14348	5.8906E-05	410.5472380841453	17.13	0.44555	17.13	16.828	17.273	0					9	4	4	0	0	0	0.0076507	1	9384	9384		113.67	48.393	1	17722000			1207	463	723	754	1626	1626		9606
ITAEEMYDIFGK	12	Oxidation (M)	_ITAEEM(Oxidation (M))YDIFGK_	ITAEEM(1)YDIFGK	ITAEEM(170)YDIFGK	0	1	0	Q9Y3B4	Q9Y3B4	Q9Y3B4	SF3B6	Splicing factor 3B subunit 6	MULTI-MSMS	DP1141_10	5	716.837646484375	2	716.836868	1431.65918	1.7592	0.0012611	-1.1843	-0.00084898	0.57486	0.00041208	716.8359721968811	19.726	0.49983	19.726	19.376	19.876	0					8	4	2	0	0	0	4.5082E-14	1	13970	13970		166.66	92.485	1	296400000			1208	615	724	755	1627	1627	423	9606
ITDIIGKEEGIGPENLR	17	Unmodified	_ITDIIGKEEGIGPENLR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	619.0046997070312	3	618.670424	1852.98944	1.0428	0.00064512	-0.45579	-0.00028198	0.58697	0.00036314	618.6703917776161	18.654	0.50066	18.654	18.405	18.905	0					17	4	5	0	0	0	4.2186E-144	4	11335	11101;11288;11335;11478		229.02	199.39	1	530020000			1209	367	725	756	1628;1629;1630;1631	1630		9606
ITDIIGKEEGIGPENLR	17	Unmodified	_ITDIIGKEEGIGPENLR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	928.0040893554688	2	927.501997	1852.98944	0.297	0.00027547	0.19624	0.00018201	0.49324	0.00045748	927.5021333353891	18.654	0.40052	18.654	18.405	18.805	0					11	3	4	0	0	0	0	2	11380	11380;11482		283.66	226.31	1	93630000			1210	367	725	756	1632;1633	1632		9606
ITDIIGKEEGIGPENLR	17	Unmodified	_ITDIIGKEEGIGPENLR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	618.6707763671875	3	618.670424	1852.98944	0.19136	0.00011839	0.65528	0.0004054	0.84665	0.00052379	619.0051244442656	18.7	0.30019	18.7	18.449	18.75	0					8	2	4	0	0	0	4.884E-09	3	12054	11903;11970;12054		154.81	123.29	1	94726000			1211	367	725	756	1634;1635;1636	1636		9606
ITDIIGKEEGIGPENLR	17	Unmodified	_ITDIIGKEEGIGPENLR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_8	3	618.7931518554688	3	618.670424	1852.98944	0.612	0.00037862	-0.33832	-0.00020931	0.27367	0.00016931	619.0044143747484	18.625	0.6008	18.625	18.275	18.876	0					6	5	2	0	0	0	8.9368E-08	1	11862	11862		117	86.687	1	33699000			1212	367	725	756	1637	1637		9606
ITGEAFVQFASQELAEK	17	Unmodified	_ITGEAFVQFASQELAEK_			0	0	0	P52597	P52597	P52597	HNRNPF	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed	MULTI-MSMS	DP1141_9	4	934.9768676757812	2	934.475448	1866.93634	0.74842	0.00069938	-0.51511	-0.00048136	0.23331	0.00021802	934.9762561169754	22.543	0.49636	22.543	22.283	22.779	0					8	6	3	0	0	0	2.2299E-23	1	17802	17802		171.36	141.81	1	55868000			1213	266	726	757	1638	1638		9606
ITISPLQELTLYNPER	16	Unmodified	_ITISPLQELTLYNPER_			0	0	0	O00425	O00425	O00425	IGF2BP3	Insulin-like growth factor 2 mRNA-binding protein 3	MSMS	DP1141_8	3	944.013427734375	2	944.014741	1886.01493	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.482	1	22.482	21.982	22.982	0								0	0	0	0.026175	1	17505	17505		119.21	78.84	1				1214	36	727	758	1639	1639		9606
ITLIIGGSYGAGNYGMCGR	19	Unmodified	_ITLIIGGSYGAGNYGMCGR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-SECPEP	DP1141_8	3	980.5307006835938	2	980.474402	1958.93425	0.4122	0.00040415	-0.21638	-0.00021216	0.19582	0.00019199	980.4745261370518	20.728	0.30009	20.728	20.578	20.878	0					4	2	2	0	0	0	9.708500000000002E-41	1	14982	14982		224.25	181.77	1	9219600			1215	567	728	759	1640	1640		9606
ITPENLPQILLQLK	14	Unmodified	_ITPENLPQILLQLK_			0	0	0	P43243	P43243	P43243	MATR3	Matrin-3	MULTI-MSMS	DP1141_7	2	810.9921875	2	810.490173	1618.96579	0.56016	0.000454	-0.32455	-0.00026305	0.2356	0.00019095	810.4901253769096	23.236	0.62749	23.236	22.853	23.481	0					13	8	3	0	0	0	0.00067643	2	18882	18882;18981		144.77	118.88	1	19027000			1216	229	729	760	1641;1642	1641		9606
ITPENLPQILLQLK	14	Unmodified	_ITPENLPQILLQLK_			0	0	0	P43243	P43243	P43243	MATR3	Matrin-3	MSMS	DP1141_8	3	810.4908447265625	2	810.490173	1618.96579	NaN	NaN	NaN	NaN	NaN	NaN	NaN	23.329	1	23.329	22.829	23.829	0								0	0	0	0.010964	1	18787	18787		100.88	75.405	1				1217	229	729	760	1643	1643		9606
ITPSYVAFTPEGER	14	Unmodified	_ITPSYVAFTPEGER_			0	0	0	P11021	P11021	P11021	HSPA5	78 kDa glucose-regulated protein	MULTI-SECPEP	DP1141_8	3	783.3584594726562	2	783.893563	1565.77257	0.6338	0.00049684	-0.20082	-0.00015743	0.43298	0.00033941	784.3948481648943	19.026	0.29939	19.026	18.876	19.175	0					6	2	3	0	0	0	0.00050378	1	12347	12347		117.09	74.901	1	94275000			1218	139	730	761	1644	1644		9606
ITSEAEDLVANFFPK	15	Unmodified	_ITSEAEDLVANFFPK_			0	0	0	P61289	P61289	P61289	PSME3	Proteasome activator complex subunit 3	MULTI-MSMS	DP1141_10	5	841.6107177734375	2	840.927603	1679.84065	0.48874	0.00041099	0.47013	0.00039535	0.95887	0.00080634	840.9279064655137	23.336	0.42729	23.336	22.942	23.369	0					9	5	3	0	0	0	0.0033287	3	19200	19200;19363;19433		119.03	86.169	1	7216700			1219	281	731	762	1645;1646;1647	1645		9606
ITSEAEDLVANFFPK	15	Unmodified	_ITSEAEDLVANFFPK_			0	0	0	P61289	P61289	P61289	PSME3	Proteasome activator complex subunit 3	MULTI-MSMS	DP1141_9	4	840.9268188476562	2	840.927603	1679.84065	0.19435	0.00016344	0.41913	0.00035246	0.61349	0.0005159	841.4294576533995	23.301	0.39605	23.301	22.939	23.335	0					12	5	3	0	0	0	0.0033973	3	18637	18586;18637;18698		107.03	82.173	1	5191700			1220	281	731	762	1648;1649;1650	1649		9606
ITSENPDEGFKPSSGTVQELNFR	23	Unmodified	_ITSENPDEGFKPSSGTVQELNFR_			0	0	1	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	851.8823852539062	3	851.41363	2551.21906	0.20443	0.00017405	0.35688	0.00030385	0.56131	0.0004779	851.7483122355866	18.8	0.50024	18.8	18.55	19.05	0					10	4	4	0	0	0	2.4503E-42	1	12135	12135		178.1	161.51	1	43579000			1221	367;40	732	763	1651	1651		9606
IVAERPGTNSTGPAPMAPPR	20	Oxidation (M)	_IVAERPGTNSTGPAPM(Oxidation (M))APPR_	IVAERPGTNSTGPAPM(1)APPR	IVAERPGTNSTGPAPM(150)APPR	0	1	1	Q13263	Q13263	Q13263	TRIM28	Transcription intermediary factor 1-beta	MULTI-MSMS	DP1141_7	2	679.3521118164062	3	679.017829	2034.03166	0.056342	3.8257E-05	-0.26717	-0.00018141	-0.21083	-0.00014316	679.3520735322626	15.059	0.703	15.059	14.809	15.512	0					26	6	5	0	0	0	7.2542E-08	2	6153	6038;6153		151.39	123.96	1	232160000			1222	372	733	764	1652;1653	1653	291	9606
IVAERPGTNSTGPAPMAPPR	20	Oxidation (M)	_IVAERPGTNSTGPAPM(Oxidation (M))APPR_	IVAERPGTNSTGPAPM(1)APPR	IVAERPGTNSTGPAPM(110)APPR	0	1	1	Q13263	Q13263	Q13263	TRIM28	Transcription intermediary factor 1-beta	MULTI-MSMS	DP1141_8	3	679.3242797851562	3	679.017829	2034.03166	0.81504	0.00055343	-0.36213	-0.00024589	0.45291	0.00030754	679.3522189703937	15.022	0.59804	15.022	14.772	15.37	0					10	5	3	0	0	0	5.4262E-06	3	6092	5923;6092;6134		113.33	99.628	1	45049000			1223	372	733	764	1654;1655;1656	1655	291	9606
IVAERPGTNSTGPAPMAPPR	20	Unmodified	_IVAERPGTNSTGPAPMAPPR_			0	0	1	Q13263	Q13263	Q13263	TRIM28	Transcription intermediary factor 1-beta	MULTI-MSMS	DP1141_7	2	674.0208740234375	3	673.686191	2018.03674	0.44682	0.00030102	0.47365	0.00031909	0.92047	0.00062011	674.0208101901304	15.964	0.29982	15.964	15.714	16.014	0					4	2	2	0	0	0	0.0085394	1	7598	7598		96.447	80.457	1	50800000			1224	372	733	765	1657	1657		9606
IVALNAHTFLR	11	Unmodified	_IVALNAHTFLR_			0	0	0	P22087;A6NHQ2	P22087	P22087	FBL;FBLL1	rRNA 2-O-methyltransferase fibrillarin;rRNA/tRNA 2-O-methyltransferase fibrillarin-like protein 1	MULTI-MSMS	DP1141_9	4	418.72418212890625	3	418.915423	1253.72444	0.23011	9.6396E-05	0.13449	5.6341E-05	0.3646	0.00015274	418.9154035008885	18.687	0.29997	18.687	18.437	18.737	0					4	2	2	0	0	0	0.0045137	1	11705	11705		96.665	74.024	1	19271000			1225	176	734	766	1658	1658		9606
IVDDLKDEAEQYR	13	Unmodified	_IVDDLKDEAEQYR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	797.7001953125	2	797.391384	1592.76822	0.75102	0.00059886	-0.31143	-0.00024834	0.43959	0.00035052	797.3910364674947	17.4	0.30062	17.4	17.149	17.45	0					4	2	2	0	0	0	8.0437E-233	1	9908	9908		258.01	214.05	1	35244000			1226	78	735	767	1659	1659		9606
IVDDLKDEAEQYR	13	Unmodified	_IVDDLKDEAEQYR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-SECPEP	DP1141_7	2	532.6543579101562	3	531.930015	1592.76822	0.3423	0.00018208	-0.12707	-6.7592E-05	0.21523	0.00011449	531.9298306004094	17.4	0.49648	17.4	16.953	17.45	0					9	4	3	0	0	0	7.993499999999999E-19	1	9810	9810		166.04	136.82	1	49307000			1227	78	735	767	1660	1660		9606
IVDDLKDEAEQYRK	14	Unmodified	_IVDDLKDEAEQYRK_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-SECPEP	DP1141_6	1	575.2745361328125	3	574.628336	1720.86318	0.41429	0.00023806	-0.12763	-7.3338E-05	0.28666	0.00016472	574.6282296658188	16.455	0.62952	16.455	16.305	16.935	0					9	7	2	0	0	0	0.013272	1	7855	7855		101.56	69.078	1	84529000			1228	78	736	768	1661	1661		9606
IVDDLKDEAEQYRK	14	Unmodified	_IVDDLKDEAEQYRK_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	574.6131591796875	3	574.628336	1720.86318	0.72779	0.00041821	-0.5856	-0.0003365	0.14219	8.1705E-05	574.6279026441938	16.468	0.52322	16.468	16.215	16.738	0					22	5	6	0	0	0	1.0206E-08	3	8286	8286;8292;8472		188.15	150.62	1	903620000			1229	78	736	768	1662;1663;1664	1662		9606
IVEIPFNSTNK	11	Unmodified	_IVEIPFNSTNK_			0	0	0	P05023	P05023	P05023	ATP1A1	Sodium/potassium-transporting ATPase subunit alpha-1	MULTI-SECPEP	DP1141_6	1	631.2980346679688	2	631.342978	1260.6714	1.2413	0.00078371	-2.5572	-0.0016144	-1.3158	-0.00083073	631.8424977617065	18.61	0.60033	18.61	18.305	18.905	0					7	5	2	0	0	0	0.020516	1	11156	11156		90.709	38.306	1	2699900			1230	106	737	769	1665	1665		9606
IVEPYIAWGYPNLK	14	Unmodified	_IVEPYIAWGYPNLK_			0	0	0	P18124	P18124	P18124	RPL7	60S ribosomal protein L7	MULTI-MSMS	DP1141_10	5	831.9484252929688	2	831.948141	1661.88173	0.61427	0.00051104	0.39352	0.00032739	1.0078	0.00083843	831.9489246303241	21.809	0.49947	21.809	21.459	21.959	0					7	4	3	0	0	0	0.018795	1	17284	17284		78.655	28.372	1	23993000			1231	167	738	770	1666	1666		9606
IVEQPTVSVTEPK	13	Unmodified	_IVEQPTVSVTEPK_			0	0	0	Q15054	Q15054	Q15054	POLD3	DNA polymerase delta subunit 3	MULTI-MSMS	DP1141_8	3	713.8477172851562	2	713.893032	1425.77151	0.02093	1.4942E-05	0.4943	0.00035288	0.51523	0.00036782	714.3944408065435	16.684	0.26166	16.684	16.469	16.731	0					4	2	2	0	0	0	0.0090299	1	8544	8544		88.187	44.879	1	7056500			1232	400	739	771	1667	1667		9606
IVGDLAQFMVQNGLSR	16	Unmodified	_IVGDLAQFMVQNGLSR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	874.9637451171875	2	874.461621	1746.90869	0.97594	0.00085343	-0.6309	-0.0005517	0.34504	0.00030173	874.9622314502368	22.272	0.22449	22.272	22.14	22.365	0					9	3	4	0	0	0	7.9362E-42	2	16910	16910;16934		184.96	124.27	1	19314000			1233	142	740	772	1668;1669	1668		9606
IVGDLAQFMVQNGLSR	16	Unmodified	_IVGDLAQFMVQNGLSR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	874.4620361328125	2	874.461621	1746.90869	0.63098	0.00055177	-1.6489	-0.0014419	-1.0179	-0.00089015	874.4613407562655	22.229	0.39598	22.229	22.079	22.475	0					5	3	2	0	0	0	8.1793E-31	1	17280	17280		177.1	118.93	1	26240000			1234	142	740	772	1670	1670		9606
IVGDLAQFMVQNGLSR	16	Unmodified	_IVGDLAQFMVQNGLSR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_9	4	874.4620971679688	2	874.461621	1746.90869	0.4715	0.00041231	-0.81467	-0.00071239	-0.34317	-0.00030009	874.4616811560259	22.251	0.46278	22.251	22.119	22.582	0					10	5	4	0	0	0	5.1786E-84	2	17335	17335;17344		207.47	132.52	1	30236000			1235	142	740	772	1671;1672	1671		9606
IVGDLAQFMVQNGLSR	16	Oxidation (M)	_IVGDLAQFM(Oxidation (M))VQNGLSR_	IVGDLAQFM(1)VQNGLSR	IVGDLAQFM(160)VQNGLSR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MSMS	DP1141_9	4	882.4418334960938	2	882.459078	1762.9036	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.234	1	20.234	19.734	20.734	0								0	0	0	6.1878E-18	1	14217	14217		156.14	113.42	1				1236	142	740	773	1673	1673	142	9606
IVILEYQPSK	10	Unmodified	_IVILEYQPSK_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	595.3455200195312	2	595.344989	1188.67542	0.57175	0.00034039	0.2413	0.00014366	0.81305	0.00048405	595.3451000286968	18.855	0.70031	18.855	18.305	19.005	0					13	6	4	0	0	0	9.552800000000002E-41	2	11643	11624;11643		187	122.79	1	65762000			1237	402	741	774	1674;1675	1675		9606
IVILEYQPSK	10	Unmodified	_IVILEYQPSK_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-SECPEP	DP1141_7	2	595.9953002929688	2	595.344989	1188.67542	0.38526	0.00022936	0.35072	0.0002088	0.73598	0.00043816	595.3451468877074	18.8	0.39993	18.8	18.55	18.95	0					6	3	2	0	0	0	1.7065E-14	1	12189	12189		180.87	127.93	1	317220000			1238	402	741	774	1676	1676		9606
IVLDNSVFSEHR	12	Unmodified	_IVLDNSVFSEHR_			0	0	0	Q00610;P53675	Q00610	Q00610	CLTC;CLTCL1	Clathrin heavy chain 1;Clathrin heavy chain 2	MSMS	DP1141_6	1	708.3696899414062	2	708.367515	1414.72048	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.298	1	18.298	17.798	18.798	0								0	0	0	0.00045563	1	10749	10749		136.02	89.566	1				1239	336	742	775	1677	1677		9606
IVLEDGTLHVTEGSGR	16	Unmodified	_IVLEDGTLHVTEGSGR_			0	0	0	Q16555	Q16555	Q16555	DPYSL2	Dihydropyrimidinase-related protein 2	MULTI-MSMS	DP1141_8	3	561.9596557617188	3	561.628448	1681.86351	0.046311	2.6009E-05	0.0516	2.898E-05	0.09791	5.4989E-05	561.6282481154105	17.724	0.29989	17.724	17.474	17.774	0					4	2	2	0	0	0	0.016272	1	10325	10325		68.173	35.898	1	41845000			1240	409	743	776	1678	1678		9606
IVPGQFLAVDPK	12	Unmodified	_IVPGQFLAVDPK_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	642.3719482421875	2	642.371538	1282.72852	0.63471	0.00040772	0.46409	0.00029812	1.0988	0.00070584	642.3717518284767	19.756	0.40023	19.756	19.506	19.906	0					9	3	3	0	0	0	0.0067927	2	13063	13063;13108		97.472	66.05	1	125370000			1241	402	744	777	1679;1680	1679		9606
IVQAEGEAEAAK	12	Unmodified	_IVQAEGEAEAAK_			0	0	0	Q99623	Q99623	Q99623	PHB2	Prohibitin-2	MSMS	DP1141_6	1	608.3599243164062	2	608.314417	1214.61428	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.285	1	14.285	13.785	14.785	0								0	0	0	1.8342E-05	1	4427	4427		140.17	77.969	1				1242	529	745	778	1681	1681		9606
IVQAEGEAEAAK	12	Unmodified	_IVQAEGEAEAAK_			0	0	0	Q99623	Q99623	Q99623	PHB2	Prohibitin-2	MULTI-MSMS	DP1141_9	4	608.3148193359375	2	608.314417	1214.61428	-0.15663	-9.5279E-05	0.84681	0.00051513	0.69018	0.00041985	608.3149082799674	14.28	0.27421	14.28	14.114	14.388	0					12	3	5	0	0	0	3.9979999999999995E-21	3	4711	4647;4711;4720		169.76	100.16	1	27337000			1243	529	745	778	1682;1683;1684	1683		9606
IVQMTEAEVR	10	Oxidation (M)	_IVQM(Oxidation (M))TEAEVR_	IVQM(1)TEAEVR	IVQM(120)TEAEVR	0	1	0	P62140	P62140	P62140	PPP1CB	Serine/threonine-protein phosphatase PP1-beta catalytic subunit	MULTI-MSMS	DP1141_10	5	596.856201171875	2	596.305538	1190.59652	0.58132	0.00034664	-0.99011	-0.00059041	-0.40879	-0.00024377	596.3054951294821	14.509	0.32369	14.509	14.276	14.6	0					14	4	4	0	0	0	0.026703	1	5562	5562		122.28	76.309	1	52730000			1244	287	746	779	1685	1685	231	9606
IVQMTEAEVR	10	Oxidation (M)	_IVQM(Oxidation (M))TEAEVR_	IVQM(1)TEAEVR	IVQM(110)TEAEVR	0	1	0	P62140	P62140	P62140	PPP1CB	Serine/threonine-protein phosphatase PP1-beta catalytic subunit	MULTI-MSMS	DP1141_9	4	596.3058471679688	2	596.305538	1190.59652	0.27189	0.00016213	0.066373	3.9579E-05	0.33827	0.00020171	596.3057376826436	14.514	0.82811	14.514	14.247	15.075	0					17	9	4	0	0	0	0.0177	1	5183	5183		108.98	62.552	1	256080000			1245	287	746	779	1686	1686	231	9606
IVQQIAILMGCAILPHLR	18	Oxidation (M)	_IVQQIAILM(Oxidation (M))GCAILPHLR_	IVQQIAILM(1)GCAILPHLR	IVQQIAILM(160)GCAILPHLR	0	1	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	688.7296752929688	3	688.060312	2061.15911	0.93358	0.00064236	-0.18062	-0.00012428	0.75296	0.00051808	688.3947187060131	21.3	0.49971	21.3	21.05	21.55	0					16	4	5	0	0	0	5.1974E-11	2	15980	15980;16100		160.04	134.63	1	108090000			1246	78	747	780	1687;1688	1687	66	9606
IVQQIAILMGCAILPHLR	18	Unmodified	_IVQQIAILMGCAILPHLR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	683.0638427734375	3	682.728674	2045.16419	0.59953	0.00040932	-0.34406	-0.0002349	0.25547	0.00017442	683.0628739589857	23.692	0.53158	23.692	23.414	23.946	0					20	6	5	0	0	0	7.386800000000001E-193	2	19441	19441;19536		225.21	208.69	1	39349000			1247	78	747	781	1689;1690	1689		9606
IVQQIAILMGCAILPHLR	18	Unmodified	_IVQQIAILMGCAILPHLR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	1024.091796875	2	1023.58937	2045.16419	0.40905	0.00041869	-0.3118	-0.00031916	0.097241	9.9535E-05	1024.0911664683101	23.692	0.39682	23.692	23.481	23.878	0					7	4	2	0	0	0	3.9282E-10	1	19684	19684		158.05	131.93	1	2851200			1248	78	747	781	1691	1691		9606
IVVNLTGR	8	Unmodified	_IVVNLTGR_			0	0	0	P62244	P62244	P62244	RPS15A	40S ribosomal protein S15a	MULTI-SECPEP	DP1141_10	5	435.92254638671875	2	436.271627	870.528701	-0.43844	-0.00019128	0.73494	0.00032064	0.29651	0.00012936	436.2719577100248	17.337	0.3006	17.337	17.187	17.488	0					4	2	2	0	0	0	0.0021157	1	10318	10318		173.59	76.525	1	364200000			1249	288	748	782	1692	1692		9606
IVVVTAGVR	9	Unmodified	_IVVVTAGVR_			0	0	0	P07195	P07195	P07195	LDHB	L-lactate dehydrogenase B chain	MULTI-MSMS	DP1141_7	2	457.295166015625	2	457.295102	912.575651	0.73425	0.00033577	-0.46177	-0.00021116	0.27248	0.0001246	457.2947684917613	16.565	0.22961	16.565	16.415	16.644	0					6	2	3	0	0	0	0.027979	1	8630	8630		77.282	38.491	1	40697000			1250	121	749	783	1693	1693		9606
IVVVTAGVR	9	Unmodified	_IVVVTAGVR_			0	0	0	P07195	P07195	P07195	LDHB	L-lactate dehydrogenase B chain	MULTI-SECPEP	DP1141_9	4	457.75640869140625	2	457.295102	912.575651	-0.47893	-0.00021901	0.62718	0.00028681	0.14825	6.7793E-05	457.2953912730902	16.598	0.23434	16.598	16.458	16.693	0					4	2	2	0	0	0	0.020059	1	8447	8447		96.19	42.839	1	45869000			1251	121	749	783	1694	1694		9606
IWDPTPSHTPAGAATPGR	18	Unmodified	_IWDPTPSHTPAGAATPGR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_6	1	611.308349609375	3	611.307708	1830.9013	0.22497	0.00013752	0.078438	4.795E-05	0.3034	0.00018547	611.6420182725064	16.68	0.31879	16.68	16.505	16.824	0					7	3	3	0	0	0	2.0421E-10	1	8134	8134		158.14	117.59	1	23894000			1252	78	750	784	1695	1695		9606
IWDPTPSHTPAGAATPGR	18	Unmodified	_IWDPTPSHTPAGAATPGR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	611.3079833984375	3	611.307708	1830.9013	0.73724	0.00045068	-0.31857	-0.00019475	0.41867	0.00025594	611.3073390081086	16.627	0.83622	16.627	16.215	17.051	0					24	9	5	0	0	0	8.1137E-45	2	8784	8624;8784		183.75	150.76	1	185420000			1253	78	750	784	1696;1697	1697		9606
IWDPTPSHTPAGAATPGR	18	Unmodified	_IWDPTPSHTPAGAATPGR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	916.959716796875	2	916.457924	1830.9013	0.66228	0.00060695	-0.35193	-0.00032253	0.31035	0.00028442	916.958975785101	16.672	0.32318	16.672	16.415	16.738	0					9	3	3	0	0	0	4.5235E-168	2	8696	8696;8809		225.33	176.14	1	22275000			1254	78	750	784	1698;1699	1698		9606
IWDPTPSHTPAGAATPGR	18	Unmodified	_IWDPTPSHTPAGAATPGR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	611.3078002929688	3	611.307708	1830.9013	0.12153	7.4294E-05	0.15249	9.3219E-05	0.27402	0.00016751	611.307700067128	16.612	0.35826	16.612	16.469	16.828	0					7	3	3	0	0	0	0.0011203	1	8672	8672		127.3	107.62	1	74632000			1255	78	750	784	1700	1700		9606
IWDPTPSHTPAGAATPGR	18	Unmodified	_IWDPTPSHTPAGAATPGR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_9	4	611.2965087890625	3	611.307708	1830.9013	-0.13563	-8.291E-05	-0.78659	-0.00048085	-0.92221	-0.00056376	611.3065224607907	16.733	0.39546	16.733	16.458	16.854	0					13	4	5	0	0	0	6.258E-73	2	8486	8486;8542		200.77	173.75	1	99739000			1256	78	750	784	1701;1702	1701		9606
IWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSAR	37	Unmodified	_IWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSAR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	591.9503173828125	6	591.953685	3545.67845	0.23811	0.00014095	-0.028653	-1.6961E-05	0.20946	0.00012399	592.2879209261666	15.358	0.70526	15.358	15.009	15.714	0					23	6	7	0	0	0	2.3974E-23	2	6493	6493;6623		88.688	72.643	1	345610000			1257	78	751	785	1703;1704	1703		9606
IWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSAR	37	Unmodified	_IWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSAR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	710.5447998046875	5	710.142967	3545.67845	0.24776	0.00017594	0.16482	0.00011705	0.41258	0.00029299	710.3436364670856	15.359	0.40227	15.359	15.109	15.512	0					15	3	5	0	0	0	2.027E-15	1	6631	6631		56.483	43.836	1	276420000			1258	78	751	785	1705	1705		9606
IWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSAR	37	Unmodified	_IWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSAR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-SECPEP	DP1141_7	2	886.9281616210938	4	887.42689	3545.67845	0.024645	2.187E-05	0.14734	0.00013076	0.17199	0.00015263	887.677817709078	15.359	0.40227	15.359	15.109	15.512	0					5	3	2	0	0	0	0.01629	1	6497	6497		39.507	24.108	1	62765000			1259	78	751	785	1706	1706		9606
IWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSAR	37	Unmodified	_IWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSAR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	710.3433837890625	5	710.142967	3545.67845	0.69385	0.00049273	-0.45851	-0.00032561	0.23534	0.00016712	710.3428632977073	15.32	0.50364	15.32	15.172	15.675	0					13	4	6	0	0	0	2.0702E-10	1	6613	6613		51.975	28.228	1	35227000			1260	78	751	785	1707	1707		9606
IWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSAR	37	Unmodified	_IWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSAR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_9	4	710.3374633789062	5	710.142967	3545.67845	0.8954	0.00063586	-0.39485	-0.0002804	0.50054	0.00035546	710.7444309571055	15.34	0.29691	15.34	15.174	15.471	0					8	2	4	0	0	0	2.3984E-15	1	6422	6422		55.425	47.426	1	20044000			1261	78	751	785	1708	1708		9606
IWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSAR	37	Unmodified	_IWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSAR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_9	4	592.2883911132812	6	591.953685	3545.67845	0.57579	0.00034084	-0.19407	-0.00011488	0.38172	0.00022596	592.2879854298365	15.36	0.29691	15.36	15.174	15.471	0					12	2	6	0	0	0	4.2085E-16	1	6504	6504		60.843	50.449	1	32489000			1262	78	751	785	1709	1709		9606
IWHHTFYNELR	11	Unmodified	_IWHHTFYNELR_			0	0	0	P60709;Q6S8J3;P68133;P68032;A5A3E0;Q9BYX7;P0CG38;P0CG39;P63261	P60709;P63261	P60709	ACTB;POTEE;ACTA1;ACTC1;POTEF;POTEKP;POTEI;POTEJ;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;POTE ankyrin domain family member E;Actin, alpha skeletal muscle;Actin, alpha cardiac muscle 1;POTE ankyrin domain family member F;Putative beta-actin-like protein 3;Putative beta-actin-like protein 3, N-terminally processed;POTE ankyrin domain family member I;POTE ankyrin domain family member J;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	MULTI-MSMS	DP1141_9	4	505.92156982421875	3	505.921237	1514.74188	-0.28396	-0.00014366	0.7886	0.00039897	0.50463	0.0002553	505.9217483568608	17.688	0.30007	17.688	17.537	17.837	0					8	2	4	0	0	0	0.0061088	1	10402	10402		88.596	57.381	1	27203000			1263	277;318	752	786	1710	1710		9606
IYAEDPSNNFMPVAGPLVHLSTPR	24	Oxidation (M)	_IYAEDPSNNFM(Oxidation (M))PVAGPLVHLSTPR_	IYAEDPSNNFM(1)PVAGPLVHLSTPR	IYAEDPSNNFM(130)PVAGPLVHLSTPR	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	881.4425048828125	3	881.107484	2640.30062	0.58702	0.00051722	-0.30409	-0.00026794	0.28292	0.00024929	881.4416015101083	20.14	0.58396	20.14	19.806	20.39	0					17	5	6	0	0	0	8.5579E-08	1	13639	13639		132.48	108.57	1	54262000			1264	521	753	787	1711	1711	372	9606
IYAEDPSNNFMPVAGPLVHLSTPR	24	Oxidation (M)	_IYAEDPSNNFM(Oxidation (M))PVAGPLVHLSTPR_	IYAEDPSNNFM(1)PVAGPLVHLSTPR	IYAEDPSNNFM(110)PVAGPLVHLSTPR	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_7	2	881.77685546875	3	881.107484	2640.30062	0.55532	0.00048929	-0.20496	-0.00018059	0.35036	0.0003087	881.4418280280337	20.1	0.50071	20.1	19.85	20.351	0					14	4	6	0	0	0	3.678E-10	2	14226	14101;14226		106.02	73.296	1	50767000			1265	521	753	787	1712;1713	1713	372	9606
IYAEDPSNNFMPVAGPLVHLSTPR	24	Oxidation (M)	_IYAEDPSNNFM(Oxidation (M))PVAGPLVHLSTPR_	IYAEDPSNNFM(1)PVAGPLVHLSTPR	IYAEDPSNNFM(120)PVAGPLVHLSTPR	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	881.44091796875	3	881.107484	2640.30062	0.50648	0.00044627	-0.53589	-0.00047217	-0.029402	-2.5906E-05	881.4413450568346	20.126	0.90142	20.126	19.576	20.477	0					21	8	4	0	0	0	5.8578E-08	3	13971	13971;14040;14338		123.32	95.768	1	332670000			1266	521	753	787	1714;1715;1716	1714	372	9606
IYAEDPSNNFMPVAGPLVHLSTPR	24	Oxidation (M)	_IYAEDPSNNFM(Oxidation (M))PVAGPLVHLSTPR_	IYAEDPSNNFM(1)PVAGPLVHLSTPR	IYAEDPSNNFM(100)PVAGPLVHLSTPR	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_9	4	881.7762451171875	3	881.107484	2640.30062	0.73247	0.00064538	-0.31304	-0.00027582	0.41942	0.00036956	881.441253974148	20.086	0.39827	20.086	19.838	20.237	0					10	3	4	0	0	0	4.6579E-07	2	14080	13892;14080		102.92	78.278	1	33936000			1267	521	753	787	1717;1718	1718	372	9606
IYAEDPSNNFMPVAGPLVHLSTPR	24	Unmodified	_IYAEDPSNNFMPVAGPLVHLSTPR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	876.1105346679688	3	875.775846	2624.30571	0.89632	0.00078498	-0.81969	-0.00071787	0.076632	6.7113E-05	876.1097367285028	21.096	0.4339	21.096	20.862	21.296	0					11	4	4	0	0	0	0.0013683	1	15214	15214		62.589	41.219	1	9184800			1268	521	753	788	1719	1719		9606
IYAEDPSNNFMPVAGPLVHLSTPR	24	Unmodified	_IYAEDPSNNFMPVAGPLVHLSTPR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_7	2	876.4446411132812	3	875.775846	2624.30571	0.65095	0.00057009	0.16431	0.0001439	0.81526	0.00071399	876.4445555835927	21.081	0.49988	21.081	20.85	21.35	0					9	4	4	0	0	0	0.00045091	1	15706	15706		77.681	54.384	1	19027000			1269	521	753	788	1720	1720		9606
IYAEDPSNNFMPVAGPLVHLSTPR	24	Unmodified	_IYAEDPSNNFMPVAGPLVHLSTPR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	876.1102905273438	3	875.775846	2624.30571	0.54124	0.00047401	-0.37935	-0.00033223	0.16189	0.00014178	876.1100046980043	21.128	0.70083	21.128	20.678	21.379	0					20	6	6	0	0	0	1.0597E-07	2	15504	15396;15504		132.36	117.13	1	115170000			1270	521	753	788	1721;1722	1722		9606
IYAEDPSNNFMPVAGPLVHLSTPR	24	Unmodified	_IYAEDPSNNFMPVAGPLVHLSTPR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_9	4	876.4454345703125	3	875.775846	2624.30571	0.57472	0.00050333	0.46217	0.00040476	1.0369	0.00090809	876.1104441263427	21.087	0.30082	21.087	20.837	21.138	0					4	2	2	0	0	0	0.00015346	1	15551	15551		90.884	72.123	1	14763000			1271	521	753	788	1723	1723		9606
IYGFYDECK	9	Unmodified	_IYGFYDECK_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-SECPEP	DP1141_8	3	597.3089599609375	2	597.760432	1193.50631	0.57747	0.00034519	0.16215	9.6925E-05	0.73962	0.00044211	597.7605461882148	18.725	0.30068	18.725	18.575	18.876	0					4	2	2	0	0	0	0.020811	1	11824	11824		122.18	83.4	1	1259000000			1272	286;212;287	754	789	1724	1724		9606
IYGFYDECK	9	Unmodified	_IYGFYDECK_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_9	4	598.046630859375	2	597.760432	1193.50631	0.1197	7.155E-05	0.57786	0.00034542	0.69756	0.00041697	597.7608086570644	18.687	0.40004	18.687	18.537	18.937	0					10	3	4	0	0	0	9.789899999999999E-80	3	11980	11980;12005;12010		204.65	189.98	1	135310000			1273	286;212;287	754	789	1725;1726;1727	1725		9606
IYGFYDECKR	10	Unmodified	_IYGFYDECKR_			0	0	1	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_9	4	451.2110290527344	3	450.876417	1349.60742	-0.40627	-0.00018318	0.44376	0.00020008	0.037489	1.6903E-05	450.8767931148242	17.387	0.49974	17.387	17.138	17.638	0					12	4	4	0	0	0	0.0044697	1	9869	9869		140.11	118.74	1	370600000			1274	286;212;287	755	790	1728	1728		9606
IYNDDKNTYIR	11	Unmodified	_IYNDDKNTYIR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	708.3366088867188	2	707.851698	1413.68884	0.41024	0.00029039	-0.21218	-0.00015019	0.19806	0.0001402	707.8515818266102	15.459	0.50524	15.459	15.309	15.815	0					6	4	2	0	0	0	4.0273999999999995E-65	2	6788	6693;6788		173.39	110.81	1	206920000			1275	78	756	791	1729;1730	1730		9606
IYNDDKNTYIR	11	Unmodified	_IYNDDKNTYIR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-SECPEP	DP1141_7	2	471.8960266113281	3	472.236891	1413.68884	0.25827	0.00012197	-0.2378	-0.0001123	0.020475	9.6691E-06	472.23695951659056	15.459	0.50524	15.459	15.309	15.815	0					13	4	4	0	0	0	1.1289E-09	1	6790	6790		197.79	118.3	1	907830000			1276	78	756	791	1731	1731		9606
IYNDDKNTYIR	11	Unmodified	_IYNDDKNTYIR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-SECPEP	DP1141_9	4	471.7317199707031	3	472.236891	1413.68884	0.42111	0.00019886	0.17185	8.1156E-05	0.59296	0.00028002	472.2371681653396	15.419	0.59776	15.419	15.075	15.673	0					9	5	3	0	0	0	0.00012943	1	6583	6583		187.99	113.83	1	5425100			1277	78	756	791	1732	1732		9606
IYNSIYIGSQDALIAHYPR	19	Unmodified	_IYNSIYIGSQDALIAHYPR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	732.3826904296875	3	732.047894	2193.12185	0.43578	0.00031901	-0.19415	-0.00014213	0.24163	0.00017688	732.3819499772864	20.1	0.60073	20.1	19.85	20.451	0					19	5	5	0	0	0	2.9166E-07	5	14289	14078;14248;14289;14327;14345		161.08	122.58	1	353370000			1278	78	757	792	1733;1734;1735;1736;1737	1735		9606
IYNSIYIGSQDALIAHYPR	19	Unmodified	_IYNSIYIGSQDALIAHYPR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MSMS	DP1141_7	2	732.048583984375	3	732.047894	2193.12185	NaN	NaN	NaN	NaN	NaN	NaN	NaN	36.729	1	36.729	36.229	37.229	0								0	0	0	0.0047508	1	34220	34220		87.388	59.321	1				1279	78	757	792	1738	1738		9606
KAALDEAQGVGLDSTGYYDQEIYGGSDSR	29	Unmodified	_KAALDEAQGVGLDSTGYYDQEIYGGSDSR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	1023.1399536132812	3	1022.47053	3064.38977	0.27512	0.0002813	0.56077	0.00057337	0.8359	0.00085468	1023.1394233856331	19.401	0.70011	19.401	19.05	19.75	0					10	6	4	0	0	0	8.711E-05	1	13282	13282		53.722	36.564	1	61022000			1280	78	758	793	1739	1739		9606
KAEAGAGSATEFQFR	15	Unmodified	_KAEAGAGSATEFQFR_			0	0	1	P46783;Q9NQ39	P46783	P46783	RPS10;RPS10P5	40S ribosomal protein S10;Putative 40S ribosomal protein S10-like	MULTI-MSMS	DP1141_10	5	523.7250366210938	3	523.926716	1568.75832	0.057722	3.0242E-05	0.66303	0.00034738	0.72075	0.00037762	524.2614746619735	16.835	0.2782	16.835	16.727	17.005	0					10	4	3	0	0	0	0.01765	1	9364	9364		48.899	21.929	1	32732000			1281	238	759	794	1740	1740		9606
KAEGEPQEESPLK	13	Unmodified	_KAEGEPQEESPLK_			0	0	1	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_6	1	481.5782165527344	3	481.243823	1440.70964	0.083028	3.9957E-05	0.41316	0.00019883	0.49618	0.00023879	481.24397742593675	14.335	0.79767	14.335	13.811	14.609	0					16	8	4	0	0	0	0.0037468	1	4421	4421		97.631	54.129	1	2012400			1282	580	760	795	1741	1741		9606
KAEGEPQEESPLK	13	Unmodified	_KAEGEPQEESPLK_			0	0	1	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_6	1	721.3610229492188	2	721.362096	1440.70964	0.29923	0.00021585	0.49562	0.00035752	0.79485	0.00057338	721.3624629617163	14.359	0.35459	14.359	14.054	14.409	0					6	3	2	0	0	0	2.4786E-20	1	4475	4475		196.27	81.867	1	1373700			1283	580	760	795	1742	1742		9606
KAEGEPQEESPLK	13	Unmodified	_KAEGEPQEESPLK_			0	0	1	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_7	2	481.24395751953125	3	481.243823	1440.70964	0.60731	0.00029226	0.080498	3.8739E-05	0.6878	0.000331	481.2438164763501	14.265	0.56132	14.265	13.947	14.508	0					16	5	4	0	0	0	0.0012842	1	4931	4931		122.97	66.014	1	17837000			1284	580	760	795	1743	1743		9606
KAEVNTIPGFDGVVK	15	Unmodified	_KAEVNTIPGFDGVVK_			0	0	1	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_6	1	525.2940673828125	3	525.290996	1572.85116	1.0042	0.00052752	0.79316	0.00041664	1.7974	0.00094416	525.6252183450945	18.255	0.2998	18.255	18.005	18.305	0					8	2	4	0	0	0	0.023452	1	10702	10702		70.373	45.408	1	23559000			1285	110	761	796	1744	1744		9606
KAEVNTIPGFDGVVK	15	Unmodified	_KAEVNTIPGFDGVVK_			0	0	1	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-SECPEP	DP1141_8	3	524.7685546875	3	525.290996	1572.85116	0.2762	0.00014509	0.12045	6.3272E-05	0.39666	0.00020836	525.6254067935151	18.214	0.5009	18.214	17.874	18.375	0					13	4	4	0	0	0	2.9985E-06	1	11124	11124		131.08	110.34	1	80126000			1286	110	761	796	1745	1745		9606
KAGNFYVPAEPK	12	Unmodified	_KAGNFYVPAEPK_			0	0	1	P18124	P18124	P18124	RPL7	60S ribosomal protein L7	MULTI-MSMS	DP1141_10	5	661.311279296875	2	660.85097	1319.68739	-0.10057	-6.6464E-05	1.0187	0.00067323	0.91816	0.00060677	660.8514392115061	16.216	0.39521	16.216	15.968	16.363	0					5	3	2	0	0	0	0.014666	1	8456	8456		128.51	83.491	1	24301000			1287	167	762	797	1746	1746		9606
KAGTATSPAGSSPAVAGGTQR	21	Unmodified	_KAGTATSPAGSSPAVAGGTQR_			0	0	1	Q13428	Q13428	Q13428	TCOF1	Treacle protein	MULTI-MSMS	DP1141_7	2	624.9918823242188	3	624.657177	1870.9497	0.38243	0.00023889	0.14828	9.2627E-05	0.53071	0.00033151	624.9916779942981	13.426	0.79642	13.426	12.823	13.62	0					12	7	3	0	0	0	0.0015828	2	3834	3738;3834		91.774	52.389	1	903940			1288	373	763	798	1747;1748	1748		9606
KAIVICPTDEDLKDR	15	Unmodified	_KAIVICPTDEDLKDR_			0	0	2	Q9BUJ2	Q9BUJ2	Q9BUJ2	HNRNPUL1	Heterogeneous nuclear ribonucleoprotein U-like protein 1	MULTI-MSMS	DP1141_7	2	592.3270263671875	3	591.645221	1771.91383	0.857	0.00050704	-0.38903	-0.00023017	0.46797	0.00027687	591.9792680657353	16.165	0.5	16.165	15.815	16.315	0					8	4	3	0	0	0	0.0041243	1	7919	7919		110.55	80.441	1	19309000			1289	540	764	799	1749	1749		9606
KASGPPVSELITK	13	Unmodified	_KASGPPVSELITK_			0	0	1	P16403;P10412;P16402	P16403	P16403	HIST1H1C;HIST1H1E;HIST1H1D	Histone H1.2;Histone H1.4;Histone H1.3	MULTI-MSMS	DP1141_9	4	443.2601623535156	3	442.925765	1325.75547	-0.22568	-9.9959E-05	0.46029	0.00020387	0.23461	0.00010392	442.92578540616415	16.508	0.72362	16.508	16.058	16.782	0					17	7	3	0	0	0	0.00047004	2	8333	8167;8333		132.31	88.01	1	125750000			1290	157	765	800	1750;1751	1751		9606
KASGPPVSELITK	13	Unmodified	_KASGPPVSELITK_			0	0	1	P16403;P10412;P16402	P16403	P16403	HIST1H1C;HIST1H1E;HIST1H1D	Histone H1.2;Histone H1.4;Histone H1.3	MULTI-MSMS	DP1141_9	4	663.88525390625	2	663.88501	1325.75547	0.98142	0.00065155	-0.54141	-0.00035944	0.44001	0.00029211	663.8845721554374	16.508	0.56209	16.508	16.058	16.62	0					9	5	2	0	0	0	0.0039488	1	8366	8366		138.2	101.89	1	66782000			1291	157	765	800	1752	1752		9606
KATATISAKPQITNPK	16	Unmodified	_KATATISAKPQITNPK_			0	0	2	Q9Y2W2	Q9Y2W2	Q9Y2W2	WBP11	WW domain-binding protein 11	MULTI-MSMS	DP1141_8	3	556.9922485351562	3	556.99295	1667.95702	-0.07	-3.899E-05	0.6114	0.00034055	0.5414	0.00030156	557.3274136409349	14.189	0.46319	14.189	13.805	14.268	0					9	5	3	0	0	0	0.0033697	1	4734	4734		139.21	77.478	1	3470900			1292	613	766	801	1753	1753		9606
KAYVEANQMLGDLIK	15	Oxidation (M)	_KAYVEANQM(Oxidation (M))LGDLIK_	KAYVEANQM(1)LGDLIK	KAYVEANQM(110)LGDLIK	0	1	1	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	570.3032836914062	3	570.302795	1707.88656	0.32943	0.00018788	0.03319	1.8928E-05	0.36262	0.00020681	570.3029267513443	18.298	0.4002	18.298	17.949	18.349	0					11	3	5	0	0	0	0.0024688	3	11411	11342;11366;11411		110.57	74.763	1	81737000			1293	142	767	802	1754;1755;1756	1756	136	9606
KAYVEANQMLGDLIK	15	Oxidation (M)	_KAYVEANQM(Oxidation (M))LGDLIK_	KAYVEANQM(1)LGDLIK	KAYVEANQM(110)LGDLIK	0	1	1	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	855.4534301757812	2	854.950555	1707.88656	0.34969	0.00029897	0.2317	0.00019809	0.5814	0.00049706	854.950837993597	18.299	0.30011	18.299	18.049	18.349	0					6	2	3	0	0	0	0.02559	1	11432	11432		109.6	63.947	1	37913000			1294	142	767	802	1757	1757	136	9606
KEEGLPEEEPSHVTGR	16	Unmodified	_KEEGLPEEEPSHVTGR_			0	0	1	P17098	P17098	P17098	ZNF8	Zinc finger protein 8	MULTI-MSMS	DP1141_8	3	599.6146850585938	3	598.626995	1792.85916	0.46079	0.00027584	-0.12448	-7.452E-05	0.3363	0.00020132	598.6271168303748	14.809	0.36359	14.809	14.509	14.873	0					9	3	4	0	0	0	0.0017349	2	5655	5587;5655		128.82	95.069	1	7015000			1295	162	768	803	1758;1759	1759		9606
KFEEEGNPYYSSAR	14	Unmodified	_KFEEEGNPYYSSAR_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_10	5	559.7557373046875	3	559.589881	1675.74781	1.1102	0.00062128	-1.0248	-0.00057348	0.08542	4.78E-05	559.5894400611612	16.116	0.48482	16.116	15.781	16.266	0					8	4	3	0	0	0	0.00088929	1	8253	8253		141.54	112.63	1	167120000			1296	567	769	804	1760	1760		9606
KFEEEGNPYYSSAR	14	Unmodified	_KFEEEGNPYYSSAR_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_6	1	560.2515869140625	3	559.589881	1675.74781	-0.019971	-1.1176E-05	0.65119	0.0003644	0.63122	0.00035322	559.5902679806862	16.155	0.8246	16.155	15.905	16.729	0					12	8	3	0	0	0	3.4688E-14	1	7180	7180		162.94	136.65	1	111750000			1297	567	769	804	1761	1761		9606
KFEEEGNPYYSSAR	14	Unmodified	_KFEEEGNPYYSSAR_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-SECPEP	DP1141_7	2	560.3119506835938	3	559.589881	1675.74781	0.41437	0.00023188	-0.047019	-2.6311E-05	0.36735	0.00020556	559.5897975752548	16.165	0.30021	16.165	15.914	16.215	0					4	2	2	0	0	0	0.0033358	1	7794	7794		98.253	98.253	1	73892000			1298	567	769	804	1762	1762		9606
KFEEEGNPYYSSAR	14	Unmodified	_KFEEEGNPYYSSAR_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	559.9240112304688	3	559.589881	1675.74781	-0.2181	-0.00012204	0.44973	0.00025167	0.23164	0.00012962	559.5905943347938	16.126	0.40036	16.126	15.876	16.276	0					12	3	4	0	0	0	6.9474E-09	1	7811	7811		155.43	116.43	1	1900399999.9999998			1299	567	769	804	1763	1763		9606
KFGDPVVQSDMK	12	Oxidation (M)	_KFGDPVVQSDM(Oxidation (M))K_	KFGDPVVQSDM(1)K	KFGDPVVQSDM(64)K	0	1	1	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MSMS	DP1141_10	5	456.2334899902344	3	456.227227	1365.65985	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.194	1	15.194	14.694	15.694	0								0	0	0	0.030573	1	6648	6648		63.662	29.792	1				1300	135	770	805	1764	1764	127	9606
KFGDPVVQSDMK	12	Oxidation (M)	_KFGDPVVQSDM(Oxidation (M))K_	KFGDPVVQSDM(1)K	KFGDPVVQSDM(140)K	0	1	1	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-MSMS	DP1141_8	3	684.3536987304688	2	683.837202	1365.65985	0.95831	0.00065533	-0.13427	-9.182E-05	0.82404	0.00056351	683.8371011756032	15.221	0.3978	15.221	14.972	15.37	0					7	3	3	0	0	0	0.0067857	2	6247	6247;6308		142.19	99.906	1	45114000			1301	135	770	805	1765;1766	1765	127	9606
KFGDPVVQSDMK	12	Oxidation (M)	_KFGDPVVQSDM(Oxidation (M))K_	KFGDPVVQSDM(1)K	KFGDPVVQSDM(86)K	0	1	1	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-MSMS	DP1141_8	3	456.22747802734375	3	456.227227	1365.65985	0.3511	0.00016018	0.2243	0.00010233	0.5754	0.00026251	456.2272918247742	15.221	1.0009	15.221	14.674	15.675	0					13	9	2	0	0	0	0.0046209	1	6306	6306		85.554	51.684	1	76991000			1302	135	770	805	1767	1767	127	9606
KFGDPVVQSDMK	12	Oxidation (M)	_KFGDPVVQSDM(Oxidation (M))K_	KFGDPVVQSDM(1)K	KFGDPVVQSDM(61)K	0	1	1	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MSMS	DP1141_9	4	456.24481201171875	3	456.227227	1365.65985	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.216	1	15.216	14.716	15.716	0								0	0	0	0.031607	1	6173	6173		61.03	24.709	1				1303	135	770	805	1768	1768	127	9606
KFLDGIYVSEK	11	Unmodified	_KFLDGIYVSEK_			0	0	1	P32969	P32969	P32969	RPL9	60S ribosomal protein L9	MSMS	DP1141_10	5	433.78875732421875	3	433.571211	1297.6918	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.232	1	18.232	17.732	18.732	0								0	0	0	0.017073	1	11690	11690		71.085	35.562	1				1304	203	771	806	1769	1769		9606
KFVIHPESNNLIIIETDHNAYTEATK	26	Unmodified	_KFVIHPESNNLIIIETDHNAYTEATK_			0	0	1	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_7	2	1000.1839599609375	3	999.848727	2996.52435	0.12346	0.00012344	0.2892	0.00028916	0.41266	0.0004126	1000.5173608545788	18.982	0.40057	18.982	18.75	19.15	0					9	3	4	0	0	0	0.0088144	1	12622	12622		45.126	24.401	1	10747000			1305	402	772	807	1770	1770		9606
KFVIHPESNNLIIIETDHNAYTEATK	26	Unmodified	_KFVIHPESNNLIIIETDHNAYTEATK_			0	0	1	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_7	2	750.3895874023438	4	750.138364	2996.52435	0.46567	0.00034932	-0.1758	-0.00013188	0.28987	0.00021744	750.3890032550296	19	0.701	19	18.75	19.451	0					13	6	4	0	0	0	0.010389	1	12664	12664		40.986	24.365	1	73581000			1306	402	772	807	1771	1771		9606
KGHAVGDIPGVR	12	Unmodified	_KGHAVGDIPGVR_			0	0	1	P62266	P62266	P62266	RPS23	40S ribosomal protein S23	MULTI-MSMS	DP1141_10	5	402.5633544921875	3	402.563161	1204.66765	0.38696	0.00015578	0.034787	1.4004E-05	0.42175	0.00016978	402.5631346562347	14.702	0.59122	14.702	14.215	14.806	0					18	8	4	0	0	0	0.001799	2	5872	5788;5872		115.92	33.275	1	65085000			1307	292	773	808	1772;1773	1773		9606
KGHAVGDIPGVR	12	Unmodified	_KGHAVGDIPGVR_			0	0	1	P62266	P62266	P62266	RPS23	40S ribosomal protein S23	MULTI-MSMS	DP1141_6	1	402.56329345703125	3	402.563161	1204.66765	-0.88185	-0.000355	1.1988	0.00048258	0.31691	0.00012758	402.5636081780994	14.85	0.59931	14.85	14.409	15.008	0					9	5	2	0	0	0	0.0041533	1	5178	5178		87.719	8.7852	1	2852400			1308	292	773	808	1774	1774		9606
KGMSHEPK	8	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))KGM(Oxidation (M))SHEPK_	KGM(1)SHEPK	KGM(41)SHEPK	1	1	1	Q14687	Q14687	Q14687	GSE1	Genetic suppressor element 1	MSMS	DP1141_7	2	485.7455139160156	2	486.234384	970.454216	NaN	NaN	NaN	NaN	NaN	NaN	NaN	24.792	1	24.792	24.292	25.292	0								0	0	0	0.035106	1	21087	21087		41.029	11.653	1				1309	391	774	809	1775	1775	301	9606
KGTHFVQLCCQR	12	Unmodified	_KGTHFVQLCCQR_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_10	5	511.8036193847656	3	511.918622	1532.73404	0.26614	0.00013624	0.048363	2.4758E-05	0.3145	0.000161	511.9188515320834	15.083	0.46296	15.083	14.736	15.199	0					10	5	3	0	0	0	8.6945E-07	1	6443	6443		154.15	123.29	1	47708000			1310	567	775	810	1776	1776		9606
KGTHFVQLCCQR	12	Unmodified	_KGTHFVQLCCQR_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	512.9005126953125	3	511.918622	1532.73404	0.7138	0.00036541	-0.52548	-0.000269	0.18832	9.6406E-05	511.9188797127684	15.122	0.49969	15.122	14.972	15.472	0					10	4	4	0	0	0	0.0017714	2	6164	6164;6272		132.86	106.33	1	904770000			1311	567	775	810	1777;1778	1777		9606
KGTHFVQLCCQR	12	Unmodified	_KGTHFVQLCCQR_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-SECPEP	DP1141_8	3	767.3749389648438	2	767.374294	1532.73404	0.76237	0.00058503	0.012461	9.5624E-06	0.77484	0.00059459	767.3744457846103	15.122	0.39803	15.122	14.873	15.271	0					8	3	3	0	0	0	0.028353	1	6285	6285		72.79	45.461	1	85109000			1312	567	775	810	1779	1779		9606
KGTHFVQLCCQR	12	Unmodified	_KGTHFVQLCCQR_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	511.6058349609375	3	511.918622	1532.73404	0.17487	8.9521E-05	-0.35387	-0.00018115	-0.179	-9.1632E-05	511.91868168528674	15.124	0.58409	15.124	14.887	15.471	0					11	5	4	0	0	0	1.9043E-09	1	6122	6122		156.51	121.5	1	122170000			1313	567	775	810	1780	1780		9606
KHVTTAEGTPGTTDQEGPPPDGPPEKR	27	Unmodified	_KHVTTAEGTPGTTDQEGPPPDGPPEKR_			0	0	2	O14497	O14497	O14497	ARID1A	AT-rich interactive domain-containing protein 1A	MULTI-MSMS	DP1141_7	2	700.8449096679688	4	700.594055	2798.34711	1.2257	0.00085874	-0.24557	-0.00017205	0.98016	0.00068669	700.8446911523762	14.062	0.4473	14.062	13.861	14.309	0					10	4	4	0	0	0	0.0064142	1	4677	4677		44.184	30.709	1	5284800			1314	41	776	811	1781	1781		9606
KIAPYVAHNFSK	12	Unmodified	_KIAPYVAHNFSK_			0	0	1	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	688.001953125	2	687.880062	1373.74557	0.262	0.00018022	0.98817	0.00067974	1.2502	0.00085997	687.8805712581868	15.26	0.3	15.26	15.109	15.409	0					4	2	2	0	0	0	1.5628E-08	1	6501	6501		157.97	122.82	1	10535000			1315	142	777	812	1782	1782		9606
KIAPYVAHNFSK	12	Unmodified	_KIAPYVAHNFSK_			0	0	1	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	458.90899658203125	3	458.922467	1373.74557	0.054661	2.5085E-05	0.42985	0.00019727	0.48451	0.00022235	458.92268091273814	15.26	0.40227	15.26	15.109	15.512	0					8	3	3	0	0	0	1.0771E-14	2	6514	6514;6598		163.45	135.21	1	174510000			1316	142	777	812	1783;1784	1783		9606
KIDKYTEVLK	10	Unmodified	_KIDKYTEVLK_			0	0	2	P40429	P40429	P40429	RPL13A	60S ribosomal protein L13a	MULTI-MSMS	DP1141_10	5	412.858642578125	3	412.911456	1235.71254	0.33224	0.00013719	-0.048183	-1.9895E-05	0.28406	0.00011729	412.911432128761	15.415	0.33421	15.415	15.199	15.533	0					5	3	2	0	0	0	0.0054403	1	7002	7002		101.3	64.231	1	37182000			1317	221	778	813	1785	1785		9606
KIGEEEIQKPEEK	13	Unmodified	_KIGEEEIQKPEEK_			0	0	2	Q15459	Q15459	Q15459	SF3A1	Splicing factor 3A subunit 1	MULTI-MSMS	DP1141_7	2	519.6104125976562	3	519.610394	1555.80935	0.39519	0.00020534	0.50092	0.00026028	0.8961	0.00046562	519.6105608987685	14.078	0.43062	14.078	13.78	14.21	0					12	4	4	0	0	0	0.0040828	1	4682	4682		104.81	53.713	1	27367000			1318	405	779	814	1786	1786		9606
KIGEEEIQKPEEK	13	Unmodified	_KIGEEEIQKPEEK_			0	0	2	Q15459	Q15459	Q15459	SF3A1	Splicing factor 3A subunit 1	MULTI-MSMS	DP1141_8	3	519.944580078125	3	519.610394	1555.80935	-0.034529	-1.7942E-05	0.14349	7.4561E-05	0.10897	5.6619E-05	519.6103937978082	14.086	0.29465	14.086	13.884	14.179	0					10	3	4	0	0	0	1.3875000000000002E-29	2	4605	4605;4628		182.37	133.18	1	19347000			1319	405	779	814	1787;1788	1787		9606
KIHNANPELTDGQIQAMLR	19	Oxidation (M)	_KIHNANPELTDGQIQAM(Oxidation (M))LR_	KIHNANPELTDGQIQAM(1)LR	KIHNANPELTDGQIQAM(140)LR	0	1	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	542.0340576171875	4	542.033748	2164.10589	-0.0076857	-4.1659E-06	0.29188	0.00015821	0.28419	0.00015404	542.0339819758767	16.914	0.59905	16.914	16.405	17.004	0					19	7	4	0	0	0	0.00022956	1	8575	8575		135.55	113.12	1	48538000			1320	367	780	815	1789	1789	270	9606
KIHPQTIIAGWR	12	Unmodified	_KIHPQTIIAGWR_			0	0	1	P78371	P78371	P78371	CCT2	T-complex protein 1 subunit beta	MULTI-SECPEP	DP1141_8	3	473.9201965332031	3	473.945494	1418.81465	0.43691	0.00020707	-0.15668	-7.4258E-05	0.28023	0.00013281	474.27978407348155	17.634	0.40012	17.634	17.374	17.774	0					7	3	3	0	0	0	0.0039224	1	10239	10239		132.56	94.952	1	23096000			1321	328	781	816	1790	1790		9606
KIYPTVNCQPLGMISLMK	18	Oxidation (M)	_KIYPTVNCQPLGM(Oxidation (M))ISLMK_	KIYPTVNCQPLGM(0.5)ISLM(0.5)K	KIYPTVNCQPLGM(0)ISLM(0)K	0	1	1	P01042	P01042	P01042	KNG1	Kininogen-1;Kininogen-1 heavy chain;T-kinin;Bradykinin;Lysyl-bradykinin;Kininogen-1 light chain;Low molecular weight growth-promoting factor	MSMS	DP1141_8	3	703.7044677734375	3	703.701685	2108.08322	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.001	1	15.001	14.501	15.501	0								0	0	0	0.031149	1	5949	5949		56.746	24.196	2				1322	98	782	817	1791	1791	81;82	9606
KKPLDGEYFTLQIR	14	Unmodified	_KKPLDGEYFTLQIR_			0	0	2	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MULTI-MSMS	DP1141_8	3	569.986083984375	3	569.985795	1706.93556	0.073988	4.2172E-05	0.52858	0.00030128	0.60257	0.00034346	569.9860945670719	18.725	0.40073	18.725	18.475	18.876	0					7	3	3	0	0	0	0.011157	1	12082	12082		73.386	42.843	1	96604000			1323	104	783	818	1792	1792		9606
KKPLDGEYFTLQIR	14	Unmodified	_KKPLDGEYFTLQIR_			0	0	2	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MULTI-MSMS	DP1141_9	4	570.6406860351562	3	569.985795	1706.93556	0.11751	6.6978E-05	0.43225	0.00024638	0.54976	0.00031335	569.9860076697407	18.787	0.50033	18.787	18.537	19.037	0					15	4	5	0	0	0	1.8164E-81	2	11965	11965;12084		172.58	152.35	1	96957000			1324	104	783	818	1793;1794	1793		9606
KKPLFITTDSSK	12	Unmodified	_KKPLFITTDSSK_			0	0	2	Q7LBC6	Q7LBC6	Q7LBC6	KDM3B	Lysine-specific demethylase 3B	MULTI-SECPEP	DP1141_7	2	455.2762451171875	3	455.597649	1363.77112	0.19782	9.0125E-05	0.78833	0.00035916	0.98615	0.00044929	455.93312174094626	14.759	0.40096	14.759	14.608	15.009	0					7	3	3	0	0	0	0.032332	1	5747	5747		85.672	49.001	1	5572900			1325	447	784	819	1795	1795		9606
KLAAAEGLEPK	11	Unmodified	_KLAAAEGLEPK_			0	0	1	Q6NXS1;P41236	Q6NXS1	Q6NXS1	PPP1R2P3;PPP1R2	Protein phosphatase inhibitor 2-like protein 3;Protein phosphatase inhibitor 2	MULTI-MSMS	DP1141_10	5	563.8272705078125	2	563.826963	1125.63937	0.76193	0.0004296	-0.47527	-0.00026797	0.28667	0.00016163	563.8266381491298	15.157	0.56157	15.157	14.806	15.368	0					15	6	4	0	0	0	2.2222E-09	2	6494	6494;6548		161.51	70.911	1	97692000			1326	224	785	820	1796;1797	1796		9606
KLAAAEGLEPK	11	Unmodified	_KLAAAEGLEPK_			0	0	1	Q6NXS1;P41236	Q6NXS1	Q6NXS1	PPP1R2P3;PPP1R2	Protein phosphatase inhibitor 2-like protein 3;Protein phosphatase inhibitor 2	MULTI-MSMS	DP1141_9	4	563.8270263671875	2	563.826963	1125.63937	0.49329	0.00027813	-0.31284	-0.00017639	0.18046	0.00010175	563.82678684585	15.124	0.38713	15.124	14.887	15.274	0					6	3	2	0	0	0	0.0010781	1	6104	6104		147.3	87.284	1	11678000			1327	224	785	820	1798	1798		9606
KLASQGDSISSQLGPIHPPPR	21	Unmodified	_KLASQGDSISSQLGPIHPPPR_			0	0	1	Q92945	Q92945	Q92945	KHSRP	Far upstream element-binding protein 2	MULTI-MSMS	DP1141_8	3	547.2575073242188	4	547.048555	2184.16511	0.64104	0.00035068	-0.26672	-0.00014591	0.37432	0.00020477	547.0484953010298	17.161	0.64629	17.161	16.828	17.474	0					9	6	3	0	0	0	0.0011726	1	9374	9374		81.51	64.425	1	15493000			1328	500	786	821	1799	1799		9606
KLAVNMVPFPR	11	Oxidation (M)	_KLAVNM(Oxidation (M))VPFPR_	KLAVNM(1)VPFPR	KLAVNM(72)VPFPR	0	1	1	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	MULTI-MSMS	DP1141_8	3	429.91302490234375	3	429.912914	1286.71691	0.22117	9.5084E-05	-0.30243	-0.00013002	-0.081262	-3.4935E-05	429.912842001913	17.524	0.60087	17.524	17.273	17.874	0					10	5	3	0	0	0	0.014995	2	10122	10122;10199		72.434	50.675	1	107880000			1329	122;323;381;376	787	822	1800;1801	1800	110	9606
KLAVNMVPFPR	11	Oxidation (M)	_KLAVNM(Oxidation (M))VPFPR_	KLAVNM(1)VPFPR	KLAVNM(73)VPFPR	0	1	1	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	MULTI-MSMS	DP1141_9	4	429.9129943847656	3	429.912914	1286.71691	0.238	0.00010232	-0.17687	-7.604E-05	0.061128	2.628E-05	429.9128467861456	17.588	0.49986	17.588	17.338	17.837	0					9	4	4	0	0	0	0.013138	1	10087	10087		73.499	57.96	1	39573000			1330	122;323;381;376	787	822	1802	1802	110	9606
KLAVNMVPFPR	11	Oxidation (M)	_KLAVNM(Oxidation (M))VPFPR_	KLAVNM(1)VPFPR	KLAVNM(73)VPFPR	0	1	1	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	MULTI-SECPEP	DP1141_9	4	644.6683349609375	2	644.365733	1286.71691	0.67606	0.00043563	-0.22035	-0.00014199	0.4557	0.00029364	644.3655470009852	17.545	0.49986	17.545	17.338	17.837	0					7	4	3	0	0	0	0.020397	1	9958	9958		72.879	34.312	1	8388400			1331	122;323;381;376	787	822	1803	1803	110	9606
KLFIGGLSFETTDESLR	17	Unmodified	_KLFIGGLSFETTDESLR_			0	0	1	P09651;Q32P51	P09651	P09651	HNRNPA1;HNRNPA1L2	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2	MSMS	DP1141_10	5	638.6735229492188	3	638.338674	1911.99419	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.771	1	20.771	20.271	21.271	0								0	0	0	0.02491	1	15598	15598		54.974	28.682	1				1332	130	788	823	1804	1804		9606
KLFIGGLSFETTDESLR	17	Unmodified	_KLFIGGLSFETTDESLR_			0	0	1	P09651;Q32P51	P09651	P09651	HNRNPA1;HNRNPA1L2	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2	MULTI-MSMS	DP1141_9	4	638.67333984375	3	638.338674	1911.99419	0.57518	0.00036716	0.16619	0.00010608	0.74136	0.00047324	638.6730441254086	20.767	0.60095	20.767	20.437	21.037	0					14	5	4	0	0	0	8.7455E-145	2	15072	15072;15206		197.29	169.86	1	34690000			1333	130	788	823	1805;1806	1805		9606
KLFIGGLSFETTEESLR	17	Unmodified	_KLFIGGLSFETTEESLR_			0	0	1	P22626	P22626	P22626	HNRNPA2B1	Heterogeneous nuclear ribonucleoproteins A2/B1	MULTI-MSMS	DP1141_9	4	643.34619140625	3	643.010557	1926.00984	0.65413	0.00042062	0.10772	6.9266E-05	0.76186	0.00048988	643.344814865106	20.887	0.50114	20.887	20.636	21.138	0					9	4	4	0	0	0	8.537799999999999E-88	2	15273	15154;15273		156.29	99.495	1	11927000			1334	179	789	824	1807;1808	1808		9606
KLFVGGIKEDTEEHHLR	17	Unmodified	_KLFVGGIKEDTEEHHLR_			0	0	2	P22626	P22626	P22626	HNRNPA2B1	Heterogeneous nuclear ribonucleoproteins A2/B1	MULTI-MSMS	DP1141_9	4	503.0218811035156	4	502.77072	2007.05377	-0.1114	-5.6009E-05	0.48017	0.00024142	0.36877	0.00018541	503.0217097441064	15.722	1.0838	15.722	15.174	16.258	0					31	10	4	0	0	0	0.00017333	3	7032	6850;6940;7032		107.13	0	1	87854000			1335	179	790	825	1809;1810;1811	1811		9606
KLFVGGIKEDTEEHHLR	17	Unmodified	_KLFVGGIKEDTEEHHLR_			0	0	2	P22626	P22626	P22626	HNRNPA2B1	Heterogeneous nuclear ribonucleoproteins A2/B1	MULTI-MSMS	DP1141_9	4	402.54364013671875	5	402.418031	2007.05377	0.10487	4.2203E-05	0.09861	3.9682E-05	0.20348	8.1886E-05	402.61861576237635	15.739	0.6866	15.739	15.372	16.058	0					15	6	4	0	0	0	0.00043622	1	6891	6891		114.64	0	1	16431000			1336	179	790	825	1812	1812		9606
KLFVGGIKEDTEEHHLR	17	Unmodified	_KLFVGGIKEDTEEHHLR_			0	0	2	P22626	P22626	P22626	HNRNPA2B1	Heterogeneous nuclear ribonucleoproteins A2/B1	MULTI-MSMS	DP1141_9	4	670.3602905273438	3	670.025201	2007.05377	0.76792	0.00051452	0.040648	2.7235E-05	0.80856	0.00054176	670.3594409274408	15.722	0.88402	15.722	15.174	16.058	0					17	8	3	0	0	0	1.3598E-10	2	6911	6911;7098		160.93	0	1	29638000			1337	179	790	825	1813;1814	1813		9606
KLGPTEGRPQLK	12	Unmodified	_KLGPTEGRPQLK_			0	0	2	O15235	O15235	O15235	MRPS12	28S ribosomal protein S12, mitochondrial	MULTI-MSMS	DP1141_10	5	441.9296569824219	3	441.929621	1322.76703	-0.063885	-2.8233E-05	0.68372	0.00030216	0.61983	0.00027392	441.9297458818555	14.056	0.32941	14.056	13.824	14.153	0					10	5	3	0	0	0	0.010919	1	4957	4957		86.463	52.593	1	3755500			1338	52	791	826	1815	1815		9606
KLGVQTVAVYSEADR	15	Unmodified	_KLGVQTVAVYSEADR_			0	0	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_10	5	546.2962646484375	3	545.961538	1634.86278	-0.2901	-0.00015838	1.3738	0.00075002	1.0837	0.00059164	545.9626493933678	17.199	0.58249	17.199	17.005	17.588	0					8	5	3	0	0	0	0.002205	1	10075	10075		118.52	88.718	1	64459000			1339	521	792	827	1816	1816		9606
KLGVQTVAVYSEADR	15	Unmodified	_KLGVQTVAVYSEADR_			0	0	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	545.785888671875	3	545.961538	1634.86278	0.10827	5.9111E-05	0.46282	0.00025268	0.57109	0.00031179	545.9618079748819	17.254	0.40013	17.254	17.004	17.404	0					12	3	4	0	0	0	0.0017357	1	9053	9053		84.62	57.284	1	25583000			1340	521	792	827	1817	1817		9606
KLGVQTVAVYSEADR	15	Unmodified	_KLGVQTVAVYSEADR_			0	0	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	545.9617919921875	3	545.961538	1634.86278	0.73409	0.00040078	-0.54708	-0.00029868	0.18701	0.0001021	546.2955069099604	17.223	0.50117	17.223	16.973	17.474	0					9	4	3	0	0	0	2.818E-54	1	9573	9573		167.92	137.94	1	241510000			1341	521	792	827	1818	1818		9606
KLGVQTVAVYSEADR	15	Unmodified	_KLGVQTVAVYSEADR_			0	0	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	818.439208984375	2	818.438669	1634.86278	0.7791	0.00063764	-0.35463	-0.00029024	0.42447	0.00034741	818.4383690421607	17.223	0.47347	17.223	16.9	17.374	0					6	4	2	0	0	0	0	1	9648	9648		277.11	206.71	1	106970000			1342	521	792	827	1819	1819		9606
KLGVQTVAVYSEADR	15	Unmodified	_KLGVQTVAVYSEADR_			0	0	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_9	4	545.9617919921875	3	545.961538	1634.86278	0.65323	0.00035664	-0.18169	-9.9193E-05	0.47155	0.00025745	545.9613898968969	17.288	0.29037	17.288	17.047	17.338	0					8	2	4	0	0	0	0.0073928	1	9599	9599		70.41	34.754	1	36499000			1343	521	792	827	1820	1820		9606
KLHYNEGLNIK	11	Unmodified	_KLHYNEGLNIK_			0	0	1	Q6NXS1;P41236	Q6NXS1	Q6NXS1	PPP1R2P3;PPP1R2	Protein phosphatase inhibitor 2-like protein 3;Protein phosphatase inhibitor 2	MULTI-MSMS	DP1141_10	5	443.8860778808594	3	443.582221	1327.72483	-0.12376	-5.4896E-05	0.39559	0.00017548	0.27183	0.00012058	443.58235345212165	15.66	0.50565	15.66	15.368	15.873	0					13	5	5	0	0	0	2.2834E-30	1	7382	7382		150.46	118.24	1	60224000			1344	224	793	828	1821	1821		9606
KLHYNEGLNIK	11	Unmodified	_KLHYNEGLNIK_			0	0	1	Q6NXS1;P41236	Q6NXS1	Q6NXS1	PPP1R2P3;PPP1R2	Protein phosphatase inhibitor 2-like protein 3;Protein phosphatase inhibitor 2	MULTI-SECPEP	DP1141_9	4	443.2430725097656	3	443.582221	1327.72483	-0.04572	-2.028E-05	0.0041894	1.8583E-06	-0.04153	-1.8422E-05	443.5820217977849	15.623	0.59829	15.623	15.174	15.772	0					8	5	3	0	0	0	1.8672E-09	1	6873	6873		160.91	113.69	1	34649000			1345	224	793	828	1822	1822		9606
KLIYFQLHR	9	Unmodified	_KLIYFQLHR_			0	0	1	Q13263	Q13263	Q13263	TRIM28	Transcription intermediary factor 1-beta	MSMS	DP1141_7	2	406.5205993652344	3	406.576631	1216.70806	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.751	1	17.751	17.251	18.251	0								0	0	0	5.7549E-10	1	10506	10506		144.09	48.179	1				1346	372	794	829	1823	1823		9606
KLSSWDQAETPGHTPSLR	18	Unmodified	_KLSSWDQAETPGHTPSLR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_6	1	503.2561950683594	4	503.25644	2008.99665	-0.20889	-0.00010513	0.33114	0.00016665	0.12225	6.1523E-05	503.2565407067719	16.889	0.37374	16.889	16.729	17.103	0					12	4	4	0	0	0	0.023199	1	8518	8518		56.424	39.182	1	22819000			1347	78	795	830	1824	1824		9606
KLSSWDQAETPGHTPSLR	18	Unmodified	_KLSSWDQAETPGHTPSLR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_6	1	671.00732421875	3	670.672827	2008.99665	0.38838	0.00026048	-0.04572	-3.0663E-05	0.34266	0.00022981	670.6729902504378	16.885	0.27498	16.885	16.729	17.004	0					7	3	3	0	0	0	0.02027	1	8526	8526		65.287	37.437	1	11930000			1348	78	795	830	1825	1825		9606
KLSSWDQAETPGHTPSLR	18	Unmodified	_KLSSWDQAETPGHTPSLR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	670.6731567382812	3	670.672827	2008.99665	0.56643	0.00037989	0.14011	9.3971E-05	0.70654	0.00047386	670.6729062987199	16.81	0.47138	16.81	16.58	17.051	0					18	5	5	0	0	0	0.00011333	1	9098	9098		106.31	79.363	1	99384000			1349	78	795	830	1826	1826		9606
KLSSWDQAETPGHTPSLR	18	Unmodified	_KLSSWDQAETPGHTPSLR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-SECPEP	DP1141_8	3	503.7642517089844	4	503.25644	2008.99665	0.29083	0.00014636	-0.045068	-2.2681E-05	0.24576	0.00012368	503.5071583874485	16.778	0.61064	16.778	16.562	17.173	0					10	6	3	0	0	0	0.019412	1	8812	8812		55.189	40.261	1	34619000			1350	78	795	830	1827	1827		9606
KLSSWDQAETPGHTPSLR	18	Unmodified	_KLSSWDQAETPGHTPSLR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_9	4	503.508056640625	4	503.25644	2008.99665	-0.1604	-8.0723E-05	0.92317	0.00046459	0.76277	0.00038387	503.5076354816092	16.833	0.61755	16.833	16.62	17.238	0					16	7	4	0	0	0	0.0073129	2	8895	8895;8933		73.953	51.079	1	70314000			1351	78	795	830	1828;1829	1828		9606
KLSSWDQAETPGHTPSLR	18	Unmodified	_KLSSWDQAETPGHTPSLR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_9	4	670.6731567382812	3	670.672827	2008.99665	0.68612	0.00046016	-0.011032	-7.399E-06	0.67509	0.00045276	670.6728494405548	16.883	0.49421	16.883	16.553	17.047	0					13	6	4	0	0	0	0.00012406	1	8935	8935		111.09	86.564	1	30484000			1352	78	795	830	1830	1830		9606
KLTATPTPLGGMTGFHMQTEDR	22	Oxidation (M)	_KLTATPTPLGGM(Oxidation (M))TGFHMQTEDR_	KLTATPTPLGGM(1)TGFHMQTEDR	KLTATPTPLGGM(58)TGFHM(-58)QTEDR	0	1	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	602.2957153320312	4	602.045155	2404.15151	0.73895	0.00044488	-0.48316	-0.00029088	0.25579	0.000154	602.2956476045592	17.565	1.0961	17.565	16.953	18.049	0					24	10	4	0	0	0	2.4263E-07	2	9990	9990;10283		122.19	96.718	2	52418000			1353	78	796	831	1831;1832	1831	67;68	9606
KLTATPTPLGGMTGFHMQTEDR	22	Oxidation (M)	_KLTATPTPLGGMTGFHM(Oxidation (M))QTEDR_	KLTATPTPLGGMTGFHM(1)QTEDR	KLTATPTPLGGM(-63)TGFHM(63)QTEDR	0	1	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	802.3916625976562	3	802.391115	2404.15151	0.70993	0.00056964	-0.69918	-0.00056102	0.010752	8.6269E-06	802.7250331534976	17.599	0.59988	17.599	17.149	17.749	0					17	5	4	0	0	0	1.6842E-23	2	10328	10080;10328		162.39	146.09	2	37997000			1354	78	796	831	1833;1834	1834	67;68	9606
KLTATPTPLGGMTGFHMQTEDR	22	Oxidation (M)	_KLTATPTPLGGMTGFHM(Oxidation (M))QTEDR_	KLTATPTPLGGM(0.002)TGFHM(0.998)QTEDR	KLTATPTPLGGM(-27)TGFHM(27)QTEDR	0	1	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MSMS	DP1141_8	3	802.3922729492188	3	802.391115	2404.15151	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.612	1	17.612	17.112	18.112	0								0	0	0	0.0005162	1	10172	10172		99.414	68.827	2				1355	78	796	831	1835	1835	67;68	9606
KLTATPTPLGGMTGFHMQTEDR	22	Oxidation (M)	_KLTATPTPLGGM(Oxidation (M))TGFHMQTEDR_	KLTATPTPLGGM(0.999)TGFHM(0.001)QTEDR	KLTATPTPLGGM(30)TGFHM(-30)QTEDR	0	1	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-SECPEP	DP1141_8	3	602.7705688476562	4	602.045155	2404.15151	0.43332	0.00026088	0.53795	0.00032387	0.97126	0.00058475	602.2961149414707	17.513	0.60134	17.513	17.073	17.674	0					7	5	2	0	0	0	0.02314	1	9881	9881		67.251	45.24	2	23822000			1356	78	796	831	1836	1836	67;68	9606
KLTATPTPLGGMTGFHMQTEDR	22	Unmodified	_KLTATPTPLGGMTGFHMQTEDR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	598.3281860351562	4	598.046427	2388.1566	0.4383	0.00026212	0.32609	0.00019502	0.76439	0.00045714	598.2973123483221	18.6	0.50031	18.6	18.349	18.85	0					5	4	2	0	0	0	0.00139	1	11797	11797		74.324	52.46	1	43399000			1357	78	796	832	1837	1837		9606
KNHEEEMLALR	11	Oxidation (M)	_KNHEEEM(Oxidation (M))LALR_	KNHEEEM(1)LALR	KNHEEEM(92)LALR	0	1	1	CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8	CON__P08779	CON__P08779	KRT16	Keratin, type I cytoskeletal 16	MULTI-SECPEP	DP1141_9	4	463.227294921875	3	462.566243	1384.6769	-0.091834	-4.2479E-05	0.09128	4.2223E-05	-0.00055407	-2.5629E-07	462.56620620040934	14.514	0.40172	14.514	14.312	14.714	0					6	4	2	0	0	0	0.0021459	1	5051	5051		91.701	56.037	1	19201000		+	1358	16	797	833	1838	1838	13	9606
KNMLAFLLTWEK	12	Oxidation (M)	_KNM(Oxidation (M))LAFLLTWEK_	KNM(1)LAFLLTWEK	KNM(56)LAFLLTWEK	0	1	1	Q86T75	Q86T75	Q86T75	NBPF11	Neuroblastoma breakpoint family member 11	MSMS	DP1141_10	5	503.9442138671875	3	503.94265	1508.80612	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.407	1	18.407	17.907	18.907	0								0	0	0	0.033883	1	11971	11971		56.404	13	1				1359	454	798	834	1839	1839	337	9606
KNPASLPLTQAALK	14	Unmodified	_KNPASLPLTQAALK_			0	0	1	Q13428	Q13428	Q13428	TCOF1	Treacle protein	MULTI-MSMS	DP1141_7	2	484.5555419921875	3	484.624198	1450.85076	0.5695	0.00027599	-0.29226	-0.00014164	0.27724	0.00013435	484.9583202150674	17.199	0.35683	17.199	16.892	17.249	0					5	3	2	0	0	0	0.022046	1	9481	9481		53.038	16.085	1	21395000			1360	373	799	835	1840	1840		9606
KPALFPEPAK	10	Unmodified	_KPALFPEPAK_			0	0	1	Q96JM3	Q96JM3	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	MULTI-SECPEP	DP1141_7	2	549.3108520507812	2	549.321317	1096.62808	0.35024	0.00019239	0.0047231	2.5945E-06	0.35496	0.00019499	549.3212808283469	16.064	0.80066	16.064	15.614	16.415	0					14	7	3	0	0	0	5.8575E-12	1	7741	7741		176.38	138.65	1	51306000			1361	514	800	836	1841	1841		9606
KPGDLSDELR	10	Unmodified	_KPGDLSDELR_			0	0	1	Q13435	Q13435	Q13435	SF3B2	Splicing factor 3B subunit 2	MULTI-SECPEP	DP1141_8	3	565.5442504882812	2	565.296027	1128.5775	-0.37972	-0.00021465	-0.55784	-0.00031535	-0.93756	-0.00053	565.2959101778712	15.926	0.50083	15.926	15.675	16.176	0					5	4	2	0	0	0	0.0023753	1	7468	7468		102.06	67.809	1	14915000			1362	374	801	837	1842	1842		9606
KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK	31	Unmodified	_KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_10	5	586.9688110351562	6	586.801168	3514.76335	1.1893	0.00069786	-0.65373	-0.00038361	0.53554	0.00031425	586.9680276560302	19.592	0.59905	19.592	19.077	19.676	0					12	5	5	0	0	0	9.5566E-12	1	13895	13895		93.179	76.261	1	30949000			1363	78	802	838	1843	1843		9606
KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK	31	Unmodified	_KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_10	5	880.1995239257812	4	879.698115	3514.76335	0.8299	0.00073006	-0.42051	-0.00036992	0.40939	0.00036014	880.1988714996507	19.531	0.39934	19.531	19.277	19.676	0					13	3	6	0	0	0	1.0142E-10	1	13908	13908		89.299	66.412	1	20995000			1364	78	802	838	1844	1844		9606
KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK	31	Unmodified	_KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	880.1995849609375	4	879.698115	3514.76335	0.34839	0.00030648	-0.037218	-3.2741E-05	0.31117	0.00027374	880.1995094931224	19.6	0.39972	19.6	19.35	19.75	0					16	3	6	0	0	0	3.0367E-103	3	13431	13226;13431;13572		201.29	186.25	1	129820000			1365	78	802	838	1845;1846;1847	1846		9606
KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK	31	Unmodified	_KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	704.1607666015625	5	703.959947	3514.76335	0.76032	0.00053524	-0.50564	-0.00035595	0.25468	0.00017929	704.3605807678819	19.6	1.5011	19.6	18.95	20.451	0					29	14	6	0	0	0	2.6979999999999997E-59	2	13418	13418;13452		179.43	163.23	1	417660000			1366	78	802	838	1848;1849	1848		9606
KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK	31	Unmodified	_KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	587.1353759765625	6	586.801168	3514.76335	0.57942	0.00034001	-0.37787	-0.00022174	0.20155	0.00011827	587.1350867071309	19.6	0.59982	19.6	19.25	19.85	0					13	5	4	0	0	0	2.7029E-18	2	13426	13426;13568		132.88	112.43	1	190000000			1367	78	802	838	1850;1851	1850		9606
KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK	31	Unmodified	_KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	586.835693359375	6	586.801168	3514.76335	0.3828	0.00022463	0.073644	4.3214E-05	0.45644	0.00026784	587.1353306200476	19.606	0.50126	19.606	19.375	19.877	0					11	4	5	0	0	0	4.2294E-10	3	13173	13173;13232;13307		81.94	66.421	1	43519000			1368	78	802	838	1852;1853;1854	1852		9606
KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK	31	Unmodified	_KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	704.3610229492188	5	703.959947	3514.76335	0.80787	0.00056871	-0.20509	-0.00014437	0.60278	0.00042434	704.3608495365988	19.607	0.40126	19.607	19.375	19.777	0					14	3	6	0	0	0	1.5971E-18	2	13291	13175;13291		139.79	117.23	1	95505000			1369	78	802	838	1855;1856	1856		9606
KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK	31	Unmodified	_KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	880.1998901367188	4	879.698115	3514.76335	0.62313	0.00054817	0.20587	0.0001811	0.829	0.00072927	880.1996136844276	19.626	0.30096	19.626	19.375	19.676	0					8	2	4	0	0	0	2.0876E-10	1	13343	13343		87.052	68.052	1	23149000			1370	78	802	838	1857	1857		9606
KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK	31	Unmodified	_KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_9	4	587.654541015625	6	586.801168	3514.76335	0.49673	0.00029148	-0.33223	-0.00019495	0.16451	9.6532E-05	587.3022179241202	19.589	0.30021	19.589	19.438	19.739	0					12	2	6	0	0	0	2.899E-05	3	13131	13131;13157;13405		51.119	40.119	1	47327000			1371	78	802	838	1858;1859;1860	1858		9606
KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK	31	Unmodified	_KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_9	4	704.361572265625	5	703.959947	3514.76335	0.70362	0.00049532	0.20903	0.00014715	0.91265	0.00064247	704.3614775694139	19.589	0.30021	19.589	19.438	19.739	0					6	2	3	0	0	0	8.0228E-14	1	13400	13400		102.72	85.585	1	86583000			1372	78	802	838	1861	1861		9606
KPHIYYGSLEEKER	14	Unmodified	_KPHIYYGSLEEKER_			0	0	2	O43172	O43172	O43172	PRPF4	U4/U6 small nuclear ribonucleoprotein Prp4	MULTI-MSMS	DP1141_8	3	438.23040771484375	4	437.97961	1747.88933	0.4326	0.00018947	-0.1952	-8.5496E-05	0.2374	0.00010397	438.2300969248918	15.221	0.59939	15.221	14.873	15.472	0					9	5	3	0	0	0	0.0094297	2	6441	6220;6441		77.192	50.563	1	32820000			1373	56	803	839	1862;1863	1863		9606
KPLPDHVSIVEPK	13	Unmodified	_KPLPDHVSIVEPK_			0	0	1	P23396	P23396	P23396	RPS3	40S ribosomal protein S3	MULTI-MSMS	DP1141_10	5	486.9487609863281	3	486.948681	1457.82421	0.38863	0.00018924	-0.25871	-0.00012598	0.12992	6.3265E-05	486.9485400602124	15.826	0.80568	15.826	15.46	16.266	0					24	8	4	0	0	0	0.0025946	2	8036	7716;8036		118.76	84.708	1	42000000			1374	182	804	840	1864;1865	1865		9606
KPLPDHVSIVEPKDEILPTTPISEQK	26	Unmodified	_KPLPDHVSIVEPKDEILPTTPISEQK_			0	0	2	P23396	P23396	P23396	RPS3	40S ribosomal protein S3	MULTI-MSMS	DP1141_10	5	728.3656005859375	4	728.401024	2909.57499	0.59392	0.00043261	0.12396	9.0294E-05	0.71788	0.0005229	728.6517330486101	18.237	0.98951	18.237	17.987	18.977	0					25	9	5	0	0	0	8.0657E-23	3	11763	11763;11868;12045		155.11	136.01	1	90827000			1375	182	805	841	1866;1867;1868	1866		9606
KPLPDHVSIVEPKDEILPTTPISEQK	26	Unmodified	_KPLPDHVSIVEPKDEILPTTPISEQK_			0	0	2	P23396	P23396	P23396	RPS3	40S ribosomal protein S3	MULTI-MSMS	DP1141_10	5	971.53466796875	3	970.865606	2909.57499	-0.12729	-0.00012358	0.62219	0.00060406	0.4949	0.00048048	971.5349001171179	18.237	0.39954	18.237	17.987	18.387	0					7	3	3	0	0	0	1.7207E-11	1	11905	11905		120.42	88.275	1	20311000			1376	182	805	841	1869	1869		9606
KPPPAPQQPPPPPAPHPQQHPQQHPQNQAHGK	32	Unmodified	_KPPPAPQQPPPPPAPHPQQHPQQHPQNQAHGK_			0	0	1	Q07065	Q07065	Q07065	CKAP4	Cytoskeleton-associated protein 4	MULTI-MSMS	DP1141_8	3	700.3287963867188	5	699.560561	3492.76642	0.53554	0.00037465	-0.7826	-0.00054748	-0.24706	-0.00017283	699.7607659044893	13.902	0.83308	13.902	13.52	14.354	0					32	10	5	0	0	0	0.00032879	3	4703	4081;4703;4804		43.31	29.884	1	13505000			1377	351	806	842	1870;1871;1872	1871		9606
KPPPAPQQPPPPPAPHPQQHPQQHPQNQAHGK	32	Unmodified	_KPPPAPQQPPPPPAPHPQQHPQQHPQNQAHGK_			0	0	1	Q07065	Q07065	Q07065	CKAP4	Cytoskeleton-associated protein 4	MULTI-MSMS	DP1141_8	3	500.2606201171875	7	499.973908	3492.76642	0.26577	0.00013288	-0.28637	-0.00014318	-0.020596	-1.0298E-05	500.2603318170381	13.942	1.3779	13.942	13.199	14.577	0					41	17	4	0	0	0	0.00032683	2	4328	4328;4451		42.275	31.107	1	11286000			1378	351	806	842	1873;1874	1873		9606
KPSPSESPEPWKPFPAVSPEPR	22	Unmodified	_KPSPSESPEPWKPFPAVSPEPR_			0	0	2	Q96JM3	Q96JM3	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	MULTI-MSMS	DP1141_7	2	612.316650390625	4	612.315491	2445.23286	0.44116	0.00027013	0.54335	0.0003327	0.98451	0.00060283	612.3161289551765	18.128	0.4002	18.128	17.949	18.349	0					7	3	3	0	0	0	0.0097197	1	11275	11275		53.718	26.195	1	20914000			1379	514	807	843	1875	1875		9606
KPSVSEEVQATPNK	14	Unmodified	_KPSVSEEVQATPNK_			0	0	1	Q9UKJ3	Q9UKJ3	Q9UKJ3	GPATCH8	G patch domain-containing protein 8	MULTI-MSMS	DP1141_6	1	505.74468994140625	3	505.266739	1512.77839	0.041232	2.0833E-05	0.27593	0.00013942	0.31716	0.00016025	505.266917313105	14.097	0.34191	14.097	13.968	14.31	0					8	3	3	0	0	0	0.014635	1	4183	4183		73.415	46.703	1	1674100			1380	597	808	844	1876	1876		9606
KQGTIFLAGPPLVK	14	Unmodified	_KQGTIFLAGPPLVK_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_10	5	490.63592529296875	3	490.301055	1467.88134	0.58664	0.00028763	0.003929	1.9264E-06	0.59057	0.00028956	490.30083161593257	18.827	0.59496	18.827	18.682	19.277	0					9	5	3	0	0	0	0.021244	1	13062	13062		54.598	39.498	1	15490000			1381	567	809	845	1877	1877		9606
KQGTIFLAGPPLVK	14	Unmodified	_KQGTIFLAGPPLVK_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_6	1	490.6356201171875	3	490.301055	1467.88134	0.5235	0.00025667	-0.16491	-8.0854E-05	0.35859	0.00017582	490.3009088248427	18.9	0.70087	18.9	18.705	19.406	0					14	6	3	0	0	0	0.0069602	2	11813	11656;11813		64.798	60.168	1	10913000			1382	567	809	845	1878;1879	1879		9606
KQGTIFLAGPPLVK	14	Unmodified	_KQGTIFLAGPPLVK_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_6	1	735.3334350585938	2	734.947944	1467.88134	0.23145	0.0001701	0.45682	0.00033574	0.68826	0.00050584	734.948307031535	18.919	0.40066	18.919	18.705	19.105	0					8	3	3	0	0	0	0.0005662	2	11833	11744;11833		147.28	109.68	1	3929200			1383	567	809	845	1880;1881	1881		9606
KQGTIFLAGPPLVK	14	Unmodified	_KQGTIFLAGPPLVK_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	734.9487915039062	2	734.947944	1467.88134	0.76896	0.00056514	0.29382	0.00021594	1.0628	0.00078109	734.9481584825406	18.826	0.70014	18.826	18.675	19.375	0					17	6	3	0	0	0	2.6574E-29	3	12229	12025;12229;12234		180.24	165.55	1	159830000			1384	567	809	845	1882;1883;1884	1883		9606
KQGTIFLAGPPLVK	14	Unmodified	_KQGTIFLAGPPLVK_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	490.2576599121094	3	490.301055	1467.88134	0.7505	0.00036797	-0.1382	-6.7761E-05	0.61229	0.00030021	490.3009947529043	18.826	0.70014	18.826	18.675	19.375	0					28	6	5	0	0	0	0.0037871	3	12057	12057;12226;12240		79.885	79.885	1	398810000			1385	567	809	845	1885;1886;1887	1885		9606
KQGTIFLAGPPLVK	14	Unmodified	_KQGTIFLAGPPLVK_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	735.3932495117188	2	734.947944	1467.88134	0.46669	0.00034299	0.15713	0.00011548	0.62382	0.00045848	734.9479316951542	18.887	0.50091	18.887	18.737	19.238	0					9	4	3	0	0	0	0.013981	1	12089	12089		136.7	115.33	1	23053000			1386	567	809	845	1888	1888		9606
KQGTIFLAGPPLVK	14	Unmodified	_KQGTIFLAGPPLVK_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	490.61944580078125	3	490.301055	1467.88134	0.16817	8.2453E-05	0.20525	0.00010064	0.37342	0.00018309	490.3010773206736	18.887	0.7009	18.887	18.637	19.338	0					17	6	4	0	0	0	0.026607	1	12287	12287		47.774	45.34	1	67854000			1387	567	809	845	1889	1889		9606
KQMELPGQVEELLIFR	16	Oxidation (M)	_KQM(Oxidation (M))ELPGQVEELLIFR_	KQM(1)ELPGQVEELLIFR	KQM(52)ELPGQVEELLIFR	0	1	1		REV__Q5JSJ4	REV__Q5JSJ4			MULTI-MSMS	DP1141_8	3	487.2665100097656	4	487.265847	1945.03428	0.63051	0.00030723	0.90911	0.00044298	1.5396	0.00075021	487.51693825343426	14.822	0.59501	14.822	14.577	15.172	0					19	5	5	0	0	0	0.035947	1	5703	5703		52.008	16.282	1	699470000	+		1388	626	810	846	1890	1890	430	9606
KQMELPGQVEELLIFR	16	Oxidation (M)	_KQM(Oxidation (M))ELPGQVEELLIFR_	KQM(1)ELPGQVEELLIFR	KQM(53)ELPGQVEELLIFR	0	1	1		REV__Q5JSJ4	REV__Q5JSJ4			MULTI-SECPEP	DP1141_8	3	486.92315673828125	4	487.265847	1945.03428	0.63051	0.00030723	0.90911	0.00044298	1.5396	0.00075021	487.51693825343426	14.822	0.59501	14.822	14.577	15.172	0					19	5	5	0	0	0	0.035947	1	5542	5542		53.491	18.639	1	699470000	+		1389	626	810	846	1891	1891	430	9606
KQMVIDVLHPGK	12	Oxidation (M)	_KQM(Oxidation (M))VIDVLHPGK_	KQM(1)VIDVLHPGK	KQM(110)VIDVLHPGK	0	1	1	P62847	P62847	P62847	RPS24	40S ribosomal protein S24	MSMS	DP1141_10	5	460.94140625	3	460.927112	1379.75951	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.895	1	15.895	15.395	16.395	0								0	0	0	0.0032252	1	7807	7807		110.64	75.141	1				1390	307	811	847	1892	1892	241	9606
KQMVIDVLHPGK	12	Oxidation (M)	_KQM(Oxidation (M))VIDVLHPGK_	KQM(1)VIDVLHPGK	KQM(100)VIDVLHPGK	0	1	1	P62847	P62847	P62847	RPS24	40S ribosomal protein S24	MSMS	DP1141_10	5	460.92706298828125	3	460.927112	1379.75951	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.932	1	15.932	15.432	16.432	0								0	0	0	0.0030506	1	7865	7865		100.02	66.261	1				1391	307	811	847	1893	1893	241	9606
KQQISLATQMVR	12	Oxidation (M)	_KQQISLATQM(Oxidation (M))VR_	KQQISLATQM(1)VR	KQQISLATQM(58)VR	0	1	1	P48643	P48643	P48643	CCT5	T-complex protein 1 subunit epsilon	MSMS	DP1141_8	3	473.5579528808594	3	473.597654	1417.77113	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.29	1	15.29	14.79	15.79	0								0	0	0	0.032788	1	6386	6386		58.098	25.368	1				1392	244	812	848	1894	1894	195	9606
KQVVNIPSFIVR	12	Unmodified	_KQVVNIPSFIVR_			0	0	1	P46781	P46781	P46781	RPS9	40S ribosomal protein S9	MULTI-MSMS	DP1141_10	5	467.2855224609375	3	467.285516	1398.83472	0.77225	0.00036086	-0.62255	-0.00029091	0.1497	6.9953E-05	467.28522484021784	19.327	0.39906	19.327	19.077	19.476	0					7	3	3	0	0	0	0.0038886	1	13514	13514		91.961	83.857	1	56936000			1393	236	813	849	1895	1895		9606
KREELSNVLAAMR	13	Oxidation (M)	_KREELSNVLAAM(Oxidation (M))R_	KREELSNVLAAM(1)R	KREELSNVLAAM(74)R	0	1	2	Q9Y3U8	Q9Y3U8	Q9Y3U8	RPL36	60S ribosomal protein L36	MULTI-SECPEP	DP1141_10	5	512.2908325195312	3	511.611963	1531.81406	0.45889	0.00023477	0.044182	2.2604E-05	0.50307	0.00025738	511.9461762739295	16.016	0.38471	16.016	15.781	16.166	0					5	3	2	0	0	0	0.0083626	1	7947	7947		74.392	31.967	1	18025000			1394	618	814	850	1896	1896	426	9606
KRVEGPGSLGLEESGSR	17	Unmodified	_KRVEGPGSLGLEESGSR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_10	5	440.4847717285156	4	440.23397	1756.90677	-0.11849	-5.2165E-05	0.45427	0.00019998	0.33577	0.00014782	440.23420532705387	15.392	0.56985	15.392	15.039	15.609	0					13	6	3	0	0	0	0.00030079	3	7028	6815;6954;7028		112.12	94.869	1	37526000			1395	365	815	851	1897;1898;1899	1899		9606
KRVEGPGSLGLEESGSR	17	Unmodified	_KRVEGPGSLGLEESGSR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_10	5	586.9773559570312	3	586.642868	1756.90677	0.46506	0.00027282	0.46683	0.00027386	0.93189	0.00054669	586.6431890675386	15.415	0.41272	15.415	15.12	15.533	0					8	4	2	0	0	0	4.8026E-05	2	7018	6900;7018		120.82	98.99	1	92158000			1396	365	815	851	1900;1901	1901		9606
KRVEGPGSLGLEESGSR	17	Unmodified	_KRVEGPGSLGLEESGSR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_6	1	586.9759521484375	3	586.642868	1756.90677	0.38148	0.00022379	0.11016	6.4626E-05	0.49164	0.00028842	586.642955780488	15.458	0.59993	15.458	15.108	15.708	0					9	5	2	0	0	0	0.00018916	2	6097	6097;6145		124.99	124.99	1	40947000			1397	365	815	851	1902;1903	1902		9606
KRVEGPGSLGLEESGSR	17	Unmodified	_KRVEGPGSLGLEESGSR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-SECPEP	DP1141_7	2	587.28515625	3	586.642868	1756.90677	0.3161	0.00018544	-0.24423	-0.00014328	0.071872	4.2163E-05	586.6428103682372	15.459	0.60275	15.459	14.909	15.512	0					11	5	4	0	0	0	0.020888	1	6793	6793		78.848	59.525	1	52754000			1398	365	815	851	1904	1904		9606
KRVEGPGSLGLEESGSR	17	Unmodified	_KRVEGPGSLGLEESGSR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	586.6434936523438	3	586.642868	1756.90677	0.45428	0.0002665	-0.18629	-0.00010929	0.26799	0.00015722	586.6428986266343	15.42	0.80316	15.42	14.972	15.776	0					25	7	6	0	0	0	0.00033625	2	6480	6480;6595		132.5	117.11	1	683020000			1399	365	815	851	1905;1906	1905		9606
KRVEGPGSLGLEESGSR	17	Unmodified	_KRVEGPGSLGLEESGSR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	440.23455810546875	4	440.23397	1756.90677	0.30336	0.00013355	-0.13737	-6.0473E-05	0.166	7.3077E-05	440.2340416541848	15.42	0.80245	15.42	14.873	15.675	0					25	7	5	0	0	0	9.1053E-06	2	6536	6536;6601		130.47	105.53	1	382510000			1400	365	815	851	1907;1908	1907		9606
KRVEGPGSLGLEESGSR	17	Unmodified	_KRVEGPGSLGLEESGSR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	879.4612426757812	2	879.460664	1756.90677	0.69118	0.00060787	-0.2816	-0.00024765	0.40959	0.00036021	879.4604317454111	15.42	0.403	15.42	15.172	15.575	0					9	3	3	0	0	0	0	2	6683	6683;6759		297.45	258.43	1	54385000			1401	365	815	851	1909;1910	1909		9606
KRVEGPGSLGLEESGSR	17	Unmodified	_KRVEGPGSLGLEESGSR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	586.643310546875	3	586.642868	1756.90677	0.65553	0.00038456	-0.40424	-0.00023714	0.25129	0.00014742	586.6427237217943	15.419	0.59776	15.419	15.075	15.673	0					19	5	5	0	0	0	0.00039195	2	6502	6446;6502		104.16	85.857	1	143990000			1402	365	815	851	1911;1912	1912		9606
KRVEGPGSLGLEESGSR	17	Unmodified	_KRVEGPGSLGLEESGSR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	440.4847717285156	4	440.23397	1756.90677	0.13495	5.941E-05	-0.26537	-0.00011682	-0.13042	-5.7413E-05	440.23387688267525	15.415	0.98543	15.415	14.887	15.872	0					25	9	5	0	0	0	0.00074675	2	6515	6515;6653		106.82	92.781	1	92871000			1403	365	815	851	1913;1914	1913		9606
KSAEFLLHMLK	11	Oxidation (M)	_KSAEFLLHM(Oxidation (M))LK_	KSAEFLLHM(1)LK	KSAEFLLHM(110)LK	0	1	1	P18621	P18621	P18621	RPL17	60S ribosomal protein L17	MULTI-MSMS	DP1141_10	5	445.2244567871094	3	444.916324	1331.72714	-0.58301	-0.00025939	0.82856	0.00036864	0.24555	0.00010925	444.9167047932654	17.037	0.49033	17.037	16.797	17.287	0					8	6	2	0	0	0	0.0017905	1	9817	9817		111.27	82.203	1	43981000			1404	169	816	852	1915	1915	154	9606
KSGVSDHWALDDHHALHLTR	20	Unmodified	_KSGVSDHWALDDHHALHLTR_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_7	2	460.03399658203125	5	459.833369	2294.13046	0.74617	0.00034312	-0.46564	-0.00021412	0.28054	0.000129	460.03373893169857	16.585	0.32318	16.585	16.415	16.738	0					11	3	5	0	0	0	0.0008955	1	8636	8636		81.807	68.38	1	48267000			1405	567	817	853	1916	1916		9606
KSGVSDHWALDDHHALHLTR	20	Unmodified	_KSGVSDHWALDDHHALHLTR_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_7	2	574.7909545898438	4	574.539892	2294.13046	0.72794	0.00041823	-0.5248	-0.00030152	0.20314	0.00011671	574.7902169083732	16.585	0.32318	16.585	16.415	16.738	0					8	3	3	0	0	0	0.0014208	1	8645	8645		84.581	66.986	1	35339000			1406	567	817	853	1917	1917		9606
KSGVSDHWALDDHHALHLTR	20	Unmodified	_KSGVSDHWALDDHHALHLTR_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	574.7904052734375	4	574.539892	2294.13046	-0.32108	-0.00018447	0.43789	0.00025158	0.11681	6.7109E-05	574.7908557923033	16.613	0.55147	16.613	16.276	16.828	0					21	5	5	0	0	0	1.3476E-27	4	8564	8356;8439;8564;8664		172.5	150.96	1	553360000			1407	567	817	853	1918;1919;1920;1921	1920		9606
KSGVSDHWALDDHHALHLTR	20	Unmodified	_KSGVSDHWALDDHHALHLTR_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	460.03387451171875	5	459.833369	2294.13046	-0.21534	-9.9022E-05	0.23968	0.00011021	0.024336	1.1191E-05	460.03407796846517	16.612	0.89672	16.612	16.176	17.073	0					29	9	6	0	0	0	1.3824E-13	3	8553	8458;8553;8660		160.02	137.7	1	925140000			1408	567	817	853	1922;1923;1924	1923		9606
KSGVSDHWALDDHHALHLTR	20	Unmodified	_KSGVSDHWALDDHHALHLTR_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	766.0516967773438	3	765.71743	2294.13046	0.20479	0.00015681	0.10428	7.9846E-05	0.30907	0.00023666	766.0515972624187	16.612	0.4514	16.612	16.376	16.828	0					10	4	4	0	0	0	4.5351E-08	1	8680	8680		150.69	124.14	1	60834000			1409	567	817	853	1925	1925		9606
KSGVSDHWALDDHHALHLTR	20	Unmodified	_KSGVSDHWALDDHHALHLTR_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	574.7906494140625	4	574.539892	2294.13046	0.14602	8.3892E-05	0.11433	6.5684E-05	0.26034	0.00014958	574.7906405014786	16.639	0.32355	16.639	16.458	16.782	0					12	3	5	0	0	0	0.00011324	2	8526	8363;8526		134.52	116.69	1	76851000			1410	567	817	853	1926;1927	1927		9606
KSGVSDHWALDDHHALHLTR	20	Unmodified	_KSGVSDHWALDDHHALHLTR_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	460.0339660644531	5	459.833369	2294.13046	-0.35205	-0.00016188	0.43314	0.00019917	0.081092	3.7289E-05	460.0341606560977	16.628	0.49837	16.628	16.458	16.957	0					20	6	6	0	0	0	5.1625E-05	2	8519	8519;8627		135.26	118.94	1	124600000			1411	567	817	853	1928;1929	1928		9606
KSGVSDHWALDDHHALHLTR	20	Unmodified	_KSGVSDHWALDDHHALHLTR_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	766.0519409179688	3	765.71743	2294.13046	0.71724	0.0005492	-0.56629	-0.00043362	0.15095	0.00011558	766.0515530840335	16.598	0.23434	16.598	16.458	16.693	0					4	2	2	0	0	0	3.2323E-07	1	8598	8598		109.65	83.575	1	6508400			1412	567	817	853	1930	1930		9606
KTEELEEESFPER	13	Unmodified	_KTEELEEESFPER_			0	0	1	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_6	1	541.5897827148438	3	541.589658	1621.74715	0.059805	3.239E-05	0.57715	0.00031258	0.63696	0.00034497	541.5898914267987	16.455	0.62415	16.455	16.105	16.729	0					8	6	2	0	0	0	0.011472	1	7932	7932		69.878	39.311	1	16703000			1413	612	818	854	1931	1931		9606
KTEELEEESFPER	13	Unmodified	_KTEELEEESFPER_			0	0	1	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_7	2	811.9098510742188	2	811.880849	1621.74715	0.78996	0.00064136	-0.60596	-0.00049197	0.184	0.00014939	811.8802796605198	16.465	0.52322	16.465	16.215	16.738	0					11	5	3	0	0	0	0	3	8281	8281;8515;8581		276.95	240.42	1	51740000			1414	612	818	854	1932;1933;1934	1932		9606
KTEELEEESFPER	13	Unmodified	_KTEELEEESFPER_			0	0	1	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_7	2	541.28759765625	3	541.589658	1621.74715	0.48292	0.00026155	-0.087753	-4.7526E-05	0.39517	0.00021402	541.9238494474953	16.467	0.52322	16.467	16.215	16.738	0					16	5	4	0	0	0	1.2955E-09	3	8451	8451;8551;8578		128.35	106.57	1	101470000			1415	612	818	854	1935;1936;1937	1935		9606
KTEELEEESFPER	13	Unmodified	_KTEELEEESFPER_			0	0	1	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_8	3	541.5901489257812	3	541.589658	1621.74715	0.25166	0.0001363	0.36265	0.00019641	0.61431	0.0003327	541.5898992123188	16.426	0.37204	16.426	16.276	16.648	0					6	3	2	0	0	0	0.0032894	1	8392	8392		87.083	71.443	1	34643000			1416	612	818	854	1938	1938		9606
KTEELEEESFPER	13	Unmodified	_KTEELEEESFPER_			0	0	1	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MSMS	DP1141_8	3	811.9099731445312	2	811.880849	1621.74715	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.419	1	16.419	15.919	16.919	0								0	0	0	0	1	8218	8218		274.53	180.17	1				1417	612	818	854	1939	1939		9606
KTEELEEESFPER	13	Unmodified	_KTEELEEESFPER_			0	0	1	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MSMS	DP1141_8	3	811.881591796875	2	811.880849	1621.74715	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.543	1	16.543	16.043	17.043	0								0	0	0	5.9276E-05	1	8426	8426		137.89	104.86	1				1418	612	818	854	1940	1940		9606
KTHQPSDEVGTSIEHPR	17	Unmodified	_KTHQPSDEVGTSIEHPR_			0	0	1	Q99575	Q99575	Q99575	POP1	Ribonucleases P/MRP protein subunit POP1	MULTI-MSMS	DP1141_6	1	480.2410583496094	4	480.24079	1916.93405	0.18684	8.9726E-05	0.089743	4.3098E-05	0.27658	0.00013282	480.4914337462422	14.169	0.49947	14.169	13.811	14.31	0					11	5	4	0	0	0	0.002246	1	4289	4289		132.25	112.5	1	3184800			1419	528	819	855	1941	1941		9606
KTHQPSDEVGTSIEHPR	17	Unmodified	_KTHQPSDEVGTSIEHPR_			0	0	1	Q99575	Q99575	Q99575	POP1	Ribonucleases P/MRP protein subunit POP1	MULTI-SECPEP	DP1141_7	2	480.9925231933594	4	480.24079	1916.93405	0.7714	0.00037046	-0.31943	-0.0001534	0.45197	0.00021706	480.49132775957924	14.079	0.43062	14.079	13.78	14.21	0					8	4	3	0	0	0	0.032703	1	4712	4712		40.844	17.248	1	26419000			1420	528	819	855	1942	1942		9606
KTKPYIQVDIGGGQTK	16	Unmodified	_KTKPYIQVDIGGGQTK_			0	0	2	P11021	P11021	P11021	HSPA5	78 kDa glucose-regulated protein	MULTI-MSMS	DP1141_8	3	578.340576171875	3	578.324588	1731.95193	-0.088225	-5.1023E-05	-0.22528	-0.00013029	-0.31351	-0.00018131	578.3244704884015	16.026	0.5013	16.026	15.575	16.076	0					5	4	2	0	0	0	0.027884	1	7491	7491		66.289	44.936	1	8228300			1421	139	820	856	1943	1943		9606
KTTHFVEGGDAGNREDQINR	20	Unmodified	_KTTHFVEGGDAGNREDQINR_			0	0	2	P18124	P18124	P18124	RPL7	60S ribosomal protein L7	MULTI-MSMS	DP1141_10	5	562.0250244140625	4	561.774256	2243.06792	0.82809	0.0004652	-0.7087	-0.00039813	0.11939	6.7068E-05	562.0245077831194	14.28	0.25109	14.28	14.153	14.404	0					6	3	2	0	0	0	0.0062482	1	5249	5249		71.929	52.995	1	67306000			1422	167	821	857	1944	1944		9606
KTTHFVEGGDAGNREDQINR	20	Unmodified	_KTTHFVEGGDAGNREDQINR_			0	0	2	P18124	P18124	P18124	RPL7	60S ribosomal protein L7	MULTI-MSMS	DP1141_10	5	749.0311889648438	3	748.696583	2243.06792	0.52315	0.00039168	0.065912	4.9348E-05	0.58906	0.00044103	749.0308005414879	14.298	0.31453	14.298	14.09	14.404	0					10	4	4	0	0	0	0.013852	1	5266	5266		69.422	44.638	1	7158200			1423	167	821	857	1945	1945		9606
KTVTAMDVVYALK	13	Oxidation (M)	_KTVTAM(Oxidation (M))DVVYALK_	KTVTAM(1)DVVYALK	KTVTAM(110)DVVYALK	0	1	1	P62805	P62805	P62805	HIST1H4A	Histone H4	MULTI-MSMS	DP1141_10	5	485.6027526855469	3	485.602294	1453.78505	0.15963	7.7516E-05	0.41702	0.0002025	0.57664	0.00028002	485.93687395834104	18.419	0.2995	18.419	18.187	18.487	0					8	2	4	0	0	0	0.001665	1	12050	12050		110.15	88.755	1	35166000			1424	303	822	858	1946	1946	237	9606
KTVTAMDVVYALKR	14	Oxidation (M)	_KTVTAM(Oxidation (M))DVVYALKR_	KTVTAM(1)DVVYALKR	KTVTAM(130)DVVYALKR	0	1	2	P62805	P62805	P62805	HIST1H4A	Histone H4	MULTI-MSMS	DP1141_10	5	537.63623046875	3	537.635997	1609.88616	-0.6298	-0.0003386	1.04	0.00055913	0.41018	0.00022053	537.6365938944002	17.813	0.29986	17.813	17.588	17.887	0					8	2	4	0	0	0	0.0020719	1	11059	11059		130.66	90.285	1	39121000			1425	303	823	859	1947	1947	237	9606
KVEEEEDESALKR	13	Unmodified	_KVEEEEDESALKR_			0	0	2	Q14566	Q14566	Q14566	MCM6	DNA replication licensing factor MCM6	MULTI-MSMS	DP1141_7	2	521.5965576171875	3	521.261653	1560.76313	0.3665	0.00019104	2.2044	0.0011491	2.5709	0.0013401	521.2630433560939	13.788	0.70819	13.788	13.327	14.035	0					10	7	2	0	0	0	0.0053113	1	4080	4080		75.669	52.661	1	9116900			1426	387	824	860	1948	1948		9606
KVEWTSDTVDNEHMGR	16	Oxidation (M)	_KVEWTSDTVDNEHM(Oxidation (M))GR_	KVEWTSDTVDNEHM(1)GR	KVEWTSDTVDNEHM(49)GR	0	1	1	O60927	O60927	O60927	PPP1R11	Protein phosphatase 1 regulatory subunit 11	MULTI-MSMS	DP1141_10	5	641.3572998046875	3	640.623256	1918.84794	-0.62201	-0.00039847	0.6255	0.00040071	0.003499	2.2416E-06	640.95851521782	15.24	0.40814	15.24	14.96	15.368	0					8	4	3	0	0	0	0.033422	1	6620	6620		49.463	27.797	1	14022000			1427	67	825	861	1949	1949	54	9606
KVNNADDFPNLFR	13	Unmodified	_KVNNADDFPNLFR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	516.7957763671875	3	517.26344	1548.76849	0.36748	0.00019008	0.079768	4.1261E-05	0.44725	0.00023135	517.263751391979	19.355	0.60048	19.355	18.905	19.506	0					15	5	4	0	0	0	9.679E-89	1	12446	12446		218.75	174.45	1	602090000			1428	367	826	862	1950	1950		9606
KVPAESMPTLTPAFPR	16	Oxidation (M)	_KVPAESM(Oxidation (M))PTLTPAFPR_	KVPAESM(1)PTLTPAFPR	KVPAESM(56)PTLTPAFPR	0	1	1	Q7LBC6	Q7LBC6	Q7LBC6	KDM3B	Lysine-specific demethylase 3B	MULTI-SECPEP	DP1141_7	2	586.3017578125	3	586.646674	1756.91819	0.73615	0.00043186	-0.50279	-0.00029496	0.23335	0.00013689	586.646627145168	17.699	0.39927	17.699	17.45	17.849	0					5	3	2	0	0	0	0.019052	1	10319	10319		55.885	36.723	1	11971000			1429	447	827	863	1951	1951	333	9606
KVPQVSTPTLVEVSR	15	Unmodified	_KVPQVSTPTLVEVSR_			0	0	1	CON__P02769;CON__P02768-1;P02768	CON__P02769;CON__P02768-1	CON__P02769	ALB	Serum albumin	MSMS	DP1141_10	5	547.6423950195312	3	547.317433	1638.93047	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.648	1	17.648	17.148	18.148	0								0	0	0	8.089700000000001E-130	1	10731	10731		187.08	164.17	1			+	1430	15;14	828	864	1952	1952		9606
KVPQVSTPTLVEVSR	15	Unmodified	_KVPQVSTPTLVEVSR_			0	0	1	CON__P02769;CON__P02768-1;P02768	CON__P02769;CON__P02768-1	CON__P02769	ALB	Serum albumin	MULTI-MSMS	DP1141_6	1	547.6421508789062	3	547.317433	1638.93047	0.46796	0.00025612	0.15924	8.7157E-05	0.6272	0.00034328	547.3174086593693	17.655	0.40091	17.655	17.304	17.705	0					7	3	3	0	0	0	1.2205000000000001E-41	1	9737	9737		153.41	130.5	1	24814000		+	1431	15;14	828	864	1953	1953		9606
KVPQVSTPTLVEVSR	15	Unmodified	_KVPQVSTPTLVEVSR_			0	0	1	CON__P02769;CON__P02768-1;P02768	CON__P02769;CON__P02768-1	CON__P02769	ALB	Serum albumin	MULTI-SECPEP	DP1141_8	3	547.9593505859375	3	547.317433	1638.93047	0.80266	0.00043931	-0.33499	-0.00018335	0.46767	0.00025597	547.317235383604	17.624	0.30034	17.624	17.374	17.674	0					4	2	2	0	0	0	2.3731E-06	1	10106	10106		123.63	93.689	1	85499000		+	1432	15;14	828	864	1954	1954		9606
KVPQVSTPTLVEVSR	15	Unmodified	_KVPQVSTPTLVEVSR_			0	0	1	CON__P02769;CON__P02768-1;P02768	CON__P02769;CON__P02768-1	CON__P02769	ALB	Serum albumin	MULTI-MSMS	DP1141_9	4	547.976806640625	3	547.317433	1638.93047	0.6266	0.00034295	-0.26536	-0.00014524	0.36124	0.00019771	547.3173879870292	17.588	0.39993	17.588	17.338	17.738	0					7	3	3	0	0	0	2.669E-05	2	10155	10059;10155		121.95	105.69	1	16182000		+	1433	15;14	828	864	1955;1956	1956		9606
KVTQLDLDGPK	11	Unmodified	_KVTQLDLDGPK_			0	0	1	Q13442	Q13442	Q13442	PDAP1	28 kDa heat- and acid-stable phosphoprotein	MULTI-MSMS	DP1141_10	5	607.8237915039062	2	607.342978	1212.6714	0.234	0.00014212	0.67697	0.00041115	0.91096	0.00055327	607.3428969450916	15.869	0.35947	15.869	15.609	15.968	0					7	3	3	0	0	0	0.021442	1	7802	7802		169.99	74.252	1	5582300			1434	375	829	865	1957	1957		9606
KVVNPLFEK	9	Unmodified	_KVVNPLFEK_			0	0	1	P62424	P62424	P62424	RPL7A	60S ribosomal protein L7a	MULTI-MSMS	DP1141_9	4	537.321533203125	2	537.321317	1072.62808	0.44437	0.00023877	0.048089	2.5839E-05	0.49246	0.00026461	537.3212701056783	16.638	0.23434	16.638	16.458	16.693	0					6	2	3	0	0	0	0.0017801	1	8551	8551		145.72	88.442	1	22821000			1435	300	830	866	1958	1958		9606
KYYLFGR	7	Unmodified	_KYYLFGR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MSMS	DP1141_8	3	473.7908020019531	2	473.760895	945.507237	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.908	1	17.908	17.408	18.408	0								0	0	0	0.025664	1	10653	10653		127.66	44.281	1				1436	365	831	867	1959	1959		9606
KYYLFGR	7	Unmodified	_KYYLFGR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MSMS	DP1141_8	3	473.7609558105469	2	473.760895	945.507237	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.926	1	17.926	17.426	18.426	0								0	0	0	0.0089122	1	10681	10681		119.22	42.375	1				1437	365	831	867	1960	1960		9606
LAAAEGLEPK	10	Unmodified	_LAAAEGLEPK_			0	0	0	Q6NXS1;P41236	Q6NXS1	Q6NXS1	PPP1R2P3;PPP1R2	Protein phosphatase inhibitor 2-like protein 3;Protein phosphatase inhibitor 2	MULTI-MSMS	DP1141_10	5	499.7795104980469	2	499.779482	997.544411	0.34696	0.00017341	0.06371	3.1841E-05	0.41067	0.00020525	499.7794780740655	16.016	0.46911	16.016	15.697	16.166	0					6	4	2	0	0	0	0.0059232	1	8058	8058		101.64	49.789	1	43722000			1438	224	832	868	1961	1961		9606
LAADDFR	7	Unmodified	_LAADDFR_			0	0	0	CON__P13645;P13645;CON__P02535-1;Q7Z3Y7;CON__Q148H6;CON__Q7Z3Y7;CON__P19001;CON__P08727;P08727;O76013;CON__REFSEQ:XP_986630;CON__Q15323;CON__Q14532;CON__A2A5Y0;CON__O76015;CON__A2AB72;Q2M2I5;CON__Q14525;CON__O76014;Q14525;P05783;CON__Q2M2I5;CON__O76013;O76014;Q15323;CON__Q9UE12;Q92764;Q14532;O76015;CON__P05784;CON__Q92764;CON__P02533;P02533;CON__Q6IFX2;CON__P19012;CON__A2A4G1;P19012;CON__Q04695;Q04695;CON__Q9QWL7;CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8;CON__Q497I4	CON__P13645;CON__P02533;CON__Q04695;CON__P08779;CON__Q497I4	CON__P13645	KRT10;KRT28;KRT19;KRT36;KRT24;KRT33B;KRT18;KRT37;KRT31;KRT35;KRT32;KRT38;KRT14;KRT15;KRT17;KRT16	Keratin, type I cytoskeletal 10;Keratin, type I cytoskeletal 28;Keratin, type I cytoskeletal 19;Keratin, type I cuticular Ha6;Keratin, type I cytoskeletal 24;Keratin, type I cuticular Ha3-II;Keratin, type I cytoskeletal 18;Keratin, type I cuticular Ha7;Keratin, type I cuticular Ha1;Keratin, type I cuticular Ha5;Keratin, type I cuticular Ha2;Keratin, type I cuticular Ha8;Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 15;Keratin, type I cytoskeletal 17;Keratin, type I cytoskeletal 16	MULTI-MSMS	DP1141_7	2	404.2035217285156	2	404.20341	806.392267	0.34172	0.00013813	-0.10899	-4.4055E-05	0.23273	9.4071E-05	404.20329988189934	16.465	0.52322	16.465	16.215	16.738	0					9	5	3	0	0	0	1.8147E-05	1	8413	8413		128.38	73.618	1	152350000		+	1439	17;16;9;21;26	833	869	1962	1962		9606
LAADDFR	7	Unmodified	_LAADDFR_			0	0	0	CON__P13645;P13645;CON__P02535-1;Q7Z3Y7;CON__Q148H6;CON__Q7Z3Y7;CON__P19001;CON__P08727;P08727;O76013;CON__REFSEQ:XP_986630;CON__Q15323;CON__Q14532;CON__A2A5Y0;CON__O76015;CON__A2AB72;Q2M2I5;CON__Q14525;CON__O76014;Q14525;P05783;CON__Q2M2I5;CON__O76013;O76014;Q15323;CON__Q9UE12;Q92764;Q14532;O76015;CON__P05784;CON__Q92764;CON__P02533;P02533;CON__Q6IFX2;CON__P19012;CON__A2A4G1;P19012;CON__Q04695;Q04695;CON__Q9QWL7;CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8;CON__Q497I4	CON__P13645;CON__P02533;CON__Q04695;CON__P08779;CON__Q497I4	CON__P13645	KRT10;KRT28;KRT19;KRT36;KRT24;KRT33B;KRT18;KRT37;KRT31;KRT35;KRT32;KRT38;KRT14;KRT15;KRT17;KRT16	Keratin, type I cytoskeletal 10;Keratin, type I cytoskeletal 28;Keratin, type I cytoskeletal 19;Keratin, type I cuticular Ha6;Keratin, type I cytoskeletal 24;Keratin, type I cuticular Ha3-II;Keratin, type I cytoskeletal 18;Keratin, type I cuticular Ha7;Keratin, type I cuticular Ha1;Keratin, type I cuticular Ha5;Keratin, type I cuticular Ha2;Keratin, type I cuticular Ha8;Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 15;Keratin, type I cytoskeletal 17;Keratin, type I cytoskeletal 16	MULTI-MSMS	DP1141_8	3	404.2296142578125	2	404.20341	806.392267	0.017074	6.9014E-06	0.39335	0.000159	0.41043	0.0001659	404.20351259234235	16.426	0.28613	16.426	16.276	16.562	0					4	2	2	0	0	0	8.4121E-10	1	8189	8189		148.28	79.189	1	269940000		+	1440	17;16;9;21;26	833	869	1963	1963		9606
LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	37	Unmodified	_LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK_			0	0	2	P06748	P06748	P06748	NPM1	Nucleophosmin	MULTI-MSMS	DP1141_9	4	1062.8944091796875	4	1062.3931	4245.54328	-0.20551	-0.00021833	0.90254	0.00095885	0.69703	0.00074052	1063.1463307924644	16.985	0.26552	16.985	16.782	17.047	0					10	3	4	0	0	0	2.0247999999999999E-22	1	9154	9154		83.705	79.173	1	14780000			1441	120	834	870	1964	1964		9606
LAASIAPEIYGHEDVKK	17	Unmodified	_LAASIAPEIYGHEDVKK_			0	0	1	P33993	P33993	P33993	MCM7	DNA replication licensing factor MCM7	MULTI-SECPEP	DP1141_8	3	613.968505859375	3	614.331631	1839.97306	0.22818	0.00014018	0.16618	0.00010209	0.39436	0.00024227	614.6660503431242	16.923	0.24172	16.923	16.731	16.973	0					8	2	4	0	0	0	0.013218	1	8987	8987		68.944	45.765	1	38956000			1442	205	835	871	1965	1965		9606
LAAVQLLQFLAPK	13	Unmodified	_LAAVQLLQFLAPK_			0	0	0	Q9NXF1	Q9NXF1	Q9NXF1	TEX10	Testis-expressed sequence 10 protein	MULTI-MSMS	DP1141_7	2	706.4036865234375	2	706.437212	1410.85987	0.75221	0.00053139	0.12372	8.7403E-05	0.87593	0.00061879	706.4374733662681	24.042	0.27636	24.042	23.808	24.084	0					8	3	3	0	0	0	7.3989E-21	2	20025	20025;20051		196.88	168.48	1	6414700			1443	577	836	872	1966;1967	1966		9606
LADDLSTLQEK	11	Unmodified	_LADDLSTLQEK_			0	0	0	Q14980	Q14980	Q14980	NUMA1	Nuclear mitotic apparatus protein 1	MULTI-MSMS	DP1141_7	2	616.8193359375	2	616.822075	1231.6296	0.55624	0.0003431	-4.199	-0.0025901	-3.6428	-0.0022469	616.819150477308	17.4	0.80018	17.4	17.149	17.949	0					15	7	3	0	0	0	0.013885	1	10115	10115		87.149	20.187	1	39198000			1444	396	837	873	1968	1968		9606
LAELEEALQK	10	Unmodified	_LAELEEALQK_			0	0	0	CON__P13647;P13647	CON__P13647	CON__P13647	KRT5	Keratin, type II cytoskeletal 5	MULTI-MSMS	DP1141_10	5	572.3167114257812	2	572.316428	1142.6183	0.31826	0.00018215	0.13491	7.7214E-05	0.45318	0.00025936	572.3165273425145	18.237	0.49945	18.237	17.987	18.487	0					8	4	3	0	0	0	0.010394	1	11881	11881		97.635	59.359	1	25062000		+	1445	18	838	874	1969	1969		9606
LAELEEALQK	10	Unmodified	_LAELEEALQK_			0	0	0	CON__P13647;P13647	CON__P13647	CON__P13647	KRT5	Keratin, type II cytoskeletal 5	MSMS	DP1141_9	4	571.861083984375	2	572.316428	1142.6183	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.318	1	18.318	17.818	18.818	0								0	0	0	0.0080587	1	11248	11248		128.38	63.131	1			+	1446	18	838	874	1970	1970		9606
LAFEVAEK	8	Unmodified	_LAFEVAEK_			0	0	0	Q8N3F8	Q8N3F8	Q8N3F8	MICALL1	MICAL-like protein 1	MULTI-SECPEP	DP1141_7	2	453.2384033203125	2	453.750193	905.485833	0.62183	0.00028215	-0.23602	-0.00010709	0.38581	0.00017506	453.7499942780801	17.499	0.40028	17.499	17.149	17.549	0					5	3	2	0	0	0	0.0040567	1	10110	10110		108.09	49.272	1	3724500			1447	470	839	875	1971	1971		9606
LAPAQYIR	8	Unmodified	_LAPAQYIR_			0	0	0	Q13573	Q13573	Q13573	SNW1	SNW domain-containing protein 1	MULTI-MSMS	DP1141_9	4	466.27166748046875	2	466.271627	930.528701	0.022587	1.0532E-05	0.38651	0.00018022	0.40909	0.00019075	466.27166156602914	16.904	0.26552	16.904	16.782	17.047	0					7	3	3	0	0	0	0.0076831	1	8982	8982		107.74	59.896	1	22541000			1448	377	840	876	1972	1972		9606
LAPVPSPEPQKPAPVSPESVK	21	Unmodified	_LAPVPSPEPQKPAPVSPESVK_			0	0	1	Q96JM3	Q96JM3	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	MSMS	DP1141_7	2	718.7322387695312	3	718.731683	2153.17322	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.687	1	16.687	16.187	17.187	0								0	0	0	2.0329E-05	1	8769	8769		121.77	104.75	1				1449	514	841	877	1973	1973		9606
LASSMGK	7	Oxidation (M)	_LASSM(Oxidation (M))GK_	LASSM(1)GK	LASSM(46)GK	0	1	0	O75064	O75064	O75064	DENND4B	DENN domain-containing protein 4B	MULTI-MSMS	DP1141_9	4	709.3577880859375	1	709.354902	708.347625	0.65006	0.00046112	-1.9169	-0.0013598	-1.2669	-0.00089865	709.3533512724185	17.688	0.49986	17.688	17.338	17.837	0					7	4	2	0	0	0	0.034345	1	10121	10121		46.351	21.353	1	15913000			1450	69	842	878	1974	1974	55	9606
LASVLVSDWMAVIR	14	Oxidation (M)	_LASVLVSDWM(Oxidation (M))AVIR_	LASVLVSDWM(1)AVIR	LASVLVSDWM(180)AVIR	0	1	0	Q96QC0	Q96QC0	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	MULTI-MSMS	DP1141_7	2	788.4017944335938	2	788.431801	1574.84905	0.6907	0.00054457	-0.26102	-0.0002058	0.42968	0.00033877	788.4315336179376	22.622	0.24199	22.622	22.486	22.728	0					4	2	2	0	0	0	4.7310000000000006E-30	2	17962	17962;18054		182.28	120.52	1	12350000			1451	520	843	879	1975;1976	1975	366	9606
LASYLDKVR	9	Unmodified	_LASYLDKVR_			0	0	1	CON__P13645;P13645;CON__P19001;CON__P08727;P08727;Q99456;CON__Q99456;CON__P02533;P02533;CON__P19012;CON__A2A4G1;P19012;CON__Q04695;Q04695;CON__Q9QWL7;CON__P08779;P08779	CON__P13645;CON__P02533;CON__Q04695;CON__P08779	CON__P13645	KRT10;KRT19;KRT12;KRT14;KRT15;KRT17;KRT16	Keratin, type I cytoskeletal 10;Keratin, type I cytoskeletal 19;Keratin, type I cytoskeletal 12;Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 15;Keratin, type I cytoskeletal 17;Keratin, type I cytoskeletal 16	MULTI-SECPEP	DP1141_6	1	532.2539672851562	2	532.808574	1063.60259	0.27431	0.00014615	0.28526	0.00015199	0.55957	0.00029814	532.8085563642353	16.355	0.45174	16.355	16.205	16.657	0					5	4	2	0	0	0	0.00020399	1	7598	7598		153.04	107.08	1	16355000		+	1452	17;16;9;21	844	880	1977	1977		9606
LASYLDKVR	9	Unmodified	_LASYLDKVR_			0	0	1	CON__P13645;P13645;CON__P19001;CON__P08727;P08727;Q99456;CON__Q99456;CON__P02533;P02533;CON__P19012;CON__A2A4G1;P19012;CON__Q04695;Q04695;CON__Q9QWL7;CON__P08779;P08779	CON__P13645;CON__P02533;CON__Q04695;CON__P08779	CON__P13645	KRT10;KRT19;KRT12;KRT14;KRT15;KRT17;KRT16	Keratin, type I cytoskeletal 10;Keratin, type I cytoskeletal 19;Keratin, type I cytoskeletal 12;Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 15;Keratin, type I cytoskeletal 17;Keratin, type I cytoskeletal 16	MULTI-MSMS	DP1141_9	4	532.8046875	2	532.808574	1063.60259	0.27576	0.00014692	-0.43334	-0.00023089	-0.15759	-8.3963E-05	532.8083017842101	16.288	0.49492	16.288	16.058	16.553	0					8	4	2	0	0	0	0.00021614	1	8078	8078		148.04	106.82	1	22075000		+	1453	17;16;9;21	844	880	1978	1978		9606
LATQLTGPVMPVR	13	Oxidation (M)	_LATQLTGPVM(Oxidation (M))PVR_	LATQLTGPVM(1)PVR	LATQLTGPVM(74)PVR	0	1	0	P26373	P26373	P26373	RPL13	60S ribosomal protein L13	MULTI-SECPEP	DP1141_10	5	699.3848876953125	2	699.892312	1397.77007	0.3742	0.0002619	0.041227	2.8854E-05	0.41542	0.00029075	699.8925136157902	17.538	0.40034	17.538	17.287	17.688	0					5	3	2	0	0	0	0.02617	1	10669	10669		73.841	31.243	1	34540000			1454	188	845	881	1979	1979	164	9606
LAVNMVPFPR	10	Oxidation (M)	_LAVNM(Oxidation (M))VPFPR_	LAVNM(1)VPFPR	LAVNM(140)VPFPR	0	1	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	MULTI-MSMS	DP1141_10	5	580.3186645507812	2	580.318251	1158.62195	0.60852	0.00035314	-0.29023	-0.00016842	0.3183	0.00018471	580.3180125464768	18.827	0.39002	18.827	18.587	18.977	0					6	3	2	0	0	0	0.0079117	2	12677	12677;12803		143.89	143.89	1	90465000			1455	122;323;381;376	846	882	1980;1981	1980	110	9606
LAVNMVPFPR	10	Oxidation (M)	_LAVNM(Oxidation (M))VPFPR_	LAVNM(1)VPFPR	LAVNM(110)VPFPR	0	1	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	MULTI-MSMS	DP1141_6	1	581.2996826171875	2	580.318251	1158.62195	1.0251	0.00059486	-0.53858	-0.00031255	0.48649	0.00028232	580.3179879425894	18.855	0.60064	18.855	18.405	19.005	0					12	5	4	0	0	0	0.020496	1	11560	11560		110.81	79.504	1	40172000			1456	122;323;381;376	846	882	1982	1982	110	9606
LAVNMVPFPR	10	Oxidation (M)	_LAVNM(Oxidation (M))VPFPR_	LAVNM(1)VPFPR	LAVNM(98)VPFPR	0	1	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	MULTI-SECPEP	DP1141_7	2	580.6588745117188	2	580.318251	1158.62195	0.3508	0.00020357	0.36548	0.0002121	0.71628	0.00041567	580.3184774732988	18.8	0.50026	18.8	18.449	18.95	0					6	4	2	0	0	0	0.0095275	1	12278	12278		97.798	97.798	1	59612000			1457	122;323;381;376	846	882	1983	1983	110	9606
LAVNMVPFPR	10	Oxidation (M)	_LAVNM(Oxidation (M))VPFPR_	LAVNM(1)VPFPR	LAVNM(150)VPFPR	0	1	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	MSMS	DP1141_8	3	580.3187255859375	2	580.318251	1158.62195	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.836	1	18.836	18.336	19.336	0								0	0	0	1.6879E-10	1	12086	12086		148.04	93.432	1				1458	122;323;381;376	846	882	1984	1984	110	9606
LAVNMVPFPR	10	Oxidation (M)	_LAVNM(Oxidation (M))VPFPR_	LAVNM(1)VPFPR	LAVNM(120)VPFPR	0	1	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	MULTI-MSMS	DP1141_9	4	580.3181762695312	2	580.318251	1158.62195	0.34732	0.00020156	-0.015673	-9.0953E-06	0.33165	0.00019246	580.3183100974518	18.787	0.80097	18.787	18.537	19.338	0					12	7	3	0	0	0	0.02704	1	12059	12059		122.18	84.09	1	133300000			1459	122;323;381;376	846	882	1985	1985	110	9606
LAVNMVPFPR	10	Unmodified	_LAVNMVPFPR_			0	0	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	MULTI-MSMS	DP1141_8	3	572.321044921875	2	572.320794	1142.62703	-0.062773	-3.5926E-05	0.34257	0.00019606	0.2798	0.00016013	572.3209999809364	20.126	0.29985	20.126	19.877	20.176	0					4	2	2	0	0	0	7.968E-05	1	14086	14086		148.04	148.04	1	241560000			1460	122;323;381;376	846	883	1986	1986		9606
LDDLVRPYVHK	11	Unmodified	_LDDLVRPYVHK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MSMS	DP1141_7	2	677.66650390625	2	677.877519	1353.74048	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.338	1	16.338	15.838	16.838	0								0	0	0	0.02244	1	8185	8185		109.66	46.841	1				1461	78	847	884	1987	1987		9606
LDDLVRPYVHK	11	Unmodified	_LDDLVRPYVHK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MSMS	DP1141_7	2	678.3516845703125	2	677.877519	1353.74048	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.412	1	16.412	15.912	16.912	0								0	0	0	0.0012099	1	8306	8306		118.03	70.806	1				1462	78	847	884	1988	1988		9606
LDDLVRPYVHK	11	Unmodified	_LDDLVRPYVHK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MSMS	DP1141_7	2	677.8778076171875	2	677.877519	1353.74048	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.481	1	16.481	15.981	16.981	0								0	0	0	0.016879	1	8425	8425		95.523	47.432	1				1463	78	847	884	1989	1989		9606
LDECEEAFQGTK	12	Unmodified	_LDECEEAFQGTK_			0	0	0	P61289	P61289	P61289	PSME3	Proteasome activator complex subunit 3	MULTI-SECPEP	DP1141_9	4	713.848388671875	2	713.811381	1425.60821	0.59609	0.00042549	-0.19094	-0.0001363	0.40514	0.0002892	713.811315980325	16.614	0.23434	16.614	16.458	16.693	0					6	2	3	0	0	0	1.3866E-09	1	8462	8462		155.53	117.84	1	4895700			1464	281	848	885	1990	1990		9606
LDHKFDLMYAK	11	Unmodified	_LDHKFDLMYAK_			0	0	1	P68363;A6NHL2;P68366;Q71U36;P0DPH8;P0DPH7	P68363;P68366;Q71U36	P68363	TUBA1B;TUBAL3;TUBA4A;TUBA1A	Tubulin alpha-1B chain;Tubulin alpha chain-like 3;Tubulin alpha-4A chain;Tubulin alpha-1A chain	MULTI-SECPEP	DP1141_8	3	460.49139404296875	3	460.904196	1379.69076	0.151	6.9597E-05	0.26399	0.00012168	0.41499	0.00019127	460.90427747615195	17.424	0.50063	17.424	17.273	17.774	0					13	4	4	0	0	0	7.2256E-05	1	9903	9903		150.06	114.38	1	68722000			1465	321;442;322	849	886	1991	1991		9606
LDHKFDLMYAK	11	Oxidation (M)	_LDHKFDLM(Oxidation (M))YAK_	LDHKFDLM(1)YAK	LDHKFDLM(110)YAK	0	1	1	P68363;A6NHL2;P68366;Q71U36;P0DPH8;P0DPH7	P68363;P68366;Q71U36	P68363	TUBA1B;TUBAL3;TUBA4A;TUBA1A	Tubulin alpha-1B chain;Tubulin alpha chain-like 3;Tubulin alpha-4A chain;Tubulin alpha-1A chain	MULTI-MSMS	DP1141_9	4	466.268798828125	3	466.235834	1395.68567	-0.11044	-5.149E-05	0.25087	0.00011696	0.14043	6.5473E-05	466.2358895923738	16.508	0.26216	16.508	16.358	16.62	0					4	2	2	0	0	0	0.0064773	1	8343	8343		110.93	75.28	1	53788000			1466	321;442;322	849	887	1992	1992	247	9606
LDKIMNMKETTK	12	Oxidation (M)	_LDKIM(Oxidation (M))NMKETTK_	LDKIM(0.908)NM(0.092)KETTK	LDKIM(9.9)NM(-9.9)KETTK	0	1	2	Q15542	Q15542	Q15542	TAF5	Transcription initiation factor TFIID subunit 5	MULTI-MSMS	DP1141_6	1	490.2503356933594	3	489.923038	1466.74729	-0.22582	-0.00011063	-2.604	-0.0012758	-2.8298	-0.0013864	489.9214954283013	14.758	0.79982	14.758	14.609	15.408	0					10	7	2	0	0	0	0.0067799	1	5082	5082		102.53	41.051	2	2567800			1467	406	850	888	1993	1993	312	9606
LDLDLTADSQPPVFK	15	Unmodified	_LDLDLTADSQPPVFK_			0	0	0	Q13263	Q13263	Q13263	TRIM28	Transcription intermediary factor 1-beta	MULTI-MSMS	DP1141_7	2	830.4376831054688	2	829.935428	1657.8563	0.75366	0.00062549	0.063027	5.2309E-05	0.81669	0.0006778	830.4370032864643	20.901	0.39956	20.901	20.651	21.05	0					7	3	3	0	0	0	0.017851	1	15514	15514		78.653	62.732	1	97843000			1468	372	851	889	1994	1994		9606
LDLLEEK	7	Unmodified	_LDLLEEK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	430.2425231933594	2	430.242201	858.469849	1.5094	0.00064939	-2.1037	-0.0009051	-0.59433	-0.00025571	430.24140293712156	18.043	1.0002	18.043	17.404	18.405	0					12	9	2	0	0	0	2.3105E-18	1	10456	10456		168.74	0	1	472950000			1469	367	852	890	1995	1995		9606
LDLLEEK	7	Unmodified	_LDLLEEK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	430.758056640625	2	430.242201	858.469849	0.46404	0.00019965	1.9407	0.00083497	2.4047	0.0010346	430.2419872395848	18.013	0.59995	18.013	17.549	18.149	0					6	5	2	0	0	0	1.6373E-05	1	10936	10936		128.86	0	1	9739100			1470	367	852	890	1996	1996		9606
LDNASAFQGAVISPHYDSLLVK	22	Unmodified	_LDNASAFQGAVISPHYDSLLVK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	782.7442626953125	3	782.40938	2344.20631	0.097233	7.6076E-05	0.43355	0.00033921	0.53078	0.00041529	782.7439581222974	20.438	0.58365	20.438	19.998	20.582	0					16	5	5	0	0	0	1.6358E-69	2	14104	14044;14104		190.1	172.7	1	62569000			1471	142	853	891	1997;1998	1998		9606
LDNASAFQGAVISPHYDSLLVK	22	Unmodified	_LDNASAFQGAVISPHYDSLLVK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	782.7443237304688	3	782.40938	2344.20631	0.9106	0.00071246	-0.47472	-0.00037142	0.43588	0.00034104	782.7433372961796	20.401	1.0997	20.401	20.05	21.15	0					29	10	6	0	0	0	7.9764E-24	2	14636	14636;15605		166.91	136.57	1	1213800000			1472	142	853	891	1999;2000	1999		9606
LDNASAFQGAVISPHYDSLLVK	22	Unmodified	_LDNASAFQGAVISPHYDSLLVK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	782.4110107421875	3	782.40938	2344.20631	0.34797	0.00027225	0.62345	0.0004878	0.97142	0.00076005	782.7441556188455	20.427	0.40129	20.427	20.176	20.578	0					14	3	5	0	0	0	1.1551E-69	2	14487	14487;14561		192.18	171.59	1	250410000			1473	142	853	891	2001;2002	2001		9606
LDPETLESLGLIK	13	Unmodified	_LDPETLESLGLIK_			0	0	0	Q8NI27	Q8NI27	Q8NI27	THOC2	THO complex subunit 2	MULTI-MSMS	DP1141_7	2	714.3995971679688	2	714.403232	1426.79191	0.66806	0.00047727	-2.6112	-0.0018654	-1.9431	-0.0013882	714.4013811258989	21.948	0.29669	21.948	21.75	22.047	0					6	2	3	0	0	0	0.0008167	1	17018	17018		133.75	79.03	1	4422500			1474	478	854	892	2003	2003		9606
LDSELKNMQDMVEDYR	16	2 Oxidation (M)	_LDSELKNM(Oxidation (M))QDM(Oxidation (M))VEDYR_	LDSELKNM(1)QDM(1)VEDYR	LDSELKNM(67)QDM(67)VEDYR	0	2	1	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_6	1	674.303955078125	3	673.299562	2016.87686	0.49331	0.00033214	-0.43743	-0.00029452	0.055879	3.7623E-05	673.2995912887635	16.68	0.22905	16.68	16.595	16.824	0					6	2	3	0	0	0	0.012215	2	8204	8204;8288		66.674	45.427	1	20759000		+	1475	102	855	893	2004;2005	2004	84;85	9606
LELAQYR	7	Unmodified	_LELAQYR_			0	0	0	P25705	P25705	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	MSMS	DP1141_8	3	446.7485046386719	2	446.747985	891.481417	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.194	1	17.194	16.694	17.694	0								0	0	0	0.0049849	1	9500	9500		118.06	33.698	1				1476	187	856	894	2006	2006		9606
LELDDPSK	8	Unmodified	_LELDDPSK_			0	0	0	O00763	O00763	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	458.7638854980469	2	458.73474	915.454927	0.29106	0.00013352	0.52715	0.00024182	0.81822	0.00037534	458.73468805434476	16.055	0.60125	16.055	15.804	16.405	0					9	5	3	0	0	0	0.018049	1	7189	7189		96.492	39.389	1	15283000			1477	40	857	895	2007	2007		9606
LELQGPR	7	Unmodified	_LELQGPR_			0	0	0	P19338	P19338	P19338	NCL	Nucleolin	MULTI-MSMS	DP1141_8	3	406.7474670410156	2	406.734877	811.455202	0.28362	0.00011536	-0.063446	-2.5806E-05	0.22017	8.9552E-05	406.7347939337501	15.826	0.5013	15.826	15.575	16.076	0					6	4	2	0	0	0	0.0010528	1	7238	7238		118.06	42.746	1	16226000			1478	171	858	896	2008	2008		9606
LENEIQTYR	9	Unmodified	_LENEIQTYR_			0	0	0	CON__P13645;P13645;CON__P02535-1	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_10	5	583.2891235351562	2	583.296027	1164.5775	0.64346	0.00037533	-1.1472	-0.00066918	-0.50378	-0.00029386	583.797678992477	16.411	0.49219	16.411	15.968	16.46	0					6	4	2	0	0	0	2.4831E-175	1	8635	8635		240.53	153.7	1	7017000		+	1479	17	859	897	2009	2009		9606
LENEIQTYR	9	Unmodified	_LENEIQTYR_			0	0	0	CON__P13645;P13645;CON__P02535-1	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_6	1	583.255615234375	2	583.296027	1164.5775	0.47159	0.00027508	-0.11756	-6.8571E-05	0.35403	0.0002065	583.2958771430069	16.355	0.29959	16.355	16.205	16.505	0					4	2	2	0	0	0	1.6697E-114	2	7646	7646;7734		225.4	136.03	1	35028000		+	1480	17	859	897	2010;2011	2010		9606
LENPKMSLENDK	12	Oxidation (M)	_LENPKM(Oxidation (M))SLENDK_	LENPKM(1)SLENDK	LENPKM(69)SLENDK	0	1	1	Q7Z478	Q7Z478	Q7Z478	DHX29	ATP-dependent RNA helicase DHX29	MULTI-SECPEP	DP1141_6	1	479.2598876953125	3	478.569541	1432.68679	-0.33471	-0.00016018	-1.2989	-0.0006216	-1.6336	-0.00078179	478.56880944097827	14.758	0.49947	14.758	14.509	15.008	0					6	4	2	0	0	0	0.025944	1	4895	4895		68.786	34.285	1	2807500			1481	450	860	898	2012	2012	335	9606
LEPHKPQQIPIDSTVSFGASTR	22	Unmodified	_LEPHKPQQIPIDSTVSFGASTR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_10	5	603.6213989257812	4	602.81967	2407.24957	-0.045334	-2.7328E-05	0.72259	0.00043559	0.67725	0.00040826	603.0708038438823	17.637	0.50003	17.637	17.387	17.887	0					14	4	4	0	0	0	0.025069	2	10681	10681;10893		63.606	45.211	1	104330000			1482	365	861	899	2013;2014	2013		9606
LEPHKPQQIPIDSTVSFGASTR	22	Unmodified	_LEPHKPQQIPIDSTVSFGASTR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_10	5	803.7587280273438	3	803.423801	2407.24957	-0.052885	-4.2489E-05	0.70586	0.0005671	0.65297	0.00052461	803.7587442825915	17.637	0.39981	17.637	17.488	17.887	0					11	3	5	0	0	0	3.3673E-06	1	10901	10901		128.95	89.428	1	58497000			1483	365	861	899	2015	2015		9606
LEPHKPQQIPIDSTVSFGASTR	22	Unmodified	_LEPHKPQQIPIDSTVSFGASTR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_6	1	803.7584838867188	3	803.423801	2407.24957	0.62493	0.00050208	-0.092468	-7.4291E-05	0.53246	0.00042779	803.7578745479597	17.755	0.50052	17.755	17.505	18.005	0					18	4	6	0	0	0	3.3939E-06	1	9884	9884		131.56	109.95	1	73555000			1484	365	861	899	2016	2016		9606
LEPHKPQQIPIDSTVSFGASTR	22	Unmodified	_LEPHKPQQIPIDSTVSFGASTR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_7	2	603.3002319335938	4	602.81967	2407.24957	0.69547	0.00041925	-0.81763	-0.00049288	-0.12216	-7.3639E-05	603.0701573624509	17.699	0.90027	17.699	17.149	18.049	0					21	8	5	0	0	0	0.0033118	2	10409	10409;10473		84.689	58.738	1	213170000			1485	365	861	899	2017;2018	2017		9606
LEPHKPQQIPIDSTVSFGASTR	22	Unmodified	_LEPHKPQQIPIDSTVSFGASTR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	603.0706787109375	4	602.81967	2407.24957	0.48475	0.00029222	-0.21219	-0.00012791	0.27256	0.0001643	603.0703547881714	17.624	1.1018	17.624	17.273	18.375	0					38	10	7	0	0	0	0.010285	2	10359	10212;10359		77.1	57.232	1	1730099999.9999998			1486	365	861	899	2019;2020	2020		9606
LEPHKPQQIPIDSTVSFGASTR	22	Unmodified	_LEPHKPQQIPIDSTVSFGASTR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	803.4241333007812	3	803.423801	2407.24957	0.75914	0.00060991	-0.34768	-0.00027933	0.41146	0.00033057	803.7577905952369	17.624	1.0018	17.624	17.273	18.275	0					36	9	7	0	0	0	1.5002E-54	2	10301	10301;10360		184.34	154.34	1	1183800000			1487	365	861	899	2021;2022	2021		9606
LEPHKPQQIPIDSTVSFGASTR	22	Unmodified	_LEPHKPQQIPIDSTVSFGASTR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	803.7583618164062	3	803.423801	2407.24957	0.023543	1.8915E-05	0.32174	0.0002585	0.34529	0.00027741	803.758656252237	36.785	0.56806	36.785	36.743	37.311	0					15	9	2	0	0	0	0.012675	2	34289	34289;34410		73.675	53.883	1	8608600			1488	365	861	899	2023;2024	2023		9606
LEPHKPQQIPIDSTVSFGASTR	22	Unmodified	_LEPHKPQQIPIDSTVSFGASTR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	803.758544921875	3	803.423801	2407.24957	0.022389	1.7988E-05	0.63594	0.00051093	0.65833	0.00052892	803.7586019933525	17.688	0.49986	17.688	17.437	17.937	0					18	4	5	0	0	0	2.9631E-160	5	10253	10228;10253;10324;10568;10594		228.11	199.15	1	515770000			1489	365	861	899	2025;2026;2027;2028;2029	2026		9606
LEPHKPQQIPIDSTVSFGASTR	22	Unmodified	_LEPHKPQQIPIDSTVSFGASTR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	603.0706787109375	4	602.81967	2407.24957	-0.16906	-0.00010191	0.65375	0.00039409	0.48468	0.00029218	603.0708194917344	17.688	0.69921	17.688	17.338	18.037	0					24	6	6	0	0	0	3.7099E-05	1	10241	10241		101	63.429	1	917700000			1490	365	861	899	2030	2030		9606
LEPHKPQQIPIDSTVSFGASTR	22	Unmodified	_LEPHKPQQIPIDSTVSFGASTR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	1205.1336669921875	2	1204.63206	2407.24957	-1.3965	-0.0016823	1.7071	0.0020564	0.31058	0.00037414	1205.135238873556	17.688	0.30007	17.688	17.537	17.837	0					6	2	3	0	0	0	9.1583E-07	1	10409	10409		121.82	114.03	1	28876000			1491	365	861	899	2031	2031		9606
LEQGQAIDDLMPAQK	15	Unmodified	_LEQGQAIDDLMPAQK_			0	0	0	P12277	P12277	P12277	CKB	Creatine kinase B-type	MULTI-MSMS	DP1141_6	1	829.4127197265625	2	828.916712	1655.81887	0.90158	0.00074734	0.10959	9.084E-05	1.0112	0.00083818	828.9163105572526	18.955	0.3002	18.955	18.805	19.105	0					4	2	2	0	0	0	2.2776E-09	1	11871	11871		160.56	99.919	1	4676500			1492	145	862	900	2032	2032		9606
LEYYENAR	8	Unmodified	_LEYYENAR_			0	0	0	O14654	O14654	O14654	IRS4	Insulin receptor substrate 4	MSMS	DP1141_6	1	529.2409057617188	2	529.251089	1056.48762	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.993	1	15.993	15.493	16.493	0								0	0	0	0.01781	1	6953	6953		111.65	81.036	1				1493	44	863	901	2033	2033		9606
LFIGGLSFETTDESLR	16	Unmodified	_LFIGGLSFETTDESLR_			0	0	0	P09651;Q32P51	P09651	P09651	HNRNPA1;HNRNPA1L2	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2	MULTI-MSMS	DP1141_9	4	893.4157104492188	2	892.956891	1783.89923	0.82981	0.00074099	-0.3828	-0.00034182	0.44701	0.00039916	892.956531096336	22.251	0.38522	22.251	22.119	22.504	0					7	4	3	0	0	0	4.1922999999999998E-22	3	17173	17173;17331;17336		173.72	142.85	1	56459000			1494	130	864	902	2034;2035;2036	2034		9606
LFLQGPK	7	Unmodified	_LFLQGPK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	402.23992919921875	2	401.744714	801.474875	0.20058	8.0583E-05	0.26181	0.00010518	0.46239	0.00018576	401.7447817966643	17.499	0.49938	17.499	17.349	17.849	0					9	4	3	0	0	0	0.0059269	2	10209	10209;10257		109.88	61.639	1	384210000			1495	142	865	903	2037;2038	2037		9606
LFPLIQAMHPTLAGK	15	Oxidation (M)	_LFPLIQAM(Oxidation (M))HPTLAGK_	LFPLIQAM(1)HPTLAGK	LFPLIQAM(79)HPTLAGK	0	1	0	Q9H361;P11940	Q9H361	Q9H361	PABPC3;PABPC1	Polyadenylate-binding protein 3;Polyadenylate-binding protein 1	MULTI-MSMS	DP1141_8	3	552.3173217773438	3	551.644604	1651.91198	0.69908	0.00038565	2.2454	0.0012387	2.9445	0.0016243	551.6449006900489	19.206	0.4994	19.206	18.876	19.375	0					13	4	4	0	0	0	0.0051772	1	12765	12765		78.985	52.627	1	12712000			1496	143	866	904	2039	2039	147	9606
LFVGGIKEDTEEHHLR	16	Unmodified	_LFVGGIKEDTEEHHLR_			0	0	1	P22626	P22626	P22626	HNRNPA2B1	Heterogeneous nuclear ribonucleoproteins A2/B1	MULTI-MSMS	DP1141_10	5	471.2489318847656	4	470.746979	1878.95881	0.31989	0.00015059	-0.28727	-0.00013523	0.032619	1.5355E-05	470.7466608259678	16.216	0.58693	16.216	15.873	16.46	0					11	5	3	0	0	0	0.015834	1	8316	8316		130.47	0	1	28148000			1497	179	867	905	2040	2040		9606
LFVGGIKEDTEEHHLR	16	Unmodified	_LFVGGIKEDTEEHHLR_			0	0	1	P22626	P22626	P22626	HNRNPA2B1	Heterogeneous nuclear ribonucleoproteins A2/B1	MULTI-MSMS	DP1141_9	4	471.58349609375	4	470.746979	1878.95881	0.06346	2.9874E-05	0.1975	9.2973E-05	0.26096	0.00012285	470.74710641146356	16.208	0.6858	16.208	15.772	16.458	0					13	6	3	0	0	0	0.0040858	2	7889	7742;7889		130.61	0	1	278190000			1498	179	867	905	2041;2042	2042		9606
LFVGGIKEDTEEHHLR	16	Unmodified	_LFVGGIKEDTEEHHLR_			0	0	1	P22626	P22626	P22626	HNRNPA2B1	Heterogeneous nuclear ribonucleoproteins A2/B1	MULTI-MSMS	DP1141_9	4	627.6617431640625	3	627.32688	1878.95881	0.23124	0.00014506	0.37019	0.00023223	0.60143	0.00037729	627.6613903834096	16.208	0.49302	16.208	15.965	16.458	0					8	4	2	0	0	0	0.0056924	1	7920	7920		101.62	0	1	170070000			1499	179	867	905	2043	2043		9606
LFVGNLPPDITEEEMR	16	Unmodified	_LFVGNLPPDITEEEMR_			0	0	0	Q15233	Q15233	Q15233	NONO	Non-POU domain-containing octamer-binding protein	MULTI-SECPEP	DP1141_8	3	930.9649047851562	2	930.464026	1858.9135	0.21153	0.00019682	-0.14133	-0.0001315	0.070208	6.5326E-05	930.4637019650681	20.928	0.3997	20.928	20.678	21.078	0					7	3	3	0	0	0	0.014053	1	15316	15316		88.101	62.906	1	14988000			1500	401	868	906	2044	2044		9606
LFWEWGDGIR	10	Unmodified	_LFWEWGDGIR_			0	0	0	Q8N1G2	Q8N1G2	Q8N1G2	CMTR1	Cap-specific mRNA (nucleoside-2-O-)-methyltransferase 1	MULTI-MSMS	DP1141_7	2	640.3187866210938	2	639.81693	1277.61931	0.14474	9.2605E-05	-0.074171	-4.7456E-05	0.070565	4.5148E-05	640.3182559111583	22.703	0.33336	22.703	22.572	22.906	0					8	4	3	0	0	0	0.0041941	1	18148	18148		111.17	60.108	1	5794500			1501	468	869	907	2045	2045		9606
LGASNSPGQPNSVK	14	Unmodified	_LGASNSPGQPNSVK_			0	0	0	P49756	P49756	P49756	RBM25	RNA-binding protein 25	MULTI-MSMS	DP1141_7	2	678.3496704101562	2	678.349323	1354.68409	0.81018	0.00054959	-0.023017	-1.5613E-05	0.78717	0.00053397	678.3493732281905	14.079	0.349	14.079	13.861	14.21	0					9	3	4	0	0	0	4.8722999999999995E-21	1	4652	4652		169.82	136.56	1	18369000			1502	251	870	908	2046	2046		9606
LGASNSPGQPNSVK	14	Unmodified	_LGASNSPGQPNSVK_			0	0	0	P49756	P49756	P49756	RBM25	RNA-binding protein 25	MULTI-MSMS	DP1141_9	4	678.3492431640625	2	678.349323	1354.68409	0.066059	4.4811E-05	0.069133	4.6896E-05	0.13519	9.1708E-05	678.3493599264639	14.085	0.23774	14.085	13.94	14.178	0					5	3	2	0	0	0	0.0010652	1	4437	4437		125.74	82.993	1	4022400			1503	251	870	908	2047	2047		9606
LGAVFNQVAFPLQYTPR	17	Unmodified	_LGAVFNQVAFPLQYTPR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	960.9610595703125	2	961.02016	1920.02577	0.47072	0.00045237	-0.20397	-0.00019602	0.26676	0.00025636	961.0198492412567	22.214	0.2318	22.214	22.072	22.304	0					11	3	4	0	0	0	1.0038E-167	3	16802	16802;16846;16863		237.07	237.07	1	15261000			1504	402	871	909	2048;2049;2050	2048		9606
LGEHNIDVLEGNEQFINAAK	20	Unmodified	_LGEHNIDVLEGNEQFINAAK_			0	0	0	CON__P00761	CON__P00761	CON__P00761			MULTI-MSMS	DP1141_10	5	737.7068481445312	3	737.706197	2210.09676	1.2898	0.00095152	0.15686	0.00011572	1.4467	0.0010672	738.0402377667227	19.626	0.39977	19.626	19.376	19.776	0					9	3	4	0	0	0	3.1349000000000002E-27	1	13893	13893		170.38	142.3	1	101810000		+	1505	8	872	910	2051	2051		
LGEHNIDVLEGNEQFINAAK	20	Unmodified	_LGEHNIDVLEGNEQFINAAK_			0	0	0	CON__P00761	CON__P00761	CON__P00761			MULTI-MSMS	DP1141_6	1	738.0347900390625	3	737.706197	2210.09676	0.12379	9.1319E-05	1.0016	0.00073888	1.1254	0.0008302	737.7069680027969	19.556	0.40017	19.556	19.406	19.806	0					7	3	3	0	0	0	4.6301000000000003E-63	2	12869	12869;12905		192.22	152.64	1	29697000		+	1506	8	872	910	2052;2053	2052		
LGGIPVGVVAVETR	14	Unmodified	_LGGIPVGVVAVETR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MSMS	DP1141_6	1	683.9065551757812	2	683.906276	1365.798	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.756	1	19.756	19.256	20.256	0								0	0	0	0.0071409	1	13043	13043		114.86	71.555	1				1507	367	873	911	2054	2054		9606
LGTPELSTAER	11	Unmodified	_LGTPELSTAER_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_10	5	586.8121948242188	2	587.309135	1172.60372	0.65413	0.00038418	-0.19666	-0.0001155	0.45747	0.00026868	587.3090586606313	16.51	0.42508	16.51	16.166	16.591	0					8	4	2	0	0	0	0.012453	1	8735	8735		140.75	78.754	1	84116000			1508	367	874	912	2055	2055		9606
LGTPELSTAER	11	Unmodified	_LGTPELSTAER_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	587.3093872070312	2	587.309135	1172.60372	0.3042	0.00017866	-0.12947	-7.6038E-05	0.17473	0.00010262	587.3090875361275	16.555	0.72454	16.555	16.005	16.729	0					18	7	4	0	0	0	1.0486E-21	3	7740	7637;7740;7779		173.39	133.75	1	273460000			1509	367	874	912	2056;2057;2058	2057		9606
LGTPELSTAER	11	Unmodified	_LGTPELSTAER_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_8	3	587.291015625	2	587.309135	1172.60372	-0.092187	-5.4142E-05	0.096718	5.6803E-05	0.0045313	2.6613E-06	587.3092560854974	16.513	0.5865	16.513	15.976	16.562	0					8	5	3	0	0	0	0.023566	1	8275	8275		77.662	35.554	1	94145000			1510	367	874	912	2059	2059		9606
LGTPELSTAER	11	Unmodified	_LGTPELSTAER_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_9	4	587.3092651367188	2	587.309135	1172.60372	0.38408	0.00022557	-0.087759	-5.1542E-05	0.29632	0.00017403	587.309065136864	16.508	0.39493	16.508	16.158	16.553	0					6	3	2	0	0	0	8.9351E-09	2	8312	8152;8312		157.34	121.73	1	197550000			1511	367	874	912	2060;2061	2061		9606
LGTPELSTAERK	12	Unmodified	_LGTPELSTAERK_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	434.5737609863281	3	434.573503	1300.69868	0.59316	0.00025777	-0.22281	-9.6829E-05	0.37034	0.00016094	434.5733503135818	15.259	1.4801	15.259	14.133	15.613	0					30	14	3	0	0	0	0.0032015	1	5695	5695		98.182	63.65	1	27141000			1512	367	875	913	2062	2062		9606
LGTPELSTAERK	12	Unmodified	_LGTPELSTAERK_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_8	3	435.2206726074219	3	434.573503	1300.69868	0.41729	0.00018134	-0.58186	-0.00025286	-0.16457	-7.1519E-05	434.57328647733	15.32	0.29837	15.32	15.072	15.37	0					4	2	2	0	0	0	0.020108	1	6410	6410		80.014	48.144	1	6308100			1513	367	875	913	2063	2063		9606
LGVQTVAVYSEADR	14	Unmodified	_LGVQTVAVYSEADR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	754.37255859375	2	754.391187	1506.76782	0.29104	0.00021956	0.28404	0.00021428	0.57509	0.00043384	754.3913862599811	18.355	0.39944	18.355	18.205	18.604	0					7	3	3	0	0	0	2.9516E-53	2	10928	10928;10952		247.96	194.46	1	12151000			1514	521	876	914	2064;2065	2064		9606
LGVQTVAVYSEADR	14	Unmodified	_LGVQTVAVYSEADR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-SECPEP	DP1141_8	3	754.4144287109375	2	754.391187	1506.76782	0.83479	0.00062976	0.092872	7.0062E-05	0.92766	0.00069982	754.3911450061884	18.425	0.29999	18.425	18.175	18.475	0					6	2	3	0	0	0	3.8121000000000002E-31	1	11455	11455		167.11	126.62	1	39284000			1515	521	876	914	2066	2066		9606
LHFFMPGFAPLTSR	14	Oxidation (M)	_LHFFM(Oxidation (M))PGFAPLTSR_	LHFFM(1)PGFAPLTSR	LHFFM(100)PGFAPLTSR	0	1	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_10	5	546.6162719726562	3	546.281666	1635.82317	0.68815	0.00037592	-0.40655	-0.00022209	0.28159	0.00015383	546.6158811535597	20.526	0.29949	20.526	20.376	20.676	0					6	2	3	0	0	0	0.0017119	1	15403	15403		104.17	56.401	1	35554000			1516	122;323;381	877	915	2067	2067	111	9606
LHFFMPGFAPLTSR	14	Oxidation (M)	_LHFFM(Oxidation (M))PGFAPLTSR_	LHFFM(1)PGFAPLTSR	LHFFM(140)PGFAPLTSR	0	1	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_8	3	546.2820434570312	3	546.281666	1635.82317	0.76825	0.00041968	-0.10727	-5.8601E-05	0.66097	0.00036108	546.2816631672003	20.527	0.80085	20.527	20.377	21.178	0					15	7	4	0	0	0	0.00032971	2	14773	14773;14794		142.91	76.905	1	182420000			1517	122;323;381	877	915	2068;2069	2068	111	9606
LHFFMPGFAPLTSR	14	Oxidation (M)	_LHFFM(Oxidation (M))PGFAPLTSR_	LHFFM(1)PGFAPLTSR	LHFFM(93)PGFAPLTSR	0	1	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_8	3	818.9197998046875	2	818.918861	1635.82317	0.82826	0.00067828	-0.0088874	-7.278E-06	0.81937	0.000671	818.9190258724649	20.527	0.40125	20.527	20.277	20.678	0					5	3	2	0	0	0	0.028981	1	14781	14781		93.442	52.714	1	58094000			1518	122;323;381	877	915	2070	2070	111	9606
LHFFMPGFAPLTSR	14	Oxidation (M)	_LHFFM(Oxidation (M))PGFAPLTSR_	LHFFM(1)PGFAPLTSR	LHFFM(100)PGFAPLTSR	0	1	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_9	4	546.9506225585938	3	546.281666	1635.82317	0.63884	0.00034899	-0.14973	-8.1793E-05	0.48912	0.0002672	546.2816080019766	20.586	0.50007	20.586	20.337	20.837	0					7	4	2	0	0	0	0.0017119	1	14850	14850		104.17	63.697	1	168410000			1519	122;323;381	877	915	2071	2071	111	9606
LHFFMPGFAPLTSR	14	Unmodified	_LHFFMPGFAPLTSR_			0	0	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_8	3	541.9058837890625	3	540.950028	1619.82825	0.66609	0.00036032	-0.2329	-0.00012599	0.43319	0.00023433	540.949971871513	21.829	0.29971	21.829	21.679	21.979	0					10	2	5	0	0	0	0.0017592	2	16617	16617;16685		113.24	83.259	1	106370000			1520	122;323;381	877	916	2072;2073	2072		9606
LHFFMPGFAPLTSR	14	Unmodified	_LHFFMPGFAPLTSR_			0	0	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_8	3	811.8541259765625	2	810.921403	1619.82825	0.86782	0.00070374	-0.38312	-0.00031068	0.4847	0.00039306	811.4227227315514	21.829	0.39952	21.829	21.679	22.079	0					8	3	3	0	0	0	0.019941	1	16657	16657		96.015	39.656	1	40671000			1521	122;323;381	877	916	2074	2074		9606
LHLIYLINDVLHHCQR	16	Unmodified	_LHLIYLINDVLHHCQR_			0	0	0	Q8IWX8	Q8IWX8	Q8IWX8	CHERP	Calcium homeostasis endoplasmic reticulum protein	MULTI-MSMS	DP1141_7	2	682.0358276367188	3	682.035154	2043.08363	0.72726	0.00049602	-0.13214	-9.0124E-05	0.59512	0.0004059	682.3691380143896	22.041	0.76891	22.041	21.55	22.319	0					9	7	2	0	0	0	0.001445	3	17298	17070;17152;17298		136.83	112.42	1	6586900			1522	463	878	917	2075;2076;2077	2077		9606
LIANNTTVER	10	Unmodified	_LIANNTTVER_			0	0	0	O96019	O96019	O96019	ACTL6A	Actin-like protein 6A	MULTI-SECPEP	DP1141_9	4	566.2891845703125	2	565.811845	1129.60914	0.382	0.00021614	-0.28266	-0.00015994	0.099339	5.6207E-05	565.8119352269468	14.84	0.26582	14.84	14.714	14.98	0					4	2	2	0	0	0	0.022512	1	5629	5629		99.802	58.773	1	2275300			1523	96	879	918	2078	2078		9606
LIEQAFR	7	Unmodified	_LIEQAFR_			0	0	0	Q01167	Q01167	Q01167	FOXK2	Forkhead box protein K2	MULTI-MSMS	DP1141_8	3	438.7467041015625	2	438.750527	875.486502	0.013869	6.0852E-06	3.2218	0.0014136	3.2357	0.0014197	438.75177910592373	17.123	0.37296	17.123	16.9	17.273	0					6	3	2	0	0	0	0.032614	1	9369	9369		96.048	24.67	1	21763000			1524	339	880	919	2079	2079		9606
LIEQAFR	7	Unmodified	_LIEQAFR_			0	0	0	Q01167	Q01167	Q01167	FOXK2	Forkhead box protein K2	MSMS	DP1141_9	4	438.72564697265625	2	438.750527	875.486502	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.078	1	17.078	16.578	17.578	0								0	0	0	0.012459	1	9242	9242		110.54	39.158	1				1525	339	880	919	2080	2080		9606
LIETYFSK	8	Unmodified	_LIETYFSK_			0	0	0	P60201	P60201	P60201	PLP1	Myelin proteolipid protein	MULTI-MSMS	DP1141_10	5	500.701416015625	2	500.771126	999.527698	0.14672	7.3473E-05	0.71515	0.00035813	0.86187	0.0004316	500.77146921558403	18.437	0.49947	18.437	18.087	18.587	0					5	4	2	0	0	0	0.017833	1	12172	12172		98.523	55.609	1	27159000			1526	276	881	920	2081	2081		9606
LIETYFSK	8	Unmodified	_LIETYFSK_			0	0	0	P60201	P60201	P60201	PLP1	Myelin proteolipid protein	MULTI-MSMS	DP1141_6	1	501.7738952636719	2	500.771126	999.527698	0.65712	0.00032907	0.12004	6.011E-05	0.77716	0.00038918	500.77110907664667	18.432	0.49965	18.432	18.205	18.705	0					9	4	3	0	0	0	0.017807	1	11046	11046		96.19	59.097	1	16275000			1527	276	881	920	2082	2082		9606
LIEVDDER	8	Unmodified	_LIEVDDER_			0	0	0	P62753	P62753	P62753	RPS6	40S ribosomal protein S6	MULTI-MSMS	DP1141_10	5	494.751220703125	2	494.750921	987.48729	0.38076	0.00018838	0.26912	0.00013315	0.64988	0.00032153	494.75100587552856	16.016	0.39273	16.016	15.873	16.266	0					5	3	2	0	0	0	0.020301	1	8182	8182		88.942	30.338	1	153560000			1528	302	882	921	2083	2083		9606
LIGEYGLR	8	Unmodified	_LIGEYGLR_			0	0	0	P46781	P46781	P46781	RPS9	40S ribosomal protein S9	MULTI-MSMS	DP1141_10	5	460.78192138671875	2	460.763635	919.512717	-0.54008	-0.00024885	0.83502	0.00038475	0.29494	0.0001359	460.76397512443515	18.037	0.29986	18.037	17.887	18.187	0					8	2	4	0	0	0	1.7474E-14	1	11366	11366		167.25	78.626	1	317710000			1529	236	883	922	2084	2084		9606
LIIDDLSMDK	10	Unmodified	_LIIDDLSMDK_			0	0	0		REV__Q86V81	REV__Q86V81			MULTI-MSMS	DP1141_10	5	581.8047485351562	2	581.804839	1161.59513	0.18461	0.00010741	0.12811	7.4536E-05	0.31272	0.00018194	581.8049186335755	16.83	0.49596	16.83	16.591	17.087	0					19	7	4	0	0	0	0.0095881	2	9322	9322;9389		98.418	65.808	1	220940000	+		1530	627	884	923	2085;2086	2085		9606
LIIDDLSMDK	10	Unmodified	_LIIDDLSMDK_			0	0	0		REV__Q86V81	REV__Q86V81			MULTI-MSMS	DP1141_6	1	581.8047485351562	2	581.804839	1161.59513	0.41274	0.00024013	-0.71154	-0.00041398	-0.2988	-0.00017384	581.8045300729531	16.869	1.7001	16.869	16.505	18.205	0					55	18	5	0	0	0	0.018103	1	8209	8209		86.472	33.121	1	874740000	+		1531	627	884	923	2087	2087		9606
LIIDDLSMDK	10	Unmodified	_LIIDDLSMDK_			0	0	0		REV__Q86V81	REV__Q86V81			MULTI-MSMS	DP1141_7	2	581.8047485351562	2	581.804839	1161.59513	0.87544	0.00050933	-0.52774	-0.00030704	0.3477	0.00020229	581.8045873963422	16.781	0.66955	16.781	16.58	17.249	0					12	7	3	0	0	0	0.024385	1	8961	8961		79.451	31.535	1	281530000	+		1532	627	884	923	2088	2088		9606
LIIVEGCQR	9	Unmodified	_LIIVEGCQR_			0	0	0	P05023;P13637;P50993;Q13733;P54707	P05023;P13637	P13637	ATP1A1;ATP1A3;ATP1A2;ATP1A4;ATP12A	Sodium/potassium-transporting ATPase subunit alpha-1;Sodium/potassium-transporting ATPase subunit alpha-3;Sodium/potassium-transporting ATPase subunit alpha-2;Sodium/potassium-transporting ATPase subunit alpha-4;Potassium-transporting ATPase alpha chain 2	MULTI-SECPEP	DP1141_6	1	544.70263671875	2	544.300059	1086.58556	-0.114	-6.2052E-05	0.63204	0.00034402	0.51804	0.00028197	544.3004099603157	16.956	0.27927	16.956	16.824	17.103	0					5	3	2	0	0	0	0.002407	1	8643	8643		116.88	61.208	1	29877000			1533	147;106	885	924	2089	2089		9606
LILIESR	7	Unmodified	_LILIESR_			0	0	0	P62277	P62277	P62277	RPS13	40S ribosomal protein S13	MULTI-SECPEP	DP1141_10	5	421.7479248046875	2	422.268553	842.522553	-0.20534	-8.6707E-05	0.50813	0.00021457	0.3028	0.00012786	422.26869807069437	18.037	0.29986	18.037	17.887	18.187	0					4	2	2	0	0	0	4.642799999999999E-19	1	11437	11437		198.32	83.728	1	61751000			1534	294	886	925	2090	2090		9606
LILISTNGSFIR	12	Unmodified	_LILISTNGSFIR_			0	0	0	Q6UXN9	Q6UXN9	Q6UXN9	WDR82	WD repeat-containing protein 82	MULTI-SECPEP	DP1141_9	4	667.6759643554688	2	667.395544	1332.77654	0.88882	0.00059319	-0.90127	-0.0006015	-0.012451	-8.3096E-06	667.394679651627	20.787	0.50114	20.787	20.636	21.138	0					6	4	2	0	0	0	0.012174	1	15145	15145		138.08	64.831	1	15384000			1535	436	887	926	2091	2091		9606
LIPFLEK	7	Unmodified	_LIPFLEK_			0	0	0	Q05D32	Q05D32	Q05D32	CTDSPL2	CTD small phosphatase-like protein 2	MULTI-MSMS	DP1141_6	1	430.73516845703125	2	430.268022	858.521491	1.4344	0.00061719	-3.4581	-0.0014879	-2.0237	-0.00087074	430.26833409439456	18.217	0.2998	18.217	18.005	18.305	0					4	2	2	0	0	0	0.02064	1	10300	10300		101.33	31.945	1	1286400			1536	347	888	927	2092	2092		9606
LISQIVSSITASLR	14	Unmodified	_LISQIVSSITASLR_			0	0	0	P68363;Q9H853;P68366	P68363;P68366	P68363	TUBA1B;TUBA4B;TUBA4A	Tubulin alpha-1B chain;Putative tubulin-like protein alpha-4B;Tubulin alpha-4A chain	MULTI-MSMS	DP1141_10	5	744.4421997070312	2	744.443223	1486.87189	0.86101	0.00064097	-0.014066	-1.0471E-05	0.84694	0.0006305	744.4424746882887	23.904	0.26165	23.904	23.712	23.974	0					6	3	2	0	0	0	2.3554E-05	3	20253	20221;20253;20335		150.06	79.262	1	2105800			1537	321;322	889	928	2093;2094;2095	2094		9606
LISQIVSSITASLR	14	Unmodified	_LISQIVSSITASLR_			0	0	0	P68363;Q9H853;P68366	P68363;P68366	P68363	TUBA1B;TUBA4B;TUBA4A	Tubulin alpha-1B chain;Putative tubulin-like protein alpha-4B;Tubulin alpha-4A chain	MSMS	DP1141_7	2	744.1651000976562	2	744.443223	1486.87189	NaN	NaN	NaN	NaN	NaN	NaN	NaN	23.936	1	23.936	23.436	24.436	0								0	0	0	0.012313	1	19889	19889		103.26	45.009	1				1538	321;322	889	928	2096	2096		9606
LISQIVSSITASLR	14	Unmodified	_LISQIVSSITASLR_			0	0	0	P68363;Q9H853;P68366	P68363;P68366	P68363	TUBA1B;TUBA4B;TUBA4A	Tubulin alpha-1B chain;Putative tubulin-like protein alpha-4B;Tubulin alpha-4A chain	MULTI-MSMS	DP1141_8	3	744.9454345703125	2	744.443223	1486.87189	0.84275	0.00062738	-0.22087	-0.00016442	0.62188	0.00046295	744.4431592947469	23.903	0.38718	23.903	23.711	24.098	0					8	4	3	0	0	0	5.658999999999999E-21	2	19678	19678;19776		168.85	136.63	1	16554000			1539	321;322	889	928	2097;2098	2097		9606
LISQIVSSITASLR	14	Unmodified	_LISQIVSSITASLR_			0	0	0	P68363;Q9H853;P68366	P68363;P68366	P68363	TUBA1B;TUBA4B;TUBA4A	Tubulin alpha-1B chain;Putative tubulin-like protein alpha-4B;Tubulin alpha-4A chain	MULTI-MSMS	DP1141_9	4	744.4435424804688	2	744.443223	1486.87189	1.0381	0.00077283	-1.0476	-0.0007799	-0.0095088	-7.0787E-06	744.4424209730219	23.902	0.2163	23.902	23.748	23.964	0					4	2	2	0	0	0	0.00034536	2	19758	19607;19758		146.16	113.75	1	3092800			1540	321;322	889	928	2099;2100	2100		9606
LITEDVQGK	9	Unmodified	_LITEDVQGK_			0	0	0	P61247	P61247	P61247	RPS3A	40S ribosomal protein S3a	MULTI-MSMS	DP1141_9	4	501.7772521972656	2	501.776939	1001.53933	0.052413	2.6299E-05	0.35187	0.00017656	0.40429	0.00020286	501.77700303570106	15.419	0.7857	15.419	14.887	15.673	0					10	7	2	0	0	0	0.0073441	1	6510	6510		118.74	69.302	1	79065000			1541	280	890	929	2101	2101		9606
LITKPSEGTTLR	12	Unmodified	_LITKPSEGTTLR_			0	0	1	P49959	P49959	P49959	MRE11A	Double-strand break repair protein MRE11A	MULTI-MSMS	DP1141_8	3	439.25958251953125	3	439.257515	1314.75072	0.38131	0.00016749	0.28018	0.00012307	0.66149	0.00029056	439.2577841683435	15.122	0.49858	15.122	14.772	15.271	0					9	4	3	0	0	0	0.0091458	1	6174	6174		132.32	84.135	1	82397000			1542	254	891	930	2102	2102		9606
LITPAVVSER	10	Unmodified	_LITPAVVSER_			0	0	0	P62851	P62851	P62851	RPS25	40S ribosomal protein S25	MULTI-MSMS	DP1141_10	5	542.8120727539062	2	542.821681	1083.62881	-0.48714	-0.00026443	1.4908	0.00080923	1.0036	0.0005448	542.8221574697669	17.463	0.70047	17.463	17.087	17.788	0					15	6	3	0	0	0	0.018475	1	10350	10350		86.136	36.718	1	27356000			1543	308	892	931	2103	2103		9606
LIVENLSSR	9	Unmodified	_LIVENLSSR_			0	0	0	Q13243;Q13247;Q08170	Q13243	Q13243	SRSF5;SRSF6;SRSF4	Serine/arginine-rich splicing factor 5;Serine/arginine-rich splicing factor 6;Serine/arginine-rich splicing factor 4	MSMS	DP1141_9	4	515.7984619140625	2	515.798206	1029.58186	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.314	1	17.314	16.814	17.814	0								0	0	0	1.9758E-16	1	9625	9625		157.33	76.867	1				1544	355	893	932	2104	2104		9606
LIWEVWMPFVR	11	Oxidation (M)	_LIWEVWM(Oxidation (M))PFVR_	LIWEVWM(1)PFVR	LIWEVWM(82)PFVR	0	1	0	Q9UBB9	Q9UBB9	Q9UBB9	TFIP11	Tuftelin-interacting protein 11	MSMS	DP1141_7	2	746.8721313476562	2	746.39449	1490.77443	NaN	NaN	NaN	NaN	NaN	NaN	NaN	23.939	1	23.939	23.439	24.439	0								0	0	0	0.032703	1	19894	19894		82.426	47.653	1				1545	586	894	933	2105	2105	414	9606
LKATVTPSPVK	11	Unmodified	_LKATVTPSPVK_			0	0	1	Q9H1E3	Q9H1E3	Q9H1E3	NUCKS1	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1	MULTI-SECPEP	DP1141_9	4	570.9385375976562	2	570.852981	1139.69141	0.16833	9.6091E-05	0.34803	0.00019867	0.51636	0.00029476	570.8531390565983	14.344	0.2261	14.344	14.247	14.473	0					4	2	2	0	0	0	0.012355	1	4908	4908		103.26	15.616	1	11560000			1546	556	895	934	2106	2106		9606
LKECCDKPLLEK	12	Unmodified	_LKECCDKPLLEK_			0	0	2	CON__P02769	CON__P02769	CON__P02769			MULTI-MSMS	DP1141_8	3	511.59857177734375	3	511.598555	1531.77384	0.36086	0.00018462	-0.58555	-0.00029957	-0.22468	-0.00011495	511.5983000615746	14.527	0.22305	14.527	14.354	14.577	0					6	2	3	0	0	0	0.0099808	1	5250	5250		91.62	42.197	1	10214000		+	1547	15	896	935	2107	2107		
LKEREEFLIPIYHQVAVQFADLHDTPGR	28	Unmodified	_LKEREEFLIPIYHQVAVQFADLHDTPGR_			0	0	2	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_10	5	665.3538208007812	5	665.153396	3320.7306	0.26866	0.0001787	0.77142	0.00051311	1.0401	0.00069181	665.3543463711457	21.326	0.48393	21.326	20.975	21.459	0					11	4	4	0	0	0	3.353E-12	3	16524	16303;16524;16585		119.14	112.32	1	13785000			1548	367	897	936	2108;2109;2110	2109		9606
LKEREEFLIPIYHQVAVQFADLHDTPGR	28	Unmodified	_LKEREEFLIPIYHQVAVQFADLHDTPGR_			0	0	2	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_9	4	831.4082641601562	4	831.189925	3320.7306	-0.32606	-0.00027102	0.86217	0.00071663	0.53611	0.00044561	831.6925438179339	21.36	0.40082	21.36	21.138	21.538	0					5	3	2	0	0	0	0.0021723	1	15857	15857		46.63	24.959	1	4350300			1549	367	897	936	2111	2111		9606
LKETGYVVERPSTTK	15	Unmodified	_LKETGYVVERPSTTK_			0	0	2	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_6	1	570.3158569335938	3	569.98071	1706.9203	-0.052405	-2.987E-05	0.30722	0.00017511	0.25481	0.00014524	569.9809233209555	14.858	0.39969	14.858	14.609	15.008	0					6	3	2	0	0	0	0.01115	1	5290	5290		113.37	72.127	1	11301000			1550	580	898	937	2112	2112		9606
LKETGYVVERPSTTK	15	Unmodified	_LKETGYVVERPSTTK_			0	0	2	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_7	2	569.9808959960938	3	569.98071	1706.9203	0.10084	5.7477E-05	-0.26866	-0.00015313	-0.16782	-9.5654E-05	569.9805434521642	14.859	0.60114	14.859	14.508	15.109	0					14	5	5	0	0	0	0.0019385	1	5831	5831		154.72	98.632	1	115230000			1551	580	898	937	2113	2113		9606
LKETGYVVERPSTTK	15	Unmodified	_LKETGYVVERPSTTK_			0	0	2	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_7	2	427.7373352050781	4	427.737351	1706.9203	0.16652	7.1225E-05	-0.43877	-0.00018768	-0.27226	-0.00011645	427.73715085796186	14.859	0.30069	14.859	14.608	14.909	0					4	2	2	0	0	0	0.011657	1	5846	5846		88.282	65.274	1	84601000			1552	580	898	937	2114	2114		9606
LKETGYVVERPSTTK	15	Unmodified	_LKETGYVVERPSTTK_			0	0	2	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MSMS	DP1141_7	2	854.3820190429688	2	854.467426	1706.9203	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.846	1	14.846	14.346	15.346	0								0	0	0	1.1985E-109	1	5802	5802		206.32	128.65	1				1553	580	898	937	2115	2115		9606
LKGDDLQAIKK	11	Unmodified	_LKGDDLQAIKK_			0	0	2	P07910	P07910	P07910	HNRNPC	Heterogeneous nuclear ribonucleoproteins C1/C2	MULTI-MSMS	DP1141_9	4	410.2470397949219	3	410.246839	1227.71869	0.19694	8.0796E-05	0.14693	6.028E-05	0.34388	0.00014108	410.24689571620246	14.344	0.45594	14.344	14.178	14.634	0					8	5	3	0	0	0	0.0029215	1	4847	4847		127.87	49.355	1	39951000			1554	124	899	938	2116	2116		9606
LKNPNAPMLPPPK	13	Oxidation (M)	_LKNPNAPM(Oxidation (M))LPPPK_	LKNPNAPM(1)LPPPK	LKNPNAPM(96)LPPPK	0	1	1	O15042	O15042	O15042	U2SURP	U2 snRNP-associated SURP motif-containing protein	MULTI-SECPEP	DP1141_7	2	478.5746765136719	3	478.270878	1431.79081	0.059387	2.8403E-05	-0.4993	-0.0002388	-0.43992	-0.0002104	478.27109647482973	15.168	0.90578	15.168	14.809	15.714	0					20	8	4	0	0	0	0.0018284	1	6306	6306		96.067	71.214	1	40078000			1555	49	900	939	2117	2117	41	9606
LKPDPEPDDKNQEPSSCK	18	Unmodified	_LKPDPEPDDKNQEPSSCK_			0	0	2	Q9GZU8	Q9GZU8	Q9GZU8	FAM192A	Protein FAM192A	MULTI-MSMS	DP1141_9	4	695.6597290039062	3	695.324876	2082.9528	0.20258	0.00014086	0.34721	0.00024143	0.5498	0.00038229	695.659473690499	12.752	1.0362	12.752	12.502	13.538	0					23	10	5	0	0	0	0.0083891	1	2835	2835		118.55	101.25	1	9910100			1556	551	901	940	2118	2118		9606
LLADQAEAR	9	Unmodified	_LLADQAEAR_			0	0	0	P84098	P84098	P84098	RPL19	60S ribosomal protein L19	MULTI-SECPEP	DP1141_10	5	493.9795227050781	2	493.766906	985.519259	0.16904	8.3466E-05	0.4115	0.00020318	0.58054	0.00028665	493.76715117048514	14.924	0.3723	14.924	14.667	15.039	0					11	4	4	0	0	0	9.2619E-05	1	6162	6162		143.89	67.04	1	15024000			1557	332	902	941	2119	2119		9606
LLAEGHPDPDAELQR	15	Unmodified	_LLAEGHPDPDAELQR_			0	0	0	P49756	P49756	P49756	RBM25	RNA-binding protein 25	MULTI-MSMS	DP1141_7	2	554.2813720703125	3	554.281159	1659.82165	0.40735	0.00022579	-0.10927	-6.0569E-05	0.29808	0.00016522	554.2811056161121	16.565	0.32318	16.565	16.415	16.738	0					11	3	5	0	0	0	0.0027345	2	8619	8619;8641		104.55	59.342	1	182250000			1558	251	903	942	2120;2121	2120		9606
LLAEGHPDPDAELQR	15	Unmodified	_LLAEGHPDPDAELQR_			0	0	0	P49756	P49756	P49756	RBM25	RNA-binding protein 25	MULTI-MSMS	DP1141_7	2	830.9185791015625	2	830.918101	1659.82165	0.73739	0.00061271	-0.20793	-0.00017277	0.52946	0.00043994	830.9181219931141	16.568	0.22961	16.568	16.415	16.644	0					6	2	3	0	0	0	0.021547	1	8638	8638		74.237	26.935	1	31921000			1559	251	903	942	2122	2122		9606
LLALNSLYSPK	11	Unmodified	_LLALNSLYSPK_			0	0	0	P78527	P78527	P78527	PRKDC	DNA-dependent protein kinase catalytic subunit	MULTI-SECPEP	DP1141_6	1	610.638671875	2	609.858264	1217.70197	0.75117	0.00045811	-0.4269	-0.00026035	0.32427	0.00019776	609.8579679715762	20.14	0.28451	20.14	19.906	20.19	0					4	2	2	0	0	0	0.0049008	1	13563	13563		110.53	47.115	1	5683400			1560	329	904	943	2123	2123		9606
LLASTLVHSVK	11	Unmodified	_LLASTLVHSVK_			0	0	0	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MSMS	DP1141_7	2	584.8472900390625	2	584.358431	1166.70231	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.354	1	17.354	16.854	17.854	0								0	0	0	0.033132	1	9856	9856		94.409	41.32	1				1561	580	905	944	2124	2124		9606
LLDAESEDRPK	11	Unmodified	_LLDAESEDRPK_			0	0	1	O95239;Q2VIQ3	O95239	O95239	KIF4A;KIF4B	Chromosome-associated kinesin KIF4A;Chromosome-associated kinesin KIF4B	MULTI-MSMS	DP1141_7	2	424.89080810546875	3	424.885858	1271.63574	0.2769	0.00011765	-1.072	-0.00045549	-0.79512	-0.00033784	425.21926131166	14.658	0.40025	14.658	14.408	14.809	0					5	3	2	0	0	0	0.014632	1	5494	5494		132.25	77.186	1	17860000			1562	89	906	945	2125	2125		9606
LLDAESEDRPK	11	Unmodified	_LLDAESEDRPK_			0	0	1	O95239;Q2VIQ3	O95239	O95239	KIF4A;KIF4B	Chromosome-associated kinesin KIF4A;Chromosome-associated kinesin KIF4B	MSMS	DP1141_7	2	636.6318359375	2	636.825149	1271.63574	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.651	1	14.651	14.151	15.151	0								0	0	0	0.0092176	1	5506	5506		98.943	51.861	1				1563	89	906	945	2126	2126		9606
LLDLQVR	7	Unmodified	_LLDLQVR_			0	0	0	Q6ZMZ3	Q6ZMZ3	Q6ZMZ3	SYNE3	Nesprin-3	MULTI-MSMS	DP1141_7	2	428.7538757324219	2	428.766178	855.517802	0.7064	0.00030288	-0.80426	-0.00034484	-0.097869	-4.1963E-05	428.76591823061557	16.594	0.71682	16.594	16.114	16.831	0					24	7	5	0	0	0	0.0030729	1	8933	8933		114.59	54.977	1	1685099999.9999998			1564	440	907	946	2127	2127		9606
LLDSLEPPGEPGPSTNIPENDTVDGREEK	29	Unmodified	_LLDSLEPPGEPGPSTNIPENDTVDGREEK_			0	0	1	Q92734	Q92734	Q92734	TFG	Protein TFG	MULTI-MSMS	DP1141_8	3	1036.50390625	3	1035.83347	3104.47858	0.89382	0.00092584	0.4611	0.00047762	1.3549	0.0014035	1036.1678813311316	18.926	0.40032	18.926	18.675	19.075	0					8	3	3	0	0	0	9.5084E-09	1	12336	12336		83.202	59.762	1	14614000			1565	493	908	947	2128	2128		9606
LLEGEDAHLTQYK	13	Unmodified	_LLEGEDAHLTQYK_			0	0	0	CON__Q04695;Q04695;CON__Q9QWL7	CON__Q04695	CON__Q04695	KRT17	Keratin, type I cytoskeletal 17	MULTI-MSMS	DP1141_9	4	506.2598876953125	3	506.259584	1515.75692	-0.18272	-9.2503E-05	0.72055	0.00036478	0.53783	0.00027228	506.25991767684553	16.907	0.26552	16.907	16.782	17.047	0					11	3	4	0	0	0	4.1299999999999996E-21	1	8969	8969		169.23	125.68	1	73623000		+	1566	21	909	948	2129	2129		9606
LLEGEDAHLTQYK	13	Unmodified	_LLEGEDAHLTQYK_			0	0	0	CON__Q04695;Q04695;CON__Q9QWL7	CON__Q04695	CON__Q04695	KRT17	Keratin, type I cytoskeletal 17	MULTI-MSMS	DP1141_9	4	759.387939453125	2	758.885738	1515.75692	0.72722	0.00055188	-0.30359	-0.00023039	0.42364	0.00032149	758.8857226335466	16.907	0.35613	16.907	16.782	17.138	0					8	4	3	0	0	0	0.00010693	1	9007	9007		138.76	68.951	1	18187000		+	1567	21	909	948	2130	2130		9606
LLEQYKEESK	10	Unmodified	_LLEQYKEESK_			0	0	1	Q00839	Q00839	Q00839	HNRNPU	Heterogeneous nuclear ribonucleoprotein U	MULTI-SECPEP	DP1141_7	2	423.5581359863281	3	422.890721	1265.65033	0.077524	3.2784E-05	0.60414	0.00025548	0.68166	0.00028827	422.8906629071902	14.859	1.206	14.859	14.708	15.914	0					12	11	2	0	0	0	4.9364E-07	1	5835	5835		145.9	91.838	1	32783000			1568	337	910	949	2131	2131		9606
LLETESFQMNR	11	Oxidation (M)	_LLETESFQM(Oxidation (M))NR_	LLETESFQM(1)NR	LLETESFQM(210)NR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	692.3182983398438	2	692.332284	1382.65001	0.94481	0.00065412	-0.89274	-0.00061807	0.052069	3.6049E-05	692.3317722160543	17.253	1.7752	17.253	16.729	18.504	0					35	18	4	0	0	0	3.4651E-95	3	9028	9028;9114;9173		214.23	171.36	1	729380000			1569	367	911	950	2132;2133;2134	2132	273	9606
LLETESFQMNR	11	Unmodified	_LLETESFQMNR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MSMS	DP1141_6	1	684.3392944335938	2	684.334827	1366.6551	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.635	1	18.635	18.135	19.135	0								0	0	0	1.0106E-07	1	11285	11285		143.37	101.95	1				1570	367	911	951	2135	2135		9606
LLETESFQMNR	11	Unmodified	_LLETESFQMNR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_8	3	684.8194580078125	2	684.334827	1366.6551	0.8008	0.00054802	3.1722	0.0021709	3.973	0.0027189	684.3365748949005	18.425	0.49998	18.425	18.175	18.675	0					6	4	2	0	0	0	0.0042766	1	11605	11605		96.668	44.186	1	7966300			1571	367	911	951	2136	2136		9606
LLETTDRPDGHQNNLR	16	Unmodified	_LLETTDRPDGHQNNLR_			0	0	1	Q14974	Q14974	Q14974	KPNB1	Importin subunit beta-1	MULTI-SECPEP	DP1141_7	2	470.90789794921875	4	470.490873	1877.93439	0.23754	0.00011176	-0.48038	-0.00022601	-0.24284	-0.00011426	470.74137700779704	14.859	0.30071	14.859	14.708	15.009	0					6	2	3	0	0	0	0.003034	1	5766	5766		86.756	60.799	1	51925000			1572	395	912	952	2137	2137		9606
LLEVEHPAAK	10	Unmodified	_LLEVEHPAAK_			0	0	0	P17987	P17987	P17987	TCP1	T-complex protein 1 subunit alpha	MSMS	DP1141_6	1	553.8919677734375	2	553.813856	1105.61316	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.898	1	14.898	14.398	15.398	0								0	0	0	0.02711	1	5270	5270		122.19	35.715	1				1573	165	913	953	2138	2138		9606
LLEVQGSRPGK	11	Unmodified	_LLEVQGSRPGK_			0	0	1	P62136	P62136	P62136	PPP1CA	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit	MULTI-MSMS	DP1141_10	5	592.3438720703125	2	592.343312	1182.67207	0.51154	0.00030301	0.38856	0.00023016	0.9001	0.00053317	592.3434902794648	14.631	0.26331	14.631	14.472	14.736	0					8	3	3	0	0	0	8.801899999999999E-21	1	5779	5779		154.84	80.671	1	36858000			1574	286	914	954	2139	2139		9606
LLEVQGSRPGK	11	Unmodified	_LLEVQGSRPGK_			0	0	1	P62136	P62136	P62136	PPP1CA	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit	MULTI-MSMS	DP1141_9	4	592.3439331054688	2	592.343312	1182.67207	0.48104	0.00028494	-0.15667	-9.2804E-05	0.32436	0.00019213	592.3431766799803	14.678	0.32222	14.678	14.473	14.795	0					10	3	4	0	0	0	1.3063E-20	1	5325	5325		156.16	75.706	1	103140000			1575	286	914	954	2140	2140		9606
LLEVQGSRPGK	11	Unmodified	_LLEVQGSRPGK_			0	0	1	P62136	P62136	P62136	PPP1CA	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit	MSMS	DP1141_9	4	395.2315368652344	3	395.2313	1182.67207	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.728	1	14.728	14.228	15.228	0								0	0	0	0.023942	1	5401	5401		119.34	41.802	1				1576	286	914	954	2141	2141		9606
LLEVQGSRPGK	11	Unmodified	_LLEVQGSRPGK_			0	0	1	P62136	P62136	P62136	PPP1CA	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit	MSMS	DP1141_9	4	395.231201171875	3	395.2313	1182.67207	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.77	1	14.77	14.27	15.27	0								0	0	0	0.010818	1	5468	5468		110.54	61.939	1				1577	286	914	954	2142	2142		9606
LLGASELPIVTPALR	15	Unmodified	_LLGASELPIVTPALR_			0	0	0	P52292	P52292	P52292	KPNA2	Importin subunit alpha-1	MULTI-MSMS	DP1141_8	3	775.971435546875	2	775.469241	1548.92393	0.41456	0.00032148	0.39313	0.00030486	0.80769	0.00062634	775.4693950175974	21.429	0.30074	21.429	21.178	21.479	0					6	2	3	0	0	0	0.035606	1	16000	16000		61.213	29.719	1	16615000			1578	264	915	955	2143	2143		9606
LLGGHNEDLPSNR	13	Unmodified	_LLGGHNEDLPSNR_			0	0	0	Q9BRD0	Q9BRD0	Q9BRD0	BUD13	BUD13 homolog	MSMS	DP1141_10	5	474.2690734863281	3	474.575907	1420.70589	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.413	1	15.413	14.913	15.913	0								0	0	0	0.01444	1	7006	7006		104.24	73.694	1				1579	537	916	956	2144	2144		9606
LLGGHNEDLPSNR	13	Unmodified	_LLGGHNEDLPSNR_			0	0	0	Q9BRD0	Q9BRD0	Q9BRD0	BUD13	BUD13 homolog	MULTI-SECPEP	DP1141_9	4	475.27703857421875	3	474.575907	1420.70589	0.53191	0.00025243	-0.39555	-0.00018772	0.13636	6.4714E-05	474.9100626972237	15.419	0.29865	15.419	15.274	15.573	0					4	2	2	0	0	0	0.00036557	1	6514	6514		117.86	98.364	1	8493200			1580	537	916	956	2145	2145		9606
LLGQFTLIGIPPAPR	15	Unmodified	_LLGQFTLIGIPPAPR_			0	0	0	P38646	P38646	P38646	HSPA9	Stress-70 protein, mitochondrial	MULTI-MSMS	DP1141_8	3	796.98046875	2	796.979776	1591.945	0.69536	0.00055419	-0.19237	-0.00015332	0.50298	0.00040087	796.9797145246226	22.429	0.54126	22.429	22.179	22.72	0					10	5	2	0	0	0	1.7229E-14	2	17482	17482;17566		166.86	119.6	1	39990000			1581	217	917	957	2146;2147	2146		9606
LLGQFTLIGIPPAPR	15	Unmodified	_LLGQFTLIGIPPAPR_			0	0	0	P38646	P38646	P38646	HSPA9	Stress-70 protein, mitochondrial	MULTI-MSMS	DP1141_8	3	797.482177734375	2	796.979776	1591.945	0.66394	0.00052915	0.28515	0.00022726	0.94909	0.0007564	797.4816233048276	23.104	0.4368	23.104	22.72	23.157	0					8	5	2	0	0	0	0.014461	1	18001	18001		82.379	57.997	1	7956700			1582	217	917	957	2148	2148		9606
LLGQFTLIGIPPAPR	15	Unmodified	_LLGQFTLIGIPPAPR_			0	0	0	P38646	P38646	P38646	HSPA9	Stress-70 protein, mitochondrial	MULTI-MSMS	DP1141_9	4	796.9805908203125	2	796.979776	1591.945	0.22211	0.00017702	1.5366	0.0012246	1.7587	0.0014017	796.9804158471387	22.394	0.29891	22.394	22.205	22.504	0					5	3	2	0	0	0	0.0043217	1	17568	17568		103.08	70.353	1	6948200			1583	217	917	957	2149	2149		9606
LLHYLGHVMVNGPTTPIPVK	20	Oxidation (M)	_LLHYLGHVM(Oxidation (M))VNGPTTPIPVK_	LLHYLGHVM(1)VNGPTTPIPVK	LLHYLGHVM(73)VNGPTTPIPVK	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	551.5589599609375	4	551.308047	2201.20308	0.29328	0.00016169	-4.0733	-0.0022456	-3.78	-0.002084	551.8064722441616	18.561	0.50019	18.561	18.305	18.805	0					14	4	4	0	0	0	0.0031335	1	11187	11187		73.279	53.46	1	20543000			1584	142	918	958	2150	2150	143	9606
LLHYLGHVMVNGPTTPIPVK	20	Oxidation (M)	_LLHYLGHVM(Oxidation (M))VNGPTTPIPVK_	LLHYLGHVM(1)VNGPTTPIPVK	LLHYLGHVM(72)VNGPTTPIPVK	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MSMS	DP1141_6	1	734.4256591796875	3	734.741637	2201.20308	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.507	1	18.507	18.007	19.007	0								0	0	0	0.016861	1	11081	11081		71.685	50.64	1				1585	142	918	958	2151	2151	143	9606
LLHYLGHVMVNGPTTPIPVK	20	Oxidation (M)	_LLHYLGHVM(Oxidation (M))VNGPTTPIPVK_	LLHYLGHVM(1)VNGPTTPIPVK	LLHYLGHVM(94)VNGPTTPIPVK	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	551.6283569335938	4	551.308047	2201.20308	0.06321	3.4848E-05	-1.1291	-0.00062246	-1.0659	-0.00058761	551.5574897125268	18.399	0.60052	18.399	18.149	18.75	0					8	5	2	0	0	0	0.00072223	1	11638	11638		94.454	74.729	1	189410000			1586	142	918	958	2152	2152	143	9606
LLHYLGHVMVNGPTTPIPVK	20	Oxidation (M)	_LLHYLGHVM(Oxidation (M))VNGPTTPIPVK_	LLHYLGHVM(1)VNGPTTPIPVK	LLHYLGHVM(78)VNGPTTPIPVK	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	735.4050903320312	3	734.741637	2201.20308	0.21468	0.00015773	-2.1474	-0.0015778	-1.9328	-0.0014201	735.0743616223297	18.399	0.50044	18.399	18.249	18.75	0					18	4	5	0	0	0	0.0021695	3	11883	11714;11755;11883		78.244	61.929	1	210680000			1587	142	918	958	2153;2154;2155	2155	143	9606
LLHYLGHVMVNGPTTPIPVK	20	Oxidation (M)	_LLHYLGHVM(Oxidation (M))VNGPTTPIPVK_	LLHYLGHVM(1)VNGPTTPIPVK	LLHYLGHVM(100)VNGPTTPIPVK	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	1102.110107421875	2	1101.60882	2201.20308	0.26065	0.00028713	-2.4855	-0.002738	-2.2248	-0.0024509	1102.108116006246	18.399	0.50044	18.399	18.249	18.75	0					6	4	2	0	0	0	0.001069	1	11751	11751		99.522	63.759	1	29940000			1588	142	918	958	2156	2156	143	9606
LLHYLGHVMVNGPTTPIPVK	20	Unmodified	_LLHYLGHVMVNGPTTPIPVK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	547.560302734375	4	547.309318	2185.20817	-0.038862	-2.1269E-05	-3.0172	-0.0016513	-3.0561	-0.0016726	547.8081036457268	19.1	0.60106	19.1	18.85	19.451	0					19	5	4	0	0	0	0.001344	2	12674	12674;12817		81.428	62.392	1	69558000			1589	142	918	959	2157;2158	2157		9606
LLHYLGHVMVNGPTTPIPVK	20	Unmodified	_LLHYLGHVMVNGPTTPIPVK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	729.744873046875	3	729.409998	2185.20817	-0.039466	-2.8787E-05	-3.5691	-0.0026033	-3.6085	-0.0026321	729.7421548948237	19.1	0.70095	19.1	18.85	19.551	0					21	6	5	0	0	0	0.001415	3	12678	12678;12813;13010		94.61	71.563	1	83461000			1590	142	918	959	2159;2160;2161	2159		9606
LLIYETEAKK	10	Unmodified	_LLIYETEAKK_			0	0	1	P49756	P49756	P49756	RBM25	RNA-binding protein 25	MULTI-MSMS	DP1141_7	2	403.72119140625	3	403.23594	1206.68599	0.32053	0.00012925	-0.29661	-0.0001196	0.023925	9.6473E-06	403.2358128844638	16.265	0.30022	16.265	16.114	16.415	0					4	2	2	0	0	0	0.032666	1	8129	8129		71.451	51.42	1	6228300			1591	251	919	960	2162	2162		9606
LLLDHFANR	9	Unmodified	_LLLDHFANR_			0	0	0	Q9UM47	Q9UM47	Q9UM47	NOTCH3	Neurogenic locus notch homolog protein 3;Notch 3 extracellular truncation;Notch 3 intracellular domain	MULTI-MSMS	DP1141_6	1	550.2345581054688	2	549.806365	1097.59818	-0.51894	-0.00028531	0.42259	0.00023234	-0.096343	-5.297E-05	550.3084543070761	15.259	0.50222	15.259	15.008	15.51	0					6	4	2	0	0	0	0.01058	2	5893	5805;5893		97.602	0	1	10091000			1592	602	920	961	2163;2164	2164		9606
LLLEDLVK	8	Unmodified	_LLLEDLVK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_10	5	471.7972106933594	2	471.797143	941.579734	0.62922	0.00029687	-0.24389	-0.00011506	0.38534	0.0001818	471.7969272729263	20.925	0.30052	20.925	20.775	21.076	0					6	2	3	0	0	0	0.0030737	1	15985	15985		120.49	32.46	1	42050000			1593	367	921	962	2165	2165		9606
LLLEDLVK	8	Unmodified	_LLLEDLVK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	471.7973327636719	2	471.797143	941.579734	0.6754	0.00031865	-0.41322	-0.00019496	0.26218	0.0001237	471.797190962812	20.997	0.69835	20.997	20.772	21.47	0					15	7	3	0	0	0	6.2505E-06	1	14972	14972		145.04	69.01	1	748890000			1594	367	921	962	2166	2166		9606
LLLEDLVK	8	Unmodified	_LLLEDLVK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_8	3	471.7972412109375	2	471.797143	941.579734	0.3396	0.00016022	0.0044148	2.0829E-06	0.34401	0.0001623	471.7970612610395	20.955	0.29982	20.955	20.778	21.078	0					6	2	3	0	0	0	0.014814	1	15375	15375		92.467	25.473	1	12327000			1595	367	921	962	2167	2167		9606
LLLPGELAK	9	Unmodified	_LLLPGELAK_			0	0	0	Q99880;Q99879;Q99877;Q93079;Q5QNW6;P62807;P58876;P57053;O60814;Q8N257;Q16778;P33778;P23527;P06899;A0A2R8Y619;Q96A08	Q99880	Q99880	HIST1H2BL;HIST1H2BM;HIST1H2BN;HIST1H2BH;HIST2H2BF;HIST1H2BC;HIST1H2BD;H2BFS;HIST1H2BK;HIST3H2BB;HIST2H2BE;HIST1H2BB;HIST1H2BO;HIST1H2BJ;HIST1H2BA	Histone H2B type 1-L;Histone H2B type 1-M;Histone H2B type 1-N;Histone H2B type 1-H;Histone H2B type 2-F;Histone H2B type 1-C/E/F/G/I;Histone H2B type 1-D;Histone H2B type F-S;Histone H2B type 1-K;Histone H2B type 3-B;Histone H2B type 2-E;Histone H2B type 1-B;Histone H2B type 1-O;Histone H2B type 1-J;Histone H2B type 1-A	MULTI-SECPEP	DP1141_10	5	954.1343994140625	1	953.602995	952.595718	0.69146	0.00065938	-0.23333	-0.00022251	0.45813	0.00043687	953.6026906429801	19.127	0.29978	19.127	18.977	19.277	0					6	2	3	0	0	0	0.00072002	1	13042	13042		115.49	31.742	1	64859000			1596	65	922	963	2168	2168		9606
LLLPWLEAR	9	Unmodified	_LLLPWLEAR_			0	0	0	Q00610	Q00610	Q00610	CLTC	Clathrin heavy chain 1	MULTI-MSMS	DP1141_7	2	555.8370971679688	2	555.837134	1109.65972	0.19493	0.00010835	0.0067186	3.7344E-06	0.20165	0.00011208	555.8371203776444	22.855	0.17739	22.855	22.728	22.906	0					4	2	2	0	0	0	0.0066678	1	18305	18305		116.73	84.965	1	5110100			1597	336	923	964	2169	2169		9606
LLLQVQHASK	10	Unmodified	_LLLQVQHASK_			0	0	0	P05141;P12236;P12235	P05141	P05141	SLC25A5;SLC25A6;SLC25A4	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed;ADP/ATP translocase 3;ADP/ATP translocase 3, N-terminally processed;ADP/ATP translocase 1	MSMS	DP1141_10	5	568.7889404296875	2	568.842948	1135.67134	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.718	1	15.718	15.218	16.218	0								0	0	0	1.2725E-09	1	7504	7504		143.7	30.204	1				1598	109	924	965	2170	2170		9606
LLLQVQHASK	10	Unmodified	_LLLQVQHASK_			0	0	0	P05141;P12236;P12235	P05141	P05141	SLC25A5;SLC25A6;SLC25A4	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed;ADP/ATP translocase 3;ADP/ATP translocase 3, N-terminally processed;ADP/ATP translocase 1	MSMS	DP1141_10	5	569.28076171875	2	568.842948	1135.67134	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.756	1	15.756	15.256	16.256	0								0	0	0	1.3034E-69	1	7567	7567		190.26	65.667	1				1599	109	924	965	2171	2171		9606
LLLQVQHASK	10	Unmodified	_LLLQVQHASK_			0	0	0	P05141;P12236;P12235	P05141	P05141	SLC25A5;SLC25A6;SLC25A4	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed;ADP/ATP translocase 3;ADP/ATP translocase 3, N-terminally processed;ADP/ATP translocase 1	MULTI-MSMS	DP1141_6	1	569.2805786132812	2	568.842948	1135.67134	0.4068	0.00023141	0.23732	0.000135	0.64413	0.00036641	568.8431242235149	15.753	0.49427	15.753	15.51	16.005	0					8	4	3	0	0	0	2.206E-40	1	6581	6581		182.98	49.385	1	51668000			1600	109	924	965	2172	2172		9606
LLLQVQHASK	10	Unmodified	_LLLQVQHASK_			0	0	0	P05141;P12236;P12235	P05141	P05141	SLC25A5;SLC25A6;SLC25A4	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed;ADP/ATP translocase 3;ADP/ATP translocase 3, N-terminally processed;ADP/ATP translocase 1	MULTI-MSMS	DP1141_9	4	569.6314086914062	2	568.842948	1135.67134	0.1959	0.00011144	0.24024	0.00013666	0.43614	0.0002481	568.8430583284809	15.722	0.29965	15.722	15.573	15.872	0					4	2	2	0	0	0	0.0025628	2	6970	6970;7062		141.52	35.93	1	26265000			1601	109	924	965	2173;2174	2173		9606
LLPCLHSACSACLGPAAPAAANSSGDGGAAGDGTVVDCPVCK	42	Unmodified	_LLPCLHSACSACLGPAAPAAANSSGDGGAAGDGTVVDCPVCK_			0	0	0	Q13263	Q13263	Q13263	TRIM28	Transcription intermediary factor 1-beta	MULTI-MSMS	DP1141_7	2	1371.955322265625	3	1371.28481	4110.83259	0.092769	0.00012721	-0.072372	-9.9242E-05	0.020397	2.797E-05	1371.9536579551261	19	0.30063	19	18.85	19.15	0					6	2	3	0	0	0	5.1391000000000003E-20	1	12699	12699		71.878	61.498	1	20341000			1602	372	925	966	2175	2175		9606
LLQDFFNGK	9	Unmodified	_LLQDFFNGK_			0	0	0	P11142;P54652;P17066	P11142;P17066	P11142	HSPA8;HSPA2;HSPA6	Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2;Heat shock 70 kDa protein 6	MULTI-MSMS	DP1141_8	3	541.7796630859375	2	541.287474	1080.5604	0.5911	0.00031996	-0.46165	-0.00024989	0.12945	7.0071E-05	541.2870066185578	20.226	0.40089	20.226	20.076	20.477	0					5	3	2	0	0	0	2.206E-08	1	14202	14202		155.51	70.245	1	81561000			1603	140;161	926	967	2176	2176		9606
LLQDFFNGR	9	Unmodified	_LLQDFFNGR_			0	0	0	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-MSMS	DP1141_8	3	555.2908325195312	2	555.290548	1108.56654	0.2745	0.00015243	0.32986	0.00018317	0.60437	0.0003356	555.2907108615273	20.427	0.40129	20.427	20.176	20.578	0					10	3	4	0	0	0	0.0055569	2	14628	14628;14632		113.41	76.711	1	388910000			1604	135	927	968	2177;2178	2177		9606
LLQDFFNGR	9	Unmodified	_LLQDFFNGR_			0	0	0	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-SECPEP	DP1141_9	4	554.8345947265625	2	555.290548	1108.56654	0.45225	0.00025113	-0.099578	-5.5295E-05	0.35267	0.00019583	555.2905348781944	20.486	0.49922	20.486	20.037	20.536	0					8	4	3	0	0	0	2.3873999999999998E-36	1	14582	14582		203.19	146.46	1	37535000			1605	135	927	968	2179	2179		9606
LLQLVEDR	8	Unmodified	_LLQLVEDR_			0	0	0	P17844	P17844	P17844	DDX5	Probable ATP-dependent RNA helicase DDX5	MULTI-MSMS	DP1141_9	4	493.7978210449219	2	493.287474	984.560395	0.050092	2.471E-05	0.29673	0.00014637	0.34682	0.00017108	493.28758682356096	18.529	0.50029	18.529	18.137	18.637	0					10	4	3	0	0	0	0.017857	1	11230	11230		96.253	19.661	1	13636000			1606	163	928	969	2180	2180		9606
LLQSQLQVK	9	Unmodified	_LLQSQLQVK_			0	0	0	Q96I25	Q96I25	Q96I25	RBM17	Splicing factor 45	MULTI-SECPEP	DP1141_10	5	528.7955322265625	2	528.824224	1055.63389	0.033162	1.7537E-05	-3.0586	-0.0016175	-3.0255	-0.0015999	529.3232343452813	16.736	0.2536	16.736	16.543	16.797	0					5	3	2	0	0	0	0.019368	1	9046	9046		99.375	25.4	1	33847000			1607	513	929	970	2181	2181		9606
LLQSQLQVK	9	Unmodified	_LLQSQLQVK_			0	0	0	Q96I25	Q96I25	Q96I25	RBM17	Splicing factor 45	MULTI-SECPEP	DP1141_8	3	528.3447265625	2	528.824224	1055.63389	-0.23978	-0.0001268	0.24678	0.0001305	0.0069974	3.7004E-06	528.8245384348813	16.684	0.35826	16.684	16.469	16.828	0					5	3	2	0	0	0	0.0010594	1	8574	8574		161.11	78.44	1	81748000			1608	513	929	970	2182	2182		9606
LLSDATVEKDESHAGK	16	Unmodified	_LLSDATVEKDESHAGK_			0	0	1	Q14320	Q14320	Q14320	FAM50A	Protein FAM50A	MULTI-MSMS	DP1141_9	4	426.2330017089844	4	425.717887	1698.84244	0.43965	0.00018717	-0.2796	-0.00011903	0.16005	6.8138E-05	425.7177749929734	14.75	0.4989	14.75	14.388	14.887	0					9	5	2	0	0	0	1.7642E-08	1	5431	5431		156.2	123.9	1	108190000			1609	386	930	971	2183	2183		9606
LLVATSVAAR	10	Unmodified	_LLVATSVAAR_			0	0	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-MSMS	DP1141_6	1	500.8114013671875	2	500.811116	999.60768	-0.11552	-5.7853E-05	0.76442	0.00038283	0.6489	0.00032498	500.8114060077765	16.956	0.18051	16.956	16.824	17.004	0					6	2	3	0	0	0	0.002608	1	8584	8584		137.9	58.436	1	32807000			1610	445	931	972	2184	2184		9606
LLVATSVAAR	10	Unmodified	_LLVATSVAAR_			0	0	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-MSMS	DP1141_7	2	500.8113708496094	2	500.811116	999.60768	0.30077	0.00015063	0.23588	0.00011813	0.53665	0.00026876	500.81118773709625	16.903	0.41104	16.903	16.738	17.149	0					11	4	4	0	0	0	6.5943E-30	1	9140	9140		178.99	86.523	1	141030000			1611	445	931	972	2185	2185		9606
LLVATSVAAR	10	Unmodified	_LLVATSVAAR_			0	0	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-MSMS	DP1141_8	3	500.811279296875	2	500.811116	999.60768	0.33114	0.00016584	0.051154	2.5618E-05	0.38229	0.00019146	500.811125488108	16.923	0.24172	16.923	16.731	16.973	0					4	2	2	0	0	0	0.0041941	2	9086	8975;9086		111.17	31.699	1	47205000			1612	445	931	972	2186;2187	2187		9606
LLVATSVAAR	10	Unmodified	_LLVATSVAAR_			0	0	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-MSMS	DP1141_9	4	500.8113708496094	2	500.811116	999.60768	-0.078303	-3.9215E-05	0.41809	0.00020939	0.33979	0.00017017	500.811322901192	16.907	0.26552	16.907	16.782	17.047	0					6	3	2	0	0	0	0.010698	1	9009	9009		96.948	23.699	1	15873000			1613	445	931	972	2188	2188		9606
LLVDVDESTLSPEEQKER	18	Unmodified	_LLVDVDESTLSPEEQKER_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	1044.531005859375	2	1044.02877	2086.04299	0.30015	0.00031337	-0.09726	-0.00010154	0.20289	0.00021183	1044.5301031219853	18.319	0.30033	18.319	18.149	18.449	0					6	2	3	0	0	0	8.0913E-167	1	11575	11575		223.36	192.5	1	33695000			1614	78	932	973	2189	2189		9606
LLVDVDESTLSPEEQKER	18	Unmodified	_LLVDVDESTLSPEEQKER_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-SECPEP	DP1141_8	3	696.8472290039062	3	696.354941	2086.04299	0.92006	0.00064069	-0.29169	-0.00020312	0.62836	0.00043756	696.6888668828685	18.325	0.40003	18.325	18.175	18.575	0					9	3	4	0	0	0	8.3407E-114	1	11321	11321		217.39	189.41	1	139700000			1615	78	932	973	2190	2190		9606
LLVDVDESTLSPEEQKER	18	Unmodified	_LLVDVDESTLSPEEQKER_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_9	4	696.8472290039062	3	696.354941	2086.04299	0.39476	0.00027489	-0.07472	-5.2031E-05	0.32004	0.00022286	696.6891663464787	18.311	0.30026	18.311	18.137	18.437	0					6	2	3	0	0	0	1.2377E-15	1	11256	11256		166.3	132.04	1	9907100			1616	78	932	973	2191	2191		9606
LLVPTQFVGAIIGK	14	Unmodified	_LLVPTQFVGAIIGK_			0	0	0	O00425	O00425	O00425	IGF2BP3	Insulin-like growth factor 2 mRNA-binding protein 3	MULTI-MSMS	DP1141_8	3	728.450927734375	2	728.45032	1454.88609	0.41998	0.00030593	0.18917	0.0001378	0.60915	0.00044374	728.4505389392232	22.999	0.60502	22.999	22.72	23.325	0					10	7	2	0	0	0	0.0022534	1	18321	18321		123.11	0	1	6794200			1617	36	933	974	2192	2192		9606
LLYAFAEATVPK	12	Unmodified	_LLYAFAEATVPK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	661.8717651367188	2	661.871371	1321.72819	0.7164	0.00047417	0.26145	0.00017305	0.97785	0.00064721	661.8715300291252	20.427	0.40129	20.427	20.176	20.578	0					5	3	2	0	0	0	0.0063654	1	14512	14512		90.827	64.443	1	130090000			1618	111	934	975	2193	2193		9606
LMELNMEIRDMIRR	14	2 Oxidation (M)	_LM(Oxidation (M))ELNM(Oxidation (M))EIRDMIRR_	LM(1)ELNM(0.933)EIRDM(0.068)IRR	LM(35)ELNM(11)EIRDM(-11)IRR	0	2	2	Q5TBA9	Q5TBA9	Q5TBA9	FRY	Protein furry homolog	MULTI-MSMS	DP1141_9	4	618.3148803710938	3	617.979441	1850.91649	0.080099	4.95E-05	1.7295	0.0010688	1.8096	0.0011183	618.314770317043	20.287	0.50018	20.287	20.136	20.636	0					9	4	3	0	0	0	0.024039	1	14452	14452		51.135	11.45	3	56605000			1619	422	935	976	2194	2194	317;318	9606
LMTEILGR	8	Oxidation (M)	_LM(Oxidation (M))TEILGR_	LM(1)TEILGR	LM(110)TEILGR	0	1	0	O43809	O43809	O43809	NUDT21	Cleavage and polyadenylation specificity factor subunit 5	MULTI-MSMS	DP1141_10	5	475.2770080566406	2	474.762778	947.511002	-0.1882	-8.9349E-05	1.5049	0.00071448	1.3167	0.00062513	474.76344330746593	17.137	1.1401	17.137	16.847	17.987	0					18	12	2	0	0	0	0.030936	1	9922	9922		114.72	15.346	1	95955000			1620	61	936	977	2195	2195	51	9606
LMTQMRMGKK	10	3 Oxidation (M)	_LM(Oxidation (M))TQM(Oxidation (M))RM(Oxidation (M))GKK_	LM(1)TQM(1)RM(1)GKK	LM(59)TQM(59)RM(59)GKK	0	3	2	Q9UKN7	Q9UKN7	Q9UKN7	MYO15A	Unconventional myosin-XV	MSMS	DP1141_10	5	636.3171997070312	2	636.317068	1270.61958	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.741	1	18.741	18.241	19.241	0								0	0	0	0.031144	1	12510	12510		58.981	30.773	1				1621	598	937	978	2196	2196	416;417;418	9606
LMVELSK	7	Oxidation (M)	_LM(Oxidation (M))VELSK_	LM(1)VELSK	LM(100)VELSK	0	1	0	P48643	P48643	P48643	CCT5	T-complex protein 1 subunit epsilon	MSMS	DP1141_8	3	418.2334289550781	2	418.233322	834.45209	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.244	1	16.244	15.744	16.744	0								0	0	0	0.026549	1	7924	7924		102.77	8.7669	1				1622	244	938	979	2197	2197	196	9606
LNIPVSQVNPR	11	Unmodified	_LNIPVSQVNPR_			0	0	0	P05023;P13637	P05023;P13637	P13637	ATP1A1;ATP1A3	Sodium/potassium-transporting ATPase subunit alpha-1;Sodium/potassium-transporting ATPase subunit alpha-3	MULTI-SECPEP	DP1141_6	1	619.2893676757812	2	618.856586	1235.69862	1.1934	0.00073854	-0.57494	-0.0003558	0.61845	0.00038273	618.856116058431	17.655	0.30065	17.655	17.404	17.705	0					6	2	3	0	0	0	4.0637E-09	1	9658	9658		172.25	115.44	1	19801000			1623	147;106	939	980	2198	2198		9606
LNISYTR	7	Unmodified	_LNISYTR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_10	5	433.7373962402344	2	433.74016	865.465767	0.17574	7.6226E-05	-2.2764	-0.00098735	-2.1006	-0.00091113	433.73900198981727	16.51	0.68081	16.51	15.968	16.649	0					11	7	2	0	0	0	0.0054471	1	8796	8796		110.63	47.919	1	35570000			1624	521	940	981	2199	2199		9606
LNISYTR	7	Unmodified	_LNISYTR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	434.5823974609375	2	433.74016	865.465767	-0.21556	-9.3499E-05	-0.057768	-2.5056E-05	-0.27333	-0.00011855	433.74010117287196	16.513	0.28613	16.513	16.276	16.562	0					4	2	2	0	0	0	8.5119E-10	2	8389	8328;8389		148.21	64.919	1	409790000			1625	521	940	981	2200;2201	2201		9606
LNLDSIIGR	9	Unmodified	_LNLDSIIGR_			0	0	0	P62136	P62136	P62136	PPP1CA	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit	MULTI-MSMS	DP1141_9	4	501.26153564453125	2	500.792924	999.571294	-0.12541	-6.2805E-05	0.54778	0.00027432	0.42237	0.00021152	500.79320940954767	20.387	0.2998	20.387	20.237	20.536	0					4	2	2	0	0	0	1.8204E-13	1	14494	14494		163.67	85.928	1	51583000			1626	286	941	982	2202	2202		9606
LNVAHVLFMQENK	13	Oxidation (M)	_LNVAHVLFM(Oxidation (M))QENK_	LNVAHVLFM(1)QENK	LNVAHVLFM(55)QENK	0	1	0	Q8N4P2;Q86WT1	Q8N4P2	Q8N4P2	TTC30B;TTC30A	Tetratricopeptide repeat protein 30B;Tetratricopeptide repeat protein 30A	MULTI-MSMS	DP1141_6	1	520.2432861328125	3	520.273059	1557.79735	0.014409	7.4966E-06	-2.2106	-0.0011501	-2.1962	-0.0011426	520.2720751830941	16.255	0.58997	16.255	16.005	16.595	0					13	5	4	0	0	0	0.025478	2	7321	7321;7565		55.261	20.488	1	497250000			1627	459	942	983	2203;2204	2203	338	9606
LPAAGVGDMVMATVK	15	2 Oxidation (M)	_LPAAGVGDM(Oxidation (M))VM(Oxidation (M))ATVK_	LPAAGVGDM(1)VM(1)ATVK	LPAAGVGDM(110)VM(110)ATVK	0	2	0	P62829	P62829	P62829	RPL23	60S ribosomal protein L23	MULTI-MSMS	DP1141_10	5	746.38134765625	2	746.380919	1490.74729	0.19027	0.00014201	0.011537	8.6108E-06	0.20181	0.00015062	746.3811461502152	16.973	0.20912	16.973	16.878	17.087	0					8	2	4	0	0	0	0.0080649	3	9732	9694;9732;9736		108.68	77.861	1	137450000			1628	305	943	984	2205;2206;2207	2206	238;239	9606
LPCIYLVDSGGAYLPR	16	Unmodified	_LPCIYLVDSGGAYLPR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_6	1	897.4667358398438	2	897.466372	1792.91819	0.68987	0.00061913	-0.0054092	-4.8546E-06	0.68446	0.00061428	897.4663150178592	21.749	0.2407	21.749	21.546	21.787	0					6	2	3	0	0	0	1.8493E-54	1	16157	16157		190.26	167.54	1	13345000			1629	567	944	985	2208	2208		9606
LPCIYLVDSGGAYLPR	16	Unmodified	_LPCIYLVDSGGAYLPR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	897.9682006835938	2	897.466372	1792.91819	0.46033	0.00041313	0.20155	0.00018089	0.66188	0.00059402	897.4669031421371	21.729	0.50035	21.729	21.479	21.979	0					15	4	5	0	0	0	7.5559E-287	2	16391	16391;16413		262.07	184.32	1	1048799999.9999999			1630	567	944	985	2209;2210	2209		9606
LPCIYLVDSGGAYLPR	16	Unmodified	_LPCIYLVDSGGAYLPR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	897.9679565429688	2	897.466372	1792.91819	0.94866	0.00085139	-0.6736	-0.00060453	0.27506	0.00024686	897.9672765894512	21.752	0.39379	21.752	21.438	21.832	0					13	3	5	0	0	0	3.4862E-09	1	16563	16563		158.08	101.14	1	11140000			1631	567	944	985	2211	2211		9606
LPELFETGR	9	Unmodified	_LPELFETGR_			0	0	0	P78318	P78318	P78318	IGBP1	Immunoglobulin-binding protein 1	MULTI-SECPEP	DP1141_9	4	531.9514770507812	2	531.284931	1060.55531	0.41193	0.00021885	0.032554	1.7295E-05	0.44448	0.00023615	531.2849437054401	19.589	0.40096	19.589	19.238	19.639	0					6	3	2	0	0	0	0.0002709	1	13270	13270		166.68	144.72	1	37562000			1632	325	945	986	2212	2212		9606
LPELLLK	7	Unmodified	_LPELLLK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	413.2758483886719	2	413.275847	824.537141	0.31665	0.00013087	-0.097823	-4.0428E-05	0.21883	9.0437E-05	413.2760105914049	19.556	1.0853	19.556	19.205	20.291	0					21	10	3	0	0	0	1.0115E-10	2	12680	12680;12748		153.88	34.664	1	1032899999.9999999			1633	367	946	987	2213;2214	2213		9606
LPGGNEIGMVAWK	13	Oxidation (M)	_LPGGNEIGM(Oxidation (M))VAWK_	LPGGNEIGM(1)VAWK	LPGGNEIGM(100)VAWK	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	695.3465576171875	2	694.355562	1386.69657	1.106	0.00076799	-1.2157	-0.0008441	-0.10961	-7.6109E-05	694.3550280888256	19.148	1.2012	19.148	18.604	19.806	0					26	11	5	0	0	0	0.028115	1	12201	12201		103.43	70.055	1	491350000			1634	367	947	988	2215	2215	274	9606
LPGGNEIGMVAWK	13	Unmodified	_LPGGNEIGMVAWK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	687.8543701171875	2	686.358105	1370.70166	1.2311	0.00084496	-0.8504	-0.00058368	0.38068	0.00026128	686.3576505359428	20.14	0.39145	20.14	19.998	20.39	0					9	3	4	0	0	0	0.011789	1	13614	13614		85.807	28.997	1	256860000			1635	367	947	989	2216	2216		9606
LPIVDKYK	8	Unmodified	_LPIVDKYK_			0	0	1	P15170;Q8IYD1	P15170	P15170	GSPT1;GSPT2	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A;Eukaryotic peptide chain release factor GTP-binding subunit ERF3B	MSMS	DP1141_9	4	488.27978515625	2	488.29731	974.580068	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.925	1	17.925	17.425	18.425	0								0	0	0	0.017028	1	10617	10617		116.9	50.831	1				1636	153	948	990	2217	2217		9606
LPPNTNDEVDEDPTGNK	17	Unmodified	_LPPNTNDEVDEDPTGNK_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_10	5	927.9219970703125	2	927.921234	1853.82792	0.21518	0.00019967	-0.86768	-0.00080514	-0.6525	-0.00060547	928.4230985493193	15.741	0.5331	15.741	15.533	16.066	0					8	5	2	0	0	0	0.00024853	1	7800	7800		116.63	101.95	1	3427200			1637	402	949	991	2218	2218		9606
LPPNTNDEVDEDPTGNK	17	Unmodified	_LPPNTNDEVDEDPTGNK_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	928.4230346679688	2	927.921234	1853.82792	-0.18933	-0.00017569	0.3197	0.00029665	0.13036	0.00012097	927.9216615769907	15.749	1.5208	15.749	15.209	16.729	0					50	15	5	0	0	0	5.1957E-58	2	6375	6375;6441		194.86	169.63	1	39402000			1638	402	949	991	2219;2220	2219		9606
LPPNTNDEVDEDPTGNK	17	Unmodified	_LPPNTNDEVDEDPTGNK_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_7	2	928.4226684570312	2	927.921234	1853.82792	0.41266	0.00038292	-0.28677	-0.0002661	0.12589	0.00011682	927.9211433487795	15.728	1.3349	15.728	15.309	16.644	0					37	13	5	0	0	0	1.6278E-23	4	7099	7099;7186;7512;7889		172.58	148.06	1	49168000			1639	402	949	991	2221;2222;2223;2224	2221		9606
LPPNTNDEVDEDPTGNK	17	Unmodified	_LPPNTNDEVDEDPTGNK_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_8	3	927.921630859375	2	927.921234	1853.82792	0.14381	0.00013344	0.35547	0.00032985	0.49928	0.00046329	927.921620791148	15.726	0.80407	15.726	15.472	16.276	0					14	7	2	0	0	0	2.4319E-23	1	7139	7139		170.95	146.1	1	11906000			1640	402	949	991	2225	2225		9606
LPPNTNDEVDEDPTGNK	17	Unmodified	_LPPNTNDEVDEDPTGNK_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MSMS	DP1141_9	4	927.9215087890625	2	927.921234	1853.82792	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.884	1	15.884	15.384	16.384	0								0	0	0	0.0058708	1	7248	7248		109.6	94.262	1				1641	402	949	991	2226	2226		9606
LPPPMPPSER	10	Unmodified	_LPPPMPPSER_			0	0	0	Q8IWX8	Q8IWX8	Q8IWX8	CHERP	Calcium homeostasis endoplasmic reticulum protein	MULTI-MSMS	DP1141_7	2	560.794677734375	2	560.794609	1119.57467	0.39616	0.00022217	-0.11549	-6.4765E-05	0.28067	0.0001574	560.7946401839165	16.135	1.0235	16.135	15.714	16.738	0					17	10	2	0	0	0	0.023637	1	7962	7962		80.455	11.54	1	8113300			1642	463	950	992	2227	2227		9606
LPPQDFLDR	9	Unmodified	_LPPQDFLDR_			0	0	0	Q07065	Q07065	Q07065	CKAP4	Cytoskeleton-associated protein 4	MULTI-MSMS	DP1141_8	3	550.7904663085938	2	550.790381	1099.56621	0.74596	0.00041087	0.19862	0.0001094	0.94458	0.00052027	550.7903344573414	18.638	1.2011	18.638	18.475	19.676	0					20	11	3	0	0	0	0.010619	2	11956	11956;12119		98.033	54.787	1	15290000			1643	351	951	993	2228;2229	2228		9606
LPPVLANLMGSMGAGK	16	2 Oxidation (M)	_LPPVLANLM(Oxidation (M))GSM(Oxidation (M))GAGK_	LPPVLANLM(1)GSM(1)GAGK	LPPVLANLM(96)GSM(96)GAGK	0	2	0	Q96QC0	Q96QC0	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	MULTI-MSMS	DP1141_7	2	794.41552734375	2	794.415294	1586.81603	0.49969	0.00039696	-0.26862	-0.0002134	0.23106	0.00018356	794.4152787039399	19.501	0.7005	19.501	18.95	19.65	0					8	6	2	0	0	0	0.003397	1	13357	13357		96.334	78.525	1	36516000			1644	520	952	994	2230	2230	367;368	9606
LPQTPLDTGIPFPPVFSTSSAGVK	24	Unmodified	_LPQTPLDTGIPFPPVFSTSSAGVK_			0	0	0	Q7LBC6	Q7LBC6	Q7LBC6	KDM3B	Lysine-specific demethylase 3B	MULTI-MSMS	DP1141_7	2	1229.1591796875	2	1228.65721	2455.29988	0.39895	0.00049018	-0.32534	-0.00039974	0.07361	9.0441E-05	1229.6597665338866	22.993	0.40356	22.993	22.728	23.132	0					11	5	4	0	0	0	2.3251E-09	2	18541	18541;18571		179.09	166.89	1	7137200			1645	447	953	995	2231;2232	2231		9606
LPQTPLDTGIPFPPVFSTSSAGVK	24	Unmodified	_LPQTPLDTGIPFPPVFSTSSAGVK_			0	0	0	Q7LBC6	Q7LBC6	Q7LBC6	KDM3B	Lysine-specific demethylase 3B	MULTI-MSMS	DP1141_7	2	819.7750854492188	3	819.440569	2455.29988	0.54906	0.00044993	0.23735	0.0001945	0.78642	0.00064442	819.7750291293112	23.004	0.27832	23.004	22.853	23.132	0					7	3	3	0	0	0	0.00015548	1	18550	18550		87.319	47.66	1	4476700			1646	447	953	995	2233	2233		9606
LPSYLDK	7	Unmodified	_LPSYLDK_			0	0	0	Q86TJ2	Q86TJ2	Q86TJ2	TADA2B	Transcriptional adapter 2-beta	MSMS	DP1141_6	1	418.21441650390625	2	418.231636	834.448719	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.811	1	17.811	17.311	18.311	0								0	0	0	0.014425	1	9958	9958		124.59	61.616	1				1647	455	954	996	2234	2234		9606
LPSYLDK	7	Unmodified	_LPSYLDK_			0	0	0	Q86TJ2	Q86TJ2	Q86TJ2	TADA2B	Transcriptional adapter 2-beta	MULTI-MSMS	DP1141_9	4	418.2146301269531	2	418.231636	834.448719	0.15398	6.4401E-05	-0.69414	-0.00029031	-0.54016	-0.00022591	418.2312141912091	17.787	0.39981	17.787	17.537	17.937	0					6	3	2	0	0	0	0.0003705	1	10373	10373		120.65	57.667	1	62405000			1648	455	954	996	2235	2235		9606
LPVCSQQQGEPDLTEHEK	18	Unmodified	_LPVCSQQQGEPDLTEHEK_			0	0	0	Q96F63	Q96F63	Q96F63	CCDC97	Coiled-coil domain-containing protein 97	MULTI-MSMS	DP1141_9	4	699.33154296875	3	698.996871	2093.96878	0.46507	0.00032509	-0.050468	-3.5277E-05	0.41461	0.00028981	699.3311665253879	16.008	0.38557	16.008	15.872	16.258	0					12	3	4	0	0	0	0.00064077	1	7626	7626		123.58	103.49	1	90754000			1649	510	955	997	2236	2236		9606
LQAMMTHLHMR	11	3 Oxidation (M)	_LQAM(Oxidation (M))M(Oxidation (M))THLHM(Oxidation (M))R_	LQAM(1)M(1)THLHM(1)R	LQAM(43)M(43)THLHM(43)R	0	3	0	O15409	O15409	O15409	FOXP2	Forkhead box protein P2	MSMS	DP1141_6	1	708.8287963867188	2	708.830874	1415.64719	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.469	1	19.469	18.969	19.969	0								0	0	0	0.035364	1	12607	12607		42.864	21.119	1				1650	53	956	998	2237	2237	46;47;48	9606
LQDEIQNMKEEMAR	14	2 Oxidation (M)	_LQDEIQNM(Oxidation (M))KEEM(Oxidation (M))AR_	LQDEIQNM(1)KEEM(1)AR	LQDEIQNM(64)KEEM(64)AR	0	2	1	P08670	P08670	P08670	VIM	Vimentin	MULTI-MSMS	DP1141_9	4	589.9693603515625	3	589.606438	1765.79748	0.53237	0.00031389	-0.22476	-0.00013252	0.30761	0.00018137	589.6064124735248	14.344	0.27421	14.344	14.114	14.388	0					7	3	3	0	0	0	0.015384	1	4788	4788		63.727	42.269	1	9559300			1651	127	957	999	2238	2238	119;120	9606
LQIEESSKPVR	11	Unmodified	_LQIEESSKPVR_			0	0	1	P13984	P13984	P13984	GTF2F2	General transcription factor IIF subunit 2	MULTI-MSMS	DP1141_10	5	429.241943359375	3	429.241865	1284.70376	0.012905	5.5394E-06	0.10827	4.6475E-05	0.12118	5.2014E-05	429.24195280980547	14.77	0.41146	14.77	14.472	14.884	0					12	5	4	0	0	0	0.025464	2	6097	5973;6097		106.4	41.67	1	43753000			1652	150	958	1000	2239;2240	2240		9606
LQLAMEMVGFLPK	13	2 Oxidation (M)	_LQLAM(Oxidation (M))EM(Oxidation (M))VGFLPK_	LQLAM(1)EM(1)VGFLPK	LQLAM(54)EM(54)VGFLPK	0	2	0	B2RTY4	B2RTY4	B2RTY4	MYO9A	Unconventional myosin-IXa	MULTI-SECPEP	DP1141_7	2	504.2610168457031	3	503.599896	1507.77786	-0.34174	-0.0001721	2.7203	0.0013699	2.3785	0.0011978	503.60125531652744	15.117	0.50106	15.117	14.708	15.21	0					6	4	2	0	0	0	0.022017	1	6180	6180		53.6	21.17	1	2509000			1653	6	959	1001	2241	2241	6;7	9606
LQMEQQQQLQQR	12	Oxidation (M)	_LQM(Oxidation (M))EQQQQLQQR_	LQM(1)EQQQQLQQR	LQM(180)EQQQQLQQR	0	1	0	Q9NS69	Q9NS69	Q9NS69	TOMM22	Mitochondrial import receptor subunit TOM22 homolog	MULTI-MSMS	DP1141_10	5	787.8928833007812	2	787.391196	1572.76784	0.36473	0.00028719	-0.66671	-0.00052496	-0.30197	-0.00023777	787.3906801793906	14.372	0.25737	14.372	14.215	14.472	0					7	3	3	0	0	0	5.0837E-29	1	5369	5369		177.36	138.58	1	13741000			1654	575	960	1002	2242	2242	410	9606
LQQQQRPEDAEDGAEGGGK	19	Unmodified	_LQQQQRPEDAEDGAEGGGK_			0	0	1	Q08J23	Q08J23	Q08J23	NSUN2	tRNA (cytosine(34)-C(5))-methyltransferase	MULTI-MSMS	DP1141_7	2	671.6475830078125	3	671.647118	2011.91952	0.20768	0.00013948	0.57945	0.00038919	0.78713	0.00052867	671.6473421290929	12.873	0.4011	12.873	12.724	13.125	0					9	3	3	0	0	0	0.019334	1	3205	3205		82.709	59.742	1	2830700			1655	359	961	1003	2243	2243		9606
LQSIGTENTEENRR	14	Unmodified	_LQSIGTENTEENRR_			0	0	1	P04075	P04075	P04075	ALDOA	Fructose-bisphosphate aldolase A	MULTI-MSMS	DP1141_7	2	549.9478759765625	3	549.607935	1645.80198	0.29785	0.0001637	1.4826	0.00081483	1.7804	0.00097853	549.6081167518495	14.358	0.56132	14.358	13.947	14.508	0					7	5	2	0	0	0	0.0028766	1	5034	5034		101.32	60.078	1	12323000			1656	100	962	1004	2244	2244		9606
LQSQLLSLEK	10	Unmodified	_LQSQLLSLEK_			0	0	0	P50570	P50570	P50570	DNM2	Dynamin-2	MULTI-MSMS	DP1141_9	4	579.8115844726562	2	579.840071	1157.66559	0.28916	0.00016767	0.75327	0.00043678	1.0424	0.00060444	579.8405636269231	18.387	0.50029	18.387	18.137	18.637	0					8	4	3	0	0	0	0.010102	1	11176	11176		97.965	0	1	14563000			1657	255	963	1005	2245	2245		9606
LQSSQEPEAPPPR	13	Unmodified	_LQSSQEPEAPPPR_			0	0	0	Q9UNF1	Q9UNF1	Q9UNF1	MAGED2	Melanoma-associated antigen D2	MULTI-MSMS	DP1141_8	3	718.36279296875	2	718.36243	1434.71031	0.057066	4.0994E-05	0.25904	0.00018608	0.3161	0.00022708	718.362591186218	14.498	0.4064	14.498	14.268	14.674	0					9	4	3	0	0	0	0.006165	1	5263	5263		114.89	74.836	1	6263100			1658	605	964	1006	2246	2246		9606
LQVEHPVTECITGLDLVQEMIR	22	Oxidation (M)	_LQVEHPVTECITGLDLVQEM(Oxidation (M))IR_	LQVEHPVTECITGLDLVQEM(1)IR	LQVEHPVTECITGLDLVQEM(100)IR	0	1	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_8	3	866.4429931640625	3	866.108496	2595.30366	0.56466	0.00048906	0.083099	7.1973E-05	0.64776	0.00056103	866.443078062331	20.628	0.60064	20.628	20.377	20.978	0					15	5	5	0	0	0	2.5155E-06	2	14797	14636;14797		101.92	88.284	1	65478000			1659	110	965	1007	2247;2248	2248	94	9606
LQVEHPVTEMITGTDLVEWQLR	22	Oxidation (M)	_LQVEHPVTEM(Oxidation (M))ITGTDLVEWQLR_	LQVEHPVTEM(1)ITGTDLVEWQLR	LQVEHPVTEM(90)ITGTDLVEWQLR	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	871.9642333984375	3	870.779256	2609.31594	0.56086	0.00048838	-1.0458	-0.00091068	-0.48496	-0.00042229	871.1128282854427	20.928	0.40011	20.928	20.778	21.178	0					7	3	3	0	0	0	0.0003075	2	15152	15127;15152		90.06	49.438	1	24643000			1660	521	966	1008	2249;2250	2250	373	9606
LRVDYSGGFEPFSVLR	16	Unmodified	_LRVDYSGGFEPFSVLR_			0	0	1	P49959	P49959	P49959	MRE11A	Double-strand break repair protein MRE11A	MSMS	DP1141_8	3	921.4503784179688	2	921.480868	1840.94718	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.382	1	21.382	20.882	21.882	0								0	0	0	0.0046222	1	15874	15874		110.51	42.154	1				1661	254	967	1009	2251	2251		9606
LSEVLQAVTDHDIPQQLVER	20	Unmodified	_LSEVLQAVTDHDIPQQLVER_			0	0	0	Q93009	Q93009	Q93009	USP7	Ubiquitin carboxyl-terminal hydrolase 7	MULTI-MSMS	DP1141_7	2	763.9727172851562	3	764.072768	2289.19647	1.0462	0.00079935	-0.43219	-0.00033023	0.61398	0.00046912	764.7408521417574	20.459	0.30022	20.459	20.251	20.551	0					8	2	4	0	0	0	3.3039E-08	2	14737	14654;14737		151.31	123.47	1	12306000			1662	501	968	1010	2252;2253	2253		9606
LSILYPATTGR	11	Unmodified	_LSILYPATTGR_			0	0	0	P30041	P30041	P30041	PRDX6	Peroxiredoxin-6	MULTI-MSMS	DP1141_10	5	596.2980346679688	2	596.340238	1190.66592	1.1205	0.00066818	-0.25836	-0.00015407	0.86211	0.00051411	596.3399561258888	18.999	0.30038	18.999	18.777	19.077	0					6	2	3	0	0	0	0.0035691	1	12838	12838		128.6	36.749	1	11274000			1663	196	969	1011	2254	2254		9606
LSINTQNKR	9	Unmodified	_LSINTQNKR_			0	0	1	CON__Q2UVX4	CON__Q2UVX4	CON__Q2UVX4			MULTI-SECPEP	DP1141_6	1	536.8658447265625	2	537.306729	1072.59891	1.1558	0.00062102	-0.71805	-0.00038581	0.43776	0.00023521	537.3067052468447	21.51	0.58511	21.51	21.126	21.711	0					8	6	2	0	0	0	0.0027892	1	15716	15716		107.9	34.279	1	1765800		+	1664	24	970	1012	2255	2255		
LSPPYSSPQEFAQDVGR	17	Unmodified	_LSPPYSSPQEFAQDVGR_			0	0	0	Q13263	Q13263	Q13263	TRIM28	Transcription intermediary factor 1-beta	MULTI-MSMS	DP1141_7	2	939.4546508789062	2	939.455047	1876.89554	0.39084	0.00036718	0.14345	0.00013476	0.53429	0.00050194	939.4552389000878	19.7	0.49965	19.7	19.35	19.85	0					13	4	4	0	0	0	1.8814999999999999E-44	2	13487	13487;13564		186.16	157.45	1	127120000			1665	372	971	1013	2256;2257	2256		9606
LSPPYSSPQEFAQDVGR	17	Unmodified	_LSPPYSSPQEFAQDVGR_			0	0	0	Q13263	Q13263	Q13263	TRIM28	Transcription intermediary factor 1-beta	MULTI-MSMS	DP1141_9	4	939.4581298828125	2	939.455047	1876.89554	0.74421	0.00069915	1.1636	0.0010931	1.9078	0.0017923	939.4569432675546	19.689	0.39992	19.689	19.438	19.838	0					8	3	3	0	0	0	0.010965	1	13516	13516		86.498	33.418	1	6547800			1666	372	971	1013	2258	2258		9606
LSQTLSLVPR	10	Unmodified	_LSQTLSLVPR_			0	0	0	O94766	O94766	O94766	B3GAT3	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3	MULTI-MSMS	DP1141_10	5	558.293701171875	2	557.334956	1112.65536	0.39693	0.00022122	-0.29369	-0.00016368	0.10324	5.7539E-05	557.334934170602	17.737	0.40013	17.737	17.387	17.788	0					9	3	4	0	0	0	0.022308	1	10880	10880		82.241	4.958	1	63781000			1667	84	972	1014	2259	2259		9606
LSQTLSLVPR	10	Unmodified	_LSQTLSLVPR_			0	0	0	O94766	O94766	O94766	B3GAT3	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3	MULTI-MSMS	DP1141_6	1	557.3350830078125	2	557.334956	1112.65536	0.69775	0.00038888	-0.54992	-0.00030649	0.14783	8.2391E-05	557.3347092949043	17.755	0.3004	17.755	17.505	17.805	0					6	2	3	0	0	0	0.012379	1	9940	9940		93.143	16.369	1	20463000			1668	84	972	1014	2260	2260		9606
LSQTLSLVPR	10	Unmodified	_LSQTLSLVPR_			0	0	0	O94766	O94766	O94766	B3GAT3	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3	MULTI-MSMS	DP1141_7	2	557.3349609375	2	557.334956	1112.65536	0.23685	0.000132	-0.26473	-0.00014754	-0.027882	-1.5539E-05	557.3348623269851	17.699	0.39927	17.699	17.45	17.849	0					8	3	3	0	0	0	0.020209	1	10505	10505		84.568	7.2853	1	21005000			1669	84	972	1014	2261	2261		9606
LSQYQEPLHLPGVR	14	Unmodified	_LSQYQEPLHLPGVR_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_6	1	546.633056640625	3	546.298373	1635.87329	0.40183	0.00021952	-0.19068	-0.00010417	0.21115	0.00011535	546.2981715854171	18.654	0.79999	18.654	18.005	18.805	0					11	7	2	0	0	0	0.001845	2	11350	11231;11350		136.27	113.18	1	89969000			1670	110	973	1015	2262;2263	2263		9606
LSQYQEPLHLPGVR	14	Unmodified	_LSQYQEPLHLPGVR_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_8	3	546.2987060546875	3	546.298373	1635.87329	0.97332	0.00053172	-0.49426	-0.00027001	0.47906	0.00026171	546.2981062491285	18.625	0.80086	18.625	18.075	18.876	0					18	7	4	0	0	0	0.00019141	2	11784	11686;11784		160.56	138.65	1	352700000			1671	110	973	1015	2264;2265	2265		9606
LSQYQEPLHLPGVR	14	Unmodified	_LSQYQEPLHLPGVR_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-SECPEP	DP1141_9	4	545.6089477539062	3	546.298373	1635.87329	0.66182	0.00036155	-0.2863	-0.0001564	0.37553	0.00020515	546.2980149063559	18.687	0.49997	18.687	18.237	18.737	0					11	4	4	0	0	0	0.010103	1	11829	11829		89.43	51.477	1	26695000			1672	110	973	1015	2266	2266		9606
LSRLMSGSSR	10	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))LSRLM(Oxidation (M))SGSSR_	LSRLM(1)SGSSR	LSRLM(68)SGSSR	1	1	1	Q7Z6J6	Q7Z6J6	Q7Z6J6	FRMD5	FERM domain-containing protein 5	MULTI-MSMS	DP1141_8	3	576.296142578125	2	576.295504	1150.57646	0.1252	7.2152E-05	0.83977	0.00048396	0.96497	0.00055611	576.2959999136498	22.738	0.53832	22.738	22.565	23.103	0					12	6	3	0	0	0	0.0094675	1	17941	17941		68.383	17.751	1	60472000			1673	453	974	1016	2267	2267	336	9606
LSRLMSGSSR	10	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))LSRLM(Oxidation (M))SGSSR_	LSRLM(1)SGSSR	LSRLM(46)SGSSR	1	1	1	Q7Z6J6	Q7Z6J6	Q7Z6J6	FRMD5	FERM domain-containing protein 5	MULTI-MSMS	DP1141_9	4	576.2971801757812	2	576.295504	1150.57646	0.29263	0.00016864	0.98269	0.00056632	1.2753	0.00073496	576.2961528723858	22.729	0.27792	22.729	22.582	22.86	0					5	3	2	0	0	0	0.024547	1	18061	18061		46.129	16.053	1	4911000			1674	453	974	1016	2268	2268	336	9606
LSSLNLTPDPEMEPPPK	17	Oxidation (M)	_LSSLNLTPDPEM(Oxidation (M))EPPPK_	LSSLNLTPDPEM(1)EPPPK	LSSLNLTPDPEM(68)EPPPK	0	1	0	Q8TDZ2	Q8TDZ2	Q8TDZ2	MICAL1	Protein-methionine sulfoxide oxidase MICAL1	MSMS	DP1141_7	2	940.9666748046875	2	940.969142	1879.92373	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.011	1	22.011	21.511	22.511	0								0	0	0	0.035679	1	16992	16992		67.749	39.78	1				1675	482	975	1017	2269	2269	356	9606
LSSPATLNSR	10	Unmodified	_LSSPATLNSR_			0	0	0	CON__P00761	CON__P00761	CON__P00761			MULTI-MSMS	DP1141_10	5	523.2857055664062	2	523.285463	1044.55637	0.28978	0.00015164	-0.18904	-9.8924E-05	0.10074	5.2715E-05	523.2853695946342	15.32	0.57321	15.32	14.96	15.533	0					17	6	4	0	0	0	5.1365E-05	1	6658	6658		150.36	87.897	1	425030000		+	1676	8	976	1018	2270	2270		
LSSPATLNSR	10	Unmodified	_LSSPATLNSR_			0	0	0	CON__P00761	CON__P00761	CON__P00761			MULTI-MSMS	DP1141_6	1	523.285888671875	2	523.285463	1044.55637	-0.0062707	-3.2813E-06	0.34685	0.0001815	0.34058	0.00017822	523.2856138033292	15.358	0.8021	15.358	14.708	15.51	0					16	7	3	0	0	0	9.0188E-53	3	5851	5757;5851;5960		190.73	126.52	1	137880000		+	1677	8	976	1018	2271;2272;2273	2272		
LSSPATLNSR	10	Unmodified	_LSSPATLNSR_			0	0	0	CON__P00761	CON__P00761	CON__P00761			MSMS	DP1141_7	2	523.2539672851562	2	523.285463	1044.55637	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.233	1	15.233	14.733	15.733	0								0	0	0	3.6527E-43	1	6394	6394		176.44	119.72	1			+	1678	8	976	1018	2274	2274		
LSSPATLNSR	10	Unmodified	_LSSPATLNSR_			0	0	0	CON__P00761	CON__P00761	CON__P00761			MSMS	DP1141_7	2	523.2855224609375	2	523.285463	1044.55637	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.276	1	15.276	14.776	15.776	0								0	0	0	1.3034E-69	1	6457	6457		190.26	126.05	1			+	1679	8	976	1018	2275	2275		
LSSPATLNSR	10	Unmodified	_LSSPATLNSR_			0	0	0	CON__P00761	CON__P00761	CON__P00761			MSMS	DP1141_7	2	523.2857666015625	2	523.285463	1044.55637	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.363	1	15.363	14.863	15.863	0								0	0	0	1.3034E-69	1	6599	6599		190.26	120.63	1			+	1680	8	976	1018	2276	2276		
LSSPATLNSR	10	Unmodified	_LSSPATLNSR_			0	0	0	CON__P00761	CON__P00761	CON__P00761			MULTI-MSMS	DP1141_8	3	523.2859497070312	2	523.285463	1044.55637	0.45108	0.00023605	-0.12535	-6.5596E-05	0.32573	0.00017045	523.2853039343793	15.318	0.79783	15.318	14.674	15.472	0					15	7	3	0	0	0	9.673299999999999E-53	4	6438	6185;6363;6438;6445		190.26	126.05	1	184220000		+	1681	8	976	1018	2277;2278;2279;2280	2279		
LSSPATLNSR	10	Unmodified	_LSSPATLNSR_			0	0	0	CON__P00761	CON__P00761	CON__P00761			MULTI-MSMS	DP1141_9	4	523.2857055664062	2	523.285463	1044.55637	0.46777	0.00024477	-0.13833	-7.2388E-05	0.32943	0.00017239	523.2853980273104	15.324	0.58409	15.324	14.887	15.471	0					17	5	5	0	0	0	1.0815E-29	3	6221	6221;6271;6349		176.44	121.67	1	243220000		+	1682	8	976	1018	2281;2282;2283	2281		
LSSQEAASSFGDDR	14	Unmodified	_LSSQEAASSFGDDR_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_8	3	735.329345703125	2	735.328784	1468.64302	0.20214	0.00014864	-0.13992	-0.00010289	0.062216	4.5749E-05	735.3287809489002	16.513	0.38631	16.513	16.176	16.562	0					9	3	4	0	0	0	0.0048249	1	8411	8411		101.71	86.14	1	81626000			1683	110	977	1019	2284	2284		9606
LSSWDQAETPGHTPSLR	17	Unmodified	_LSSWDQAETPGHTPSLR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MSMS	DP1141_10	5	627.7678833007812	3	627.974506	1880.90169	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.487	1	17.487	16.987	17.987	0								0	0	0	0.034068	1	10470	10470		64.565	39.443	1				1684	78	978	1020	2285	2285		9606
LSSWDQAETPGHTPSLR	17	Unmodified	_LSSWDQAETPGHTPSLR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-SECPEP	DP1141_7	2	628.30908203125	3	627.974506	1880.90169	0.4011	0.00025188	0.40661	0.00025534	0.80771	0.00050722	627.974781141852	17.499	0.39996	17.499	17.249	17.649	0					7	3	3	0	0	0	1.1444E-12	1	10191	10191		140.77	109.81	1	264630000			1685	78	978	1020	2286	2286		9606
LSSWDQAETPGHTPSLR	17	Unmodified	_LSSWDQAETPGHTPSLR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	627.787841796875	3	627.974506	1880.90169	0.47591	0.00029886	-0.31431	-0.00019738	0.1616	0.00010148	628.3084883189275	17.524	0.50121	17.524	17.073	17.574	0					5	4	2	0	0	0	0.0056497	1	9969	9969		118.52	88.89	1	40295000			1686	78	978	1020	2287	2287		9606
LSTHSPFR	8	Unmodified	_LSTHSPFR_			0	0	0	P11171	P11171	P11171	EPB41	Protein 4.1	MULTI-SECPEP	DP1141_6	1	943.90869140625	1	944.494841	943.487565	0.14147	0.00013362	-0.3507	-0.00033123	-0.20923	-0.00019762	944.493902722845	19.734	0.50046	19.734	19.406	19.906	0					7	4	2	0	0	0	0.016016	1	12951	12951		70.912	19.125	1	4041500			1687	141	979	1021	2288	2288		9606
LSVDANLQIPK	11	Unmodified	_LSVDANLQIPK_			0	0	0	O94913	O94913	O94913	PCF11	Pre-mRNA cleavage complex 2 protein Pcf11	MSMS	DP1141_8	3	599.346923828125	2	599.34552	1196.67649	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.388	1	17.388	16.888	17.888	0								0	0	0	0.02855	1	9815	9815		96.034	15.815	1				1688	87	980	1022	2289	2289		9606
LSVVEYDPGTHDLK	14	Unmodified	_LSVVEYDPGTHDLK_			0	0	0	Q10570	Q10570	Q10570	CPSF1	Cleavage and polyadenylation specificity factor subunit 1	MULTI-SECPEP	DP1141_6	1	525.635498046875	3	524.934989	1571.78314	0.91268	0.0004791	0.94532	0.00049623	1.858	0.00097533	525.2701592550758	17.692	0.3004	17.692	17.505	17.805	0					4	2	2	0	0	0	0.013148	1	9804	9804		79.744	65.113	1	1905600			1689	360	981	1023	2290	2290		9606
LTDCVVMRDPASK	13	Oxidation (M)	_LTDCVVM(Oxidation (M))RDPASK_	LTDCVVM(1)RDPASK	LTDCVVM(110)RDPASK	0	1	1	P22626	P22626	P22626	HNRNPA2B1	Heterogeneous nuclear ribonucleoproteins A2/B1	MULTI-SECPEP	DP1141_9	4	502.58990478515625	3	503.246293	1506.71705	-0.034112	-1.7167E-05	-0.41789	-0.0002103	-0.45201	-0.00022747	503.24642780306453	14.75	0.5748	14.75	14.312	14.887	0					18	6	5	0	0	0	0.0046108	1	5407	5407		110.8	88.02	1	37209000			1690	179	982	1024	2291	2291	156	9606
LTFDSSFSPNTGKK	14	Unmodified	_LTFDSSFSPNTGKK_			0	0	1	P21796	P21796	P21796	VDAC1	Voltage-dependent anion-selective channel protein 1	MSMS	DP1141_9	4	510.2377624511719	3	510.259584	1527.75692	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.455	1	17.455	16.955	17.955	0								0	0	0	0.015531	1	9853	9853		90.759	62.134	1				1691	174	983	1025	2292	2292		9606
LTGVFAPR	8	Unmodified	_LTGVFAPR_			0	0	0	P22090;P62701;Q8TD47	P22090	P22090	RPS4Y1;RPS4X;RPS4Y2	40S ribosomal protein S4, Y isoform 1;40S ribosomal protein S4, X isoform;40S ribosomal protein S4, Y isoform 2	MSMS	DP1141_10	5	430.89697265625	2	430.75307	859.491587	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.432	1	17.432	16.932	17.932	0								0	0	0	0.024675	1	10385	10385		116.54	53.828	1				1692	177	984	1026	2293	2293		9606
LTGVFAPR	8	Unmodified	_LTGVFAPR_			0	0	0	P22090;P62701;Q8TD47	P22090	P22090	RPS4Y1;RPS4X;RPS4Y2	40S ribosomal protein S4, Y isoform 1;40S ribosomal protein S4, X isoform;40S ribosomal protein S4, Y isoform 2	MSMS	DP1141_10	5	430.7294006347656	2	430.75307	859.491587	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.453	1	17.453	16.953	17.953	0								0	0	0	0.019821	1	10414	10414		107.32	37.934	1				1693	177	984	1026	2294	2294		9606
LTIIVSDPSHCNVLR	15	Unmodified	_LTIIVSDPSHCNVLR_			0	0	0	P78346	P78346	P78346	RPP30	Ribonuclease P protein subunit p30	MULTI-SECPEP	DP1141_10	5	575.3292846679688	3	575.310173	1722.90869	0.5493	0.00031602	0.011339	6.5234E-06	0.56064	0.00032254	575.3100427385576	18.637	0.3946	18.637	18.287	18.682	0					7	3	3	0	0	0	1.6992E-17	1	12235	12235		159	107.87	1	16949000			1694	326	985	1027	2295	2295		9606
LTISSPLEAHK	11	Unmodified	_LTISSPLEAHK_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	598.3380126953125	2	598.337695	1194.66084	0.10588	6.335E-05	0.52892	0.00031647	0.6348	0.00037982	598.3379983355733	17.053	0.27927	17.053	16.824	17.103	0					7	3	3	0	0	0	6.185499999999999E-22	1	8770	8770		174.41	96.484	1	44189000			1695	402	986	1028	2296	2296		9606
LTISSPLEAHK	11	Unmodified	_LTISSPLEAHK_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MSMS	DP1141_7	2	598.3076171875	2	598.337695	1194.66084	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.983	1	16.983	16.483	17.483	0								0	0	0	0.0019434	1	9259	9259		134.25	69.982	1				1696	402	986	1028	2297	2297		9606
LTISSPLEAHK	11	Unmodified	_LTISSPLEAHK_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MSMS	DP1141_7	2	598.3383178710938	2	598.337695	1194.66084	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.055	1	17.055	16.555	17.555	0								0	0	0	5.1456E-10	1	9376	9376		145.72	80.258	1				1697	402	986	1028	2298	2298		9606
LTLIDPETLLPR	12	Unmodified	_LTLIDPETLLPR_			0	0	0	Q86VP6	Q86VP6	Q86VP6	CAND1	Cullin-associated NEDD8-dissociated protein 1	MULTI-MSMS	DP1141_7	2	690.9091186523438	2	690.908485	1379.80242	0.85144	0.00058827	-0.22388	-0.00015468	0.62755	0.00043358	690.9082353275165	22.622	0.34379	22.622	22.319	22.663	0					9	3	3	0	0	0	1.3437999999999998E-52	2	17784	17784;17822		194.94	169.32	1	19350000			1698	458	987	1029	2299;2300	2299		9606
LTLLQVASR	9	Unmodified	_LTLLQVASR_			0	0	0	O95239	O95239	O95239	KIF4A	Chromosome-associated kinesin KIF4A	MULTI-MSMS	DP1141_7	2	501.3032531738281	2	500.811116	999.60768	-0.13876	-6.9493E-05	0.77259	0.00038692	0.63383	0.00031743	500.8111434219153	19.2	0.30039	19.2	19.05	19.35	0					4	2	2	0	0	0	0.022878	1	12946	12946		82.279	29.493	1	3935800			1699	89	988	1030	2301	2301		9606
LTPEELER	8	Unmodified	_LTPEELER_			0	0	0	O95399	O95399	O95399	UTS2	Urotensin-2	MULTI-MSMS	DP1141_8	3	493.7605285644531	2	493.761289	985.508025	0.23912	0.00011807	0.082919	4.0942E-05	0.32204	0.00015901	493.7613122155361	16.126	0.60068	16.126	15.776	16.376	0					8	5	2	0	0	0	6.2326E-05	1	7797	7797		132.08	0	1	113740000			1700	91	989	1031	2302	2302		9606
LTQILSYLR	9	Unmodified	_LTQILSYLR_			0	0	0	Q13123	Q13123	Q13123	IK	Protein Red	MSMS	DP1141_8	3	554.3049926757812	2	553.832049	1105.64954	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.488	1	20.488	19.988	20.988	0								0	0	0	1.5502E-100	1	14568	14568		205.36	142.89	1				1701	368	990	1032	2303	2303		9606
LTQIQESQVTSHNK	14	Unmodified	_LTQIQESQVTSHNK_			0	0	0	Q92541	Q92541	Q92541	RTF1	RNA polymerase-associated protein RTF1 homolog	MULTI-SECPEP	DP1141_8	3	538.96142578125	3	538.281159	1611.82165	0.40943	0.00022039	-0.11511	-6.1961E-05	0.29432	0.00015843	538.2811310137462	14.575	0.22975	14.575	14.445	14.674	0					4	2	2	0	0	0	2.4534999999999996E-19	1	5293	5293		164.13	135.32	1	1668200			1702	490	991	1033	2304	2304		9606
LTQTSGETTHTDKVPGGEDK	20	Unmodified	_LTQTSGETTHTDKVPGGEDK_			0	0	1	P46013	P46013	P46013	MKI67	Antigen KI-67	MULTI-MSMS	DP1141_7	2	701.0071411132812	3	701.006312	2099.99711	0.71264	0.00049956	-0.38874	-0.00027251	0.3239	0.00022705	701.3401708527123	12.773	0.399	12.773	12.524	12.923	0					9	3	3	0	0	0	6.3108E-12	1	2973	2973		185.2	147.85	1	15193000			1703	232	992	1034	2305	2305		9606
LTQTSGETTHTDKVPGGEDK	20	Unmodified	_LTQTSGETTHTDKVPGGEDK_			0	0	1	P46013	P46013	P46013	MKI67	Antigen KI-67	MULTI-MSMS	DP1141_8	3	701.0072021484375	3	701.006312	2099.99711	0.70272	0.00049261	-0.40574	-0.00028443	0.29698	0.00020818	701.3403271380574	13.132	0.94846	13.132	12.505	13.453	0					25	9	4	0	0	0	0.00092003	1	3208	3208		130.02	111.31	1	1216100			1704	232	992	1034	2306	2306		9606
LTRPAASPAVGEK	13	Unmodified	_LTRPAASPAVGEK_			0	0	1	Q8N2M8	Q8N2M8	Q8N2M8	CLASRP	CLK4-associating serine/arginine rich protein	MULTI-SECPEP	DP1141_8	3	433.2081298828125	3	432.91386	1295.71975	-0.14475	-6.2664E-05	0.69348	0.00030022	0.54874	0.00023756	432.9141088778818	14.013	0.22447	14.013	13.884	14.109	0					4	2	2	0	0	0	0.0018271	1	4499	4499		113.37	87.239	1	3794100			1705	469	993	1035	2307	2307		9606
LTTPTYGDLNHLVSATMSGVTTCLR	25	Oxidation (M)	_LTTPTYGDLNHLVSATM(Oxidation (M))SGVTTCLR_	LTTPTYGDLNHLVSATM(1)SGVTTCLR	LTTPTYGDLNHLVSATM(56)SGVTTCLR	0	1	0	P07437;P68371;P04350;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_9	4	909.4486083984375	3	908.78256	2723.32585	0.91545	0.00083194	-0.3871	-0.00035179	0.52834	0.00048015	909.4508242843982	21.038	0.50114	21.038	20.636	21.138	0					13	4	4	0	0	0	0.00016541	1	15406	15406		55.718	30.114	1	17016000			1706	122;323;381	994	1036	2308	2308	112	9606
LVAGEMGQNEPDQGGQR	17	Oxidation (M)	_LVAGEM(Oxidation (M))GQNEPDQGGQR_	LVAGEM(1)GQNEPDQGGQR	LVAGEM(110)GQNEPDQGGQR	0	1	0	Q99714	Q99714	Q99714	HSD17B10	3-hydroxyacyl-CoA dehydrogenase type-2	MULTI-MSMS	DP1141_10	5	901.409912109375	2	901.410314	1800.80607	0.066901	6.0305E-05	-0.65032	-0.00058621	-0.58342	-0.0005259	901.409550239101	14.305	0.18923	14.305	14.215	14.404	0					4	2	2	0	0	0	0.0020475	1	5367	5367		111.94	85.819	1	5957600			1707	531	995	1037	2309	2309	383	9606
LVAIVDVIDQNR	12	Unmodified	_LVAIVDVIDQNR_			0	0	0	P50914	P50914	P50914	RPL14	60S ribosomal protein L14	MSMS	DP1141_10	5	678.3654174804688	2	677.888084	1353.76161	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.692	1	20.692	20.192	21.192	0								0	0	0	0.023035	1	15486	15486		154.85	92.742	1				1708	256	996	1038	2310	2310		9606
LVDQSGPPHEPK	12	Unmodified	_LVDQSGPPHEPK_			0	0	0	P55265	P55265	P55265	ADAR	Double-stranded RNA-specific adenosine deaminase	MULTI-MSMS	DP1141_7	2	435.2261047363281	3	435.226215	1302.65681	0.69763	0.00030363	-0.4852	-0.00021117	0.21243	9.2455E-05	435.2259311986058	13.688	0.62035	13.688	13.327	13.947	0					17	6	4	0	0	0	0.011279	1	4169	4169		79.23	50.846	1	7472500			1709	271	997	1039	2311	2311		9606
LVEQAFR	7	Unmodified	_LVEQAFR_			0	0	0	P85037	P85037	P85037	FOXK1	Forkhead box protein K1	MULTI-MSMS	DP1141_8	3	431.5857849121094	2	431.742702	861.470852	-0.20758	-8.962E-05	0.64723	0.00027944	0.43965	0.00018982	431.7429859438502	16.226	0.30043	16.226	16.076	16.376	0					4	2	2	0	0	0	0.011562	1	7848	7848		104.11	20.086	1	35228000			1710	333	998	1040	2312	2312		9606
LVLPAPQISDAELQEVVK	18	Unmodified	_LVLPAPQISDAELQEVVK_			0	0	0	Q99459	Q99459	Q99459	CDC5L	Cell division cycle 5-like protein	MULTI-SECPEP	DP1141_7	2	975.5266723632812	2	975.051323	1948.08809	0.60721	0.00059206	0.2669	0.00026024	0.87411	0.0008523	975.0518403410698	21.6	0.29947	21.6	21.35	21.65	0					6	2	3	0	0	0	0.0030152	1	16307	16307		75.589	44.361	1	7920200			1711	526	999	1041	2313	2313		9606
LVLVGDGGTGK	11	Unmodified	_LVLVGDGGTGK_			0	0	0	P62826	P62826	P62826	RAN	GTP-binding nuclear protein Ran	MULTI-SECPEP	DP1141_6	1	508.7322692871094	2	508.292756	1014.57096	-0.29683	-0.00015088	0.028049	1.4257E-05	-0.26878	-0.00013662	508.29254536402277	16.779	0.22905	16.779	16.595	16.824	0					4	2	2	0	0	0	0.0091635	1	8263	8263		81.95	17.11	1	6530800			1712	304	1000	1042	2314	2314		9606
LVMADKELYR	10	Oxidation (M)	_LVM(Oxidation (M))ADKELYR_	LVM(1)ADKELYR	LVM(69)ADKELYR	0	1	1	Q8WX92	Q8WX92	Q8WX92	NELFB	Negative elongation factor B	MULTI-SECPEP	DP1141_8	3	418.8911437988281	3	418.556796	1252.64856	0.38071	0.00015935	-0.10329	-4.3233E-05	0.27742	0.00011612	418.891075210249	15.488	0.70506	15.488	15.271	15.976	0					10	6	3	0	0	0	0.033642	1	6796	6796		68.626	48.595	1	12505000			1713	488	1001	1043	2315	2315	359	9606
LVNHFVEEFKR	11	Unmodified	_LVNHFVEEFKR_			0	0	1	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-SECPEP	DP1141_6	1	472.9937744140625	3	473.257738	1416.75138	0.28994	0.00013721	1.3288	0.00062887	1.6188	0.00076609	473.25865665629374	17.207	0.60062	17.207	17.004	17.605	0					8	5	2	0	0	0	0.00095303	1	8951	8951		110.39	87.295	1	3472500			1714	135	1002	1044	2316	2316		9606
LVNHFVEEFKR	11	Unmodified	_LVNHFVEEFKR_			0	0	1	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-MSMS	DP1141_8	3	473.2578430175781	3	473.257738	1416.75138	0.24825	0.00011749	0.074042	3.5041E-05	0.32229	0.00015253	473.257911306773	17.123	0.67368	17.123	16.9	17.574	0					17	6	4	0	0	0	2.6811E-14	3	9397	9331;9397;9464		178.54	159.09	1	935110000			1715	135	1002	1044	2317;2318;2319	2318		9606
LVNHFVEEFKR	11	Unmodified	_LVNHFVEEFKR_			0	0	1	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MSMS	DP1141_8	3	709.3832397460938	2	709.382968	1416.75138	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.182	1	17.182	16.682	17.682	0								0	0	0	0.0239	1	9480	9480		109.29	77.868	1				1716	135	1002	1044	2320	2320		9606
LVNHFVEEFKR	11	Unmodified	_LVNHFVEEFKR_			0	0	1	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-MSMS	DP1141_9	4	472.8650817871094	3	473.257738	1416.75138	0.30204	0.00014294	0.10862	5.1407E-05	0.41067	0.00019435	473.25784207942394	17.088	0.68105	17.088	16.957	17.638	0					11	6	2	0	0	0	0.0026256	2	9410	9410;9431		150.04	116.17	1	72012000			1717	135	1002	1044	2321;2322	2321		9606
LVPELDTIVPLESTK	15	Unmodified	_LVPELDTIVPLESTK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_6	1	827.4144897460938	2	827.469103	1652.92365	1.1893	0.00098411	-0.42915	-0.00035511	0.76015	0.000629	827.4685567815617	21.335	0.34422	21.335	21.126	21.47	0					6	3	2	0	0	0	1.4819E-118	2	15437	15437;15504		220.29	148.05	1	16569000			1718	111	1003	1045	2323;2324	2323		9606
LVPELDTIVPLESTK	15	Unmodified	_LVPELDTIVPLESTK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	827.4697875976562	2	827.469103	1652.92365	0.83248	0.00068885	0.087671	7.2545E-05	0.92015	0.00076139	827.4692088952179	21.329	0.50131	21.329	21.078	21.579	0					11	4	4	0	0	0	0.01171	1	15945	15945		85.973	54.339	1	298890000			1719	111	1003	1045	2325	2325		9606
LVPELDTIVPLESTK	15	Unmodified	_LVPELDTIVPLESTK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	827.4696655273438	2	827.469103	1652.92365	-0.39392	-0.00032595	1.1783	0.00097502	0.7844	0.00064907	827.4700809652417	21.288	0.40082	21.288	21.138	21.538	0					9	3	4	0	0	0	0.0049438	2	15950	15950;15956		94.191	65.483	1	64655000			1720	111	1003	1045	2326;2327	2326		9606
LVPLDYGEDDKNATK	15	Unmodified	_LVPLDYGEDDKNATK_			0	0	1	P49756	P49756	P49756	RBM25	RNA-binding protein 25	MULTI-MSMS	DP1141_7	2	560.2835083007812	3	559.949187	1676.82573	0.44247	0.00024776	0.13343	7.4714E-05	0.5759	0.00032247	560.2834428882204	16.798	0.40657	16.798	16.644	17.051	0					10	4	3	0	0	0	0.0097717	2	9104	9104;9172		120.53	100.15	1	35680000			1721	251	1004	1046	2328;2329	2328		9606
LVQAFQYTDK	10	Unmodified	_LVQAFQYTDK_			0	0	0	Q13162	Q13162	Q13162	PRDX4	Peroxiredoxin-4	MSMS	DP1141_10	5	606.8380737304688	2	606.816596	1211.61864	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.711	1	17.711	17.211	18.211	0								0	0	0	0.023107	1	10840	10840		104.01	63.027	1				1722	370	1005	1047	2330	2330		9606
LVSIGHTVMTPMLNPMIYTLR	21	3 Oxidation (M)	_LVSIGHTVM(Oxidation (M))TPM(Oxidation (M))LNPM(Oxidation (M))IYTLR_	LVSIGHTVM(1)TPM(1)LNPM(1)IYTLR	LVSIGHTVM(43)TPM(43)LNPM(43)IYTLR	0	3	0	P58180	P58180	P58180	OR4D2	Olfactory receptor 4D2	MULTI-SECPEP	DP1141_8	3	812.90625	3	812.421358	2434.24224	0.91381	0.0007424	-0.62626	-0.00050879	0.28754	0.00023361	812.7549537867064	22.61	0.31274	22.61	22.475	22.788	0					5	3	2	0	0	0	0.034113	1	17626	17626		42.58	19.181	1	3176000			1723	274	1006	1048	2331	2331	225;226;227	9606
LVSLCLANSFAK	12	Unmodified	_LVSLCLANSFAK_			0	0	0		REV__Q9NWS8	REV__Q9NWS8			MULTI-MSMS	DP1141_9	4	661.8651123046875	2	661.86048	1321.70641	1.014	0.00067115	4.4873	0.00297	5.5013	0.0036411	661.8637335451859	20.687	0.60059	20.687	20.337	20.937	0					10	5	3	0	0	0	0.020397	2	14885	14885;15081		80.755	36.406	1	11333000	+		1724	631	1007	1049	2332;2333	2332		9606
LVTANTIDQK	10	Unmodified	_LVTANTIDQK_			0	0	0	Q9NRZ9	Q9NRZ9	Q9NRZ9	HELLS	Lymphoid-specific helicase	MULTI-MSMS	DP1141_7	2	552.2786254882812	2	551.808771	1101.60299	-0.24582	-0.00013565	-0.70509	-0.00038907	-0.95091	-0.00052472	551.8086246856726	15.26	0.40227	15.26	15.109	15.512	0					6	3	2	0	0	0	0.010823	1	6558	6558		96.665	53.419	1	17458000			1725	574	1008	1050	2334	2334		9606
LVTSLPSWALLTNHFK	16	Unmodified	_LVTSLPSWALLTNHFK_			0	0	0	Q9Y467	Q9Y467	Q9Y467	SALL2	Sal-like protein 2	MSMS	DP1141_7	2	609.6786499023438	3	609.676962	1826.00906	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.864	1	21.864	21.364	22.364	0								0	0	0	0.0053058	1	16772	16772		121.95	69.843	1				1726	619	1009	1051	2335	2335		9606
LVVWAADR	8	Unmodified	_LVVWAADR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	464.9115905761719	2	465.263802	928.513051	0.86484	0.00040238	0.023409	1.0892E-05	0.88825	0.00041327	465.26373538442715	18.355	0.39944	18.355	18.205	18.604	0					9	3	3	0	0	0	5.7085E-06	1	10829	10829		133.81	70.665	1	129800000			1727	521	1010	1052	2336	2336		9606
LVVWAADR	8	Unmodified	_LVVWAADR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-SECPEP	DP1141_9	4	464.5833435058594	2	465.263802	928.513051	-0.088816	-4.1323E-05	0.36655	0.00017054	0.27774	0.00012922	465.263946516119	18.387	0.50029	18.387	18.137	18.637	0					7	4	2	0	0	0	0.00014073	1	11318	11318		177.71	108.32	1	215190000			1728	521	1010	1052	2337	2337		9606
LVYVFSQDFTVFGGSLSGAHAQK	23	Unmodified	_LVYVFSQDFTVFGGSLSGAHAQK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	820.89404296875	3	820.084896	2457.23286	0.9215	0.00075571	0.025376	2.081E-05	0.94688	0.00077652	820.418877369041	22.029	0.29959	22.029	21.879	22.179	0					4	2	2	0	0	0	0.0015484	1	16912	16912		52.095	26.171	1	21793000			1729	111	1011	1053	2338	2338		9606
LWGSPDKYPK	10	Unmodified	_LWGSPDKYPK_			0	0	1	O00763	O00763	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	MSMS	DP1141_6	1	595.9615478515625	2	595.813856	1189.61316	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.593	1	16.593	16.093	17.093	0								0	0	0	0.026827	1	7967	7967		98.582	40.336	1				1730	40	1012	1054	2339	2339		9606
LWSDFKDQQK	10	Unmodified	_LWSDFKDQQK_			0	0	1	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MSMS	DP1141_6	1	647.3501586914062	2	647.824952	1293.63535	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.854	1	16.854	16.354	17.354	0								0	0	0	0.01158	1	8402	8402		109.48	54.108	1				1731	445	1013	1055	2340	2340		9606
LYGSAGPPPTGEEDTAEKDEL	21	Unmodified	_LYGSAGPPPTGEEDTAEKDEL_			0	0	1	P11021	P11021	P11021	HSPA5	78 kDa glucose-regulated protein	MULTI-MSMS	DP1141_8	3	1088.5015869140625	2	1088.50005	2174.98554	1.0431	0.0011354	0.47267	0.00051451	1.5158	0.0016499	1089.5039412437889	18.125	0.40039	18.125	17.975	18.375	0					7	3	3	0	0	0	1.5572E-06	2	11218	11197;11218		110.25	88.951	1	25753000			1732	139	1014	1056	2341;2342	2342		9606
LYPVLQQSLVR	11	Unmodified	_LYPVLQQSLVR_			0	0	0	Q5RKV6	Q5RKV6	Q5RKV6	EXOSC6	Exosome complex component MTR3	MULTI-MSMS	DP1141_10	5	658.3909912109375	2	658.390262	1314.76597	0.28744	0.00018925	0.42487	0.00027973	0.71232	0.00046898	658.3903440738524	19.826	0.7001	19.826	19.476	20.176	0					11	6	3	0	0	0	0.0040579	2	14227	14116;14227		123.21	92.596	1	19207000			1733	418	1015	1057	2343;2344	2344		9606
MADALDNYVIR	11	Oxidation (M)	_M(Oxidation (M))ADALDNYVIR_	M(1)ADALDNYVIR	M(140)ADALDNYVIR	0	1	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MSMS	DP1141_7	2	648.8394165039062	2	648.81627	1295.61799	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.931	1	18.931	18.431	19.431	0								0	0	0	2.8364E-06	1	12385	12385		138.98	82.412	1				1734	110	1016	1058	2345	2345	95	9606
MADEAVCVGPAPTSK	15	Oxidation (M)	_M(Oxidation (M))ADEAVCVGPAPTSK_	M(1)ADEAVCVGPAPTSK	M(290)ADEAVCVGPAPTSK	0	1	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_10	5	774.8607177734375	2	774.855266	1547.69598	0.52046	0.00040328	3.8598	0.0029908	4.3803	0.0033941	774.8579560310307	15.595	0.32087	15.595	15.46	15.781	0					8	3	3	0	0	0	0	1	7445	7445		286.19	227.94	1	11155000			1735	110	1017	1059	2346	2346	96	9606
MADEAVCVGPAPTSK	15	Oxidation (M)	_M(Oxidation (M))ADEAVCVGPAPTSK_	M(1)ADEAVCVGPAPTSK	M(340)ADEAVCVGPAPTSK	0	1	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MSMS	DP1141_6	1	774.8601684570312	2	774.855266	1547.69598	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.701	1	15.701	15.201	16.201	0								0	0	0	0	1	6479	6479		340.93	279.37	1				1736	110	1017	1059	2347	2347	96	9606
MADEAVCVGPAPTSK	15	Oxidation (M)	_M(Oxidation (M))ADEAVCVGPAPTSK_	M(1)ADEAVCVGPAPTSK	M(150)ADEAVCVGPAPTSK	0	1	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MSMS	DP1141_6	1	774.8566284179688	2	774.855266	1547.69598	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.773	1	15.773	15.273	16.273	0								0	0	0	3.9716E-17	1	6592	6592		154.67	108.27	1				1737	110	1017	1059	2348	2348	96	9606
MADEAVCVGPAPTSK	15	Oxidation (M)	_M(Oxidation (M))ADEAVCVGPAPTSK_	M(1)ADEAVCVGPAPTSK	M(180)ADEAVCVGPAPTSK	0	1	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_7	2	774.7191772460938	2	774.855266	1547.69598	0.55351	0.00042889	2.1313	0.0016514	2.6848	0.0020803	774.8573138240121	15.7	0.40527	15.7	15.409	15.815	0					5	3	2	0	0	0	5.8693000000000005E-30	1	7130	7130		179.6	112.64	1	8431400			1738	110	1017	1059	2349	2349	96	9606
MADEAVCVGPAPTSK	15	Oxidation (M)	_M(Oxidation (M))ADEAVCVGPAPTSK_	M(1)ADEAVCVGPAPTSK	M(340)ADEAVCVGPAPTSK	0	1	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_8	3	774.8607788085938	2	774.855266	1547.69598	0.38249	0.00029637	1.0545	0.00081708	1.437	0.0011135	774.8560126257188	15.726	0.40371	15.726	15.472	15.876	0					5	3	2	0	0	0	0	1	7108	7108		340.93	272.08	1	126680000			1739	110	1017	1059	2350	2350	96	9606
MAEEQPQVELFVK	13	Oxidation (M)	_M(Oxidation (M))AEEQPQVELFVK_	M(1)AEEQPQVELFVK	M(60)AEEQPQVELFVK	0	1	0	O00299	O00299	O00299	CLIC1	Chloride intracellular channel protein 1	MSMS	DP1141_10	5	521.9266967773438	3	521.928958	1562.76504	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.199	1	14.199	13.699	14.699	0								0	0	0	0.032065	1	5087	5087		60.08	17.292	1				1740	34	1018	1060	2351	2351	31	9606
MAFAPPKNTDGPK	13	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))AFAPPKNTDGPK_	M(1)AFAPPKNTDGPK	M(40)AFAPPKNTDGPK	1	1	1	Q8IX29	Q8IX29	Q8IX29	FBXO16	F-box only protein 16	MULTI-MSMS	DP1141_9	4	477.9041442871094	3	477.902743	1430.6864	0.47585	0.00022741	2.0993	0.0010033	2.5751	0.0012307	478.23800185607206	14.213	0.3354	14.213	14.053	14.388	0					5	4	2	0	0	0	0.03202	1	4652	4652		40.373	9.3049	1	2849000			1741	465	1019	1061	2352	2352	346	9606
MAGAELGAALEQR	13	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))AGAELGAALEQR_	M(1)AGAELGAALEQR	M(55)AGAELGAALEQR	1	1	0	A6NEY8	A6NEY8	A6NEY8	PRORSD1P	Putative prolyl-tRNA synthetase associated domain-containing protein 1	MSMS	DP1141_9	4	687.8370361328125	2	687.837733	1373.66091	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.752	1	17.752	17.252	18.252	0								0	0	0	0.034432	1	10338	10338		55.064	9.6958	1				1742	2	1020	1062	2353	2353	2	9606
MALENGGLARR	11	Oxidation (M)	_M(Oxidation (M))ALENGGLARR_	M(1)ALENGGLARR	M(64)ALENGGLARR	0	1	1	CON__Q3T052	CON__Q3T052	CON__Q3T052			MULTI-MSMS	DP1141_10	5	402.12060546875	3	401.880273	1202.61899	0.44562	0.00017909	2.842	0.0011422	3.2876	0.0013212	401.88155602730814	15.209	0.47395	15.209	14.806	15.28	0					7	5	2	0	0	0	0.024942	1	6577	6577		63.944	26.004	1	2708300		+	1743	25	1021	1063	2354	2354	27	
MAMSLPGSRRTSAGSR	16	2 Oxidation (M)	_M(Oxidation (M))AM(Oxidation (M))SLPGSRRTSAGSR_	M(1)AM(1)SLPGSRRTSAGSR	M(91)AM(91)SLPGSRRTSAGSR	0	2	2	O15079	O15079	O15079	SNPH	Syntaphilin	MSMS	DP1141_7	2	848.912841796875	2	848.914512	1695.81447	NaN	NaN	NaN	NaN	NaN	NaN	NaN	23.042	1	23.042	22.542	23.542	0								0	0	0	0.014991	1	18545	18545		90.913	15.261	1				1744	50	1022	1064	2355	2355	42;43	9606
MAPVPLDDSNRPASLTK	17	Oxidation (M)	_M(Oxidation (M))APVPLDDSNRPASLTK_	M(1)APVPLDDSNRPASLTK	M(150)APVPLDDSNRPASLTK	0	1	1	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_7	2	609.9805908203125	3	609.980492	1826.91965	0.74666	0.00045545	-0.40619	-0.00024777	0.34047	0.00020768	610.3145418281707	16.301	0.40029	16.301	16.114	16.515	0					10	3	4	0	0	0	1.1255E-05	3	8239	8183;8239;8302		151.22	132.43	1	84774000			1745	580	1023	1065	2356;2357;2358	2357	412	9606
MAPVPLDDSNRPASLTK	17	Oxidation (M)	_M(Oxidation (M))APVPLDDSNRPASLTK_	M(1)APVPLDDSNRPASLTK	M(96)APVPLDDSNRPASLTK	0	1	1	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_7	2	914.4669799804688	2	914.4671	1826.91965	0.65319	0.00059732	-0.3905	-0.0003571	0.2627	0.00024023	914.4669250687126	16.318	0.30022	16.318	16.114	16.415	0					6	2	3	0	0	0	0.011414	1	8298	8298		96.334	65.771	1	12754000			1746	580	1023	1065	2359	2359	412	9606
MATKEKLQCLK	11	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))ATKEKLQCLK_	M(1)ATKEKLQCLK	M(44)ATKEKLQCLK	1	1	2	P31641	P31641	P31641	SLC6A6	Sodium- and chloride-dependent taurine transporter	MSMS	DP1141_8	3	704.37109375	2	704.370355	1406.72616	NaN	NaN	NaN	NaN	NaN	NaN	NaN	24.563	1	24.563	24.063	25.063	0								0	0	0	0.035506	1	20563	20563		44.203	10.974	1				1747	198	1024	1066	2360	2360	167	9606
MAVTFIGNSTAIQELFK	17	Oxidation (M)	_M(Oxidation (M))AVTFIGNSTAIQELFK_	M(1)AVTFIGNSTAIQELFK	M(180)AVTFIGNSTAIQELFK	0	1	0	P07437	P07437	P07437	TUBB	Tubulin beta chain	MULTI-MSMS	DP1141_10	5	943.49072265625	2	943.490044	1884.96554	0.47701	0.00045006	0.22528	0.00021255	0.70229	0.00066261	943.490242870568	22.729	0.4126	22.729	22.435	22.848	0					11	4	5	0	0	0	9.522100000000001E-24	2	18613	18613;18617		175.48	132.4	1	65833000			1748	122	1025	1067	2361;2362	2361	113	9606
MAVTFIGNSTAIQELFK	17	Oxidation (M)	_M(Oxidation (M))AVTFIGNSTAIQELFK_	M(1)AVTFIGNSTAIQELFK	M(290)AVTFIGNSTAIQELFK	0	1	0	P07437	P07437	P07437	TUBB	Tubulin beta chain	MULTI-MSMS	DP1141_8	3	943.490478515625	2	943.490044	1884.96554	0.34178	0.00032246	-0.11016	-0.00010393	0.23162	0.00021853	943.4899739759908	22.738	0.30737	22.738	22.565	22.872	0					14	3	6	0	0	0	0	2	17915	17915;17916		286.29	232.69	1	142330000			1749	122	1025	1067	2363;2364	2363	113	9606
MAVTFIGNSTAIQELFK	17	Oxidation (M)	_M(Oxidation (M))AVTFIGNSTAIQELFK_	M(1)AVTFIGNSTAIQELFK	M(110)AVTFIGNSTAIQELFK	0	1	0	P07437	P07437	P07437	TUBB	Tubulin beta chain	MULTI-MSMS	DP1141_8	3	629.6636352539062	3	629.329122	1884.96554	0.53371	0.00033588	-0.19964	-0.00012564	0.33406	0.00021024	629.3291051436933	22.738	0.40857	22.738	22.379	22.788	0					9	4	4	0	0	0	0.00010836	1	17942	17942		106.38	84.163	1	13787000			1750	122	1025	1067	2365	2365	113	9606
MAVTFIGNSTAIQELFK	17	Oxidation (M)	_M(Oxidation (M))AVTFIGNSTAIQELFK_	M(1)AVTFIGNSTAIQELFK	M(250)AVTFIGNSTAIQELFK	0	1	0	P07437	P07437	P07437	TUBB	Tubulin beta chain	MULTI-MSMS	DP1141_9	4	943.9923095703125	2	943.490044	1884.96554	0.74556	0.00070343	-0.24408	-0.00023029	0.50148	0.00047315	943.48998585132	22.729	0.19732	22.729	22.582	22.779	0					10	2	5	0	0	0	1.1431000000000001E-192	2	17988	17988;18021		246.63	198.35	1	47727000			1751	122	1025	1067	2366;2367	2366	113	9606
MAVTFIGNSTAIQELFKR	18	Oxidation (M)	_M(Oxidation (M))AVTFIGNSTAIQELFKR_	M(1)AVTFIGNSTAIQELFKR	M(140)AVTFIGNSTAIQELFKR	0	1	1	P07437	P07437	P07437	TUBB	Tubulin beta chain	MULTI-MSMS	DP1141_9	4	681.3682861328125	3	681.362825	2041.06665	-0.17403	-0.00011857	0.48796	0.00033247	0.31393	0.0002139	681.362614315963	21.533	0.30114	21.533	21.338	21.639	0					4	2	2	0	0	0	0.00054551	1	16116	16116		140.93	55.921	1	3970900			1752	122	1026	1068	2368	2368	113	9606
MAVVKTPSRGLK	12	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))AVVKTPSRGLK_	M(1)AVVKTPSRGLK	M(49)AVVKTPSRGLK	1	1	2	Q4G0U5	Q4G0U5	Q4G0U5	CFAP221	Cilia- and flagella-associated protein 221	MSMS	DP1141_10	5	448.7637939453125	3	448.927112	1343.75951	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.154	1	17.154	16.654	17.654	0								0	0	0	0.034119	1	9923	9923		49.189	12.511	1				1753	416	1027	1069	2369	2369	316	9606
MDEPSPLAQPLELNQHSR	18	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))DEPSPLAQPLELNQHSR_	M(1)DEPSPLAQPLELNQHSR	M(340)DEPSPLAQPLELNQHSR	1	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	1060.5074462890625	2	1060.50749	2119.00042	0.083202	8.8237E-05	-0.18051	-0.00019143	-0.09731	-0.0001032	1061.0088362995868	19.456	0.79275	19.456	19.205	19.998	0					17	7	3	0	0	0	0	4	12612	12612;12625;13280;13367		338.12	274	1	319150000			1754	367	1028	1070	2370;2371;2372;2373	2370	275	9606
MDEPSPLAQPLELNQHSR	18	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))MDEPSPLAQPLELNQHSR_			1	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	1052.509521484375	2	1052.51003	2103.0055	0.17922	0.00018863	-0.1775	-0.00018682	0.0017266	1.8172E-06	1053.0116770985314	20.341	0.39493	20.341	20.09	20.485	0					12	3	5	0	0	0	0	2	14049	14049;14094		327.94	273.24	1	57584000			1755	367	1028	1071	2374;2375	2374		9606
MDILKSEILR	10	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))DILKSEILR_	M(1)DILKSEILR	M(41)DILKSEILR	1	1	1	Q99633	Q99633	Q99633	PRPF18	Pre-mRNA-splicing factor 18	MULTI-MSMS	DP1141_6	1	638.3508911132812	2	638.352488	1274.69042	1.0876	0.00069425	-2.8717	-0.0018331	-1.7841	-0.0011389	638.3505003174138	23.101	0.11375	23.101	23.036	23.149	0					6	2	3	0	0	0	0.029715	1	18162	18162		40.882	7.0066	1	1444200			1756	530	1029	1072	2376	2376	382	9606
MDKQSSAGGVKR	12	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))DKQSSAGGVKR_	M(1)DKQSSAGGVKR	M(46)DKQSSAGGVKR	1	1	2	Q9NY87;Q9NS26;Q9BXN6	Q9NY87	Q9NY87	SPANXC;SPANXA1;SPANXD	Sperm protein associated with the nucleus on the X chromosome C;Sperm protein associated with the nucleus on the X chromosome A;Sperm protein associated with the nucleus on the X chromosome D	MSMS	DP1141_7	2	441.2118835449219	3	441.222476	1320.6456	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.003	1	16.003	15.503	16.503	0								0	0	0	0.035364	1	7631	7631		45.764	9.4467	1				1757	545	1030	1073	2377	2377	390	9606
MDLFGDLPEPER	12	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))DLFGDLPEPER_	M(1)DLFGDLPEPER	M(82)DLFGDLPEPER	1	1	0	Q9H0C8	Q9H0C8	Q9H0C8	ILKAP	Integrin-linked kinase-associated serine/threonine phosphatase 2C	MULTI-MSMS	DP1141_9	4	738.8375244140625	2	738.837399	1475.66025	0.44792	0.00033094	-0.30126	-0.00022258	0.14666	0.00010835	738.8373073044248	22.605	0.22873	22.605	22.43	22.659	0					4	2	2	0	0	0	0.0060037	1	17842	17842		82.171	22.745	1	4636600			1758	552	1031	1074	2378	2378	396	9606
MEDLTNVSSLLNMER	15	Oxidation (M)	_MEDLTNVSSLLNM(Oxidation (M))ER_	MEDLTNVSSLLNM(1)ER	M(-43)EDLTNVSSLLNM(43)ER	0	1	0	Q7L2Z9	Q7L2Z9	Q7L2Z9	CENPQ	Centromere protein Q	MULTI-MSMS	DP1141_10	5	589.8026733398438	3	589.946571	1766.81788	0.13918	8.2106E-05	-3.1086	-0.0018339	-2.9694	-0.0017518	589.9445358504255	17.637	0.50037	17.637	17.287	17.788	0					6	4	2	0	0	0	0.029032	1	10306	10306		49.333	21.28	2	70296000			1759	446	1032	1075	2379	2379	332	9606
MEEPQSDPSVEPPLSQETFSDLWK	24	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))EEPQSDPSVEPPLSQETFSDLWK_	M(1)EEPQSDPSVEPPLSQETFSDLWK	M(100)EEPQSDPSVEPPLSQETFSDLWK	1	1	0	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MULTI-MSMS	DP1141_8	3	945.9908447265625	3	945.428617	2833.26402	0.28566	0.00027007	0.090821	8.5864E-05	0.37648	0.00035593	945.7636161504662	23.903	0.23898	23.903	23.783	24.022	0					4	2	2	0	0	0	6.9225E-07	1	19691	19691		100.85	74.665	1	6017700			1760	104	1033	1076	2380	2380	88	9606
MEGPLSVFGDR	11	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))EGPLSVFGDR_	M(1)EGPLSVFGDR	M(60)EGPLSVFGDR	1	1	0	P17987	P17987	P17987	TCP1	T-complex protein 1 subunit alpha	MULTI-SECPEP	DP1141_8	3	633.369384765625	2	633.29517	1264.57579	0.6388	0.00040455	0.1255	7.948E-05	0.7643	0.00048403	633.2952804602705	22.303	0.5996	22.303	21.779	22.379	0					6	5	2	0	0	0	0.022155	1	17289	17289		60.102	35.227	1	3347800			1761	165	1034	1077	2381	2381	152	9606
MEHYLPARVMEK	12	Oxidation (M)	_M(Oxidation (M))EHYLPARVMEK_	M(1)EHYLPARVMEK	M(52)EHYLPARVM(-52)EK	0	1	1	Q12923	Q12923	Q12923	PTPN13	Tyrosine-protein phosphatase non-receptor type 13	MSMS	DP1141_8	3	507.2500915527344	3	507.251378	1518.7323	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.002	1	17.002	16.502	17.502	0								0	0	0	0.032366	1	9188	9188		67.214	23.416	2				1762	364	1035	1078	2382	2382	263	9606
MELGNVTRVK	10	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))ELGNVTRVK_	M(1)ELGNVTRVK	M(63)ELGNVTRVK	1	1	1	Q8NGI4	Q8NGI4	Q8NGI4	OR4D11	Olfactory receptor 4D11	MULTI-MSMS	DP1141_9	4	602.8204345703125	2	602.821355	1203.62816	0.6513	0.00039262	-2.7521	-0.001659	-2.1008	-0.0012664	602.8200714375525	26.804	0.40748	26.804	26.582	26.989	0					5	4	2	0	0	0	0.011918	1	23587	23587		62.546	19.463	1	877670			1763	476	1036	1079	2383	2383	353	9606
MELITILEK	9	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))ELITILEK_	M(1)ELITILEK	M(110)ELITILEK	1	1	0	Q14974	Q14974	Q14974	KPNB1	Importin subunit beta-1	MULTI-MSMS	DP1141_7	2	574.3178100585938	2	574.317583	1146.62061	0.48595	0.00027909	-0.18284	-0.00010501	0.30311	0.00017408	574.3175169786768	24.042	0.44804	24.042	23.878	24.326	0					11	5	4	0	0	0	0.0015106	2	20043	20043;20050		109.11	76.5	1	18874000			1764	395	1037	1080	2384;2385	2384	304	9606
MEQMSNMTLMKETISTVEKEMK	22	2 Oxidation (M)	_MEQMSNMTLM(Oxidation (M))KETISTVEKEM(Oxidation (M))K_	M(0.112)EQM(0.109)SNM(0.096)TLM(0.691)KETISTVEKEM(0.993)K	M(-8)EQM(-8.2)SNM(-8.8)TLM(8)KETISTVEKEM(22)K	0	2	2	Q9BZW7	Q9BZW7	Q9BZW7	TSGA10	Testis-specific gene 10 protein	MULTI-SECPEP	DP1141_7	2	884.4439086914062	3	884.408349	2650.20322	0.27177	0.00024035	-0.90865	-0.00080362	-0.63688	-0.00056327	884.7419360103229	19.401	0.5	19.401	19.15	19.65	0					10	4	4	0	0	0	0.017616	1	13206	13206		45.047	14.455	10	44635000			1765	547	1038	1081	2386	2386	392;393	9606
MEQTEVLK	8	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))EQTEVLK_	M(1)EQTEVLK	M(67)EQTEVLK	1	1	0	Q16878	Q16878	Q16878	CDO1	Cysteine dioxygenase type 1	MULTI-MSMS	DP1141_8	3	518.7931518554688	2	518.254982	1034.49541	0.14272	7.3965E-05	-3.0515	-0.0015815	-2.9088	-0.0015075	518.2533698720594	17.023	0.51041	17.023	16.562	17.073	0					8	5	3	0	0	0	0.031898	1	9195	9195		67.035	13.683	1	36817000			1766	414	1039	1082	2387	2387	315	9606
MEVKPPPGRPQPDSGR	16	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))EVKPPPGRPQPDSGR_	M(1)EVKPPPGRPQPDSGR	M(57)EVKPPPGRPQPDSGR	1	1	2	P51991	P51991	P51991	HNRNPA3	Heterogeneous nuclear ribonucleoprotein A3	MULTI-MSMS	DP1141_10	5	602.6371459960938	3	602.636949	1804.88902	0.27783	0.00016743	0.14212	8.5647E-05	0.41995	0.00025307	602.6368917132412	14.509	0.32766	14.509	14.339	14.667	0					7	4	2	0	0	0	0.00975	1	5574	5574		56.793	30.012	1	12152000			1767	262	1040	1083	2388	2388	212	9606
MFGGPGTASRPSSSR	15	Oxidation (M)	_M(Oxidation (M))FGGPGTASRPSSSR_	M(1)FGGPGTASRPSSSR	M(97)FGGPGTASRPSSSR	0	1	1	P08670	P08670	P08670	VIM	Vimentin	MULTI-MSMS	DP1141_8	3	504.24090576171875	3	504.240418	1509.69942	0.2345	0.00011824	-0.37116	-0.00018715	-0.13666	-6.891E-05	504.57466121402024	14.013	0.37395	14.013	13.805	14.179	0					10	4	3	0	0	0	0.0030642	1	4458	4458		96.604	56.45	1	11917000			1768	127	1041	1084	2389	2389	121	9606
MFLYNLTLQR	10	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))FLYNLTLQR_	M(1)FLYNLTLQR	M(80)FLYNLTLQR	1	1	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_7	2	678.8529663085938	2	678.852655	1355.69076	0.54506	0.00037002	0.22322	0.00015153	0.76828	0.00052155	678.852712699938	22.858	0.17739	22.858	22.728	22.906	0					4	2	2	0	0	0	0.0077243	1	18311	18311		80.455	47.614	1	5095600			1769	402	1042	1085	2390	2390	306	9606
MFQLPVNNLGSLR	13	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))FQLPVNNLGSLR_	M(1)FQLPVNNLGSLR	M(160)FQLPVNNLGSLR	1	1	0	Q9H2P0	Q9H2P0	Q9H2P0	ADNP	Activity-dependent neuroprotector homeobox protein	MULTI-MSMS	DP1141_7	2	773.9069213867188	2	773.90595	1545.79735	0.73651	0.00056999	0.52661	0.00040755	1.2631	0.00097754	773.9061497748107	22.858	0.17739	22.858	22.728	22.906	0					6	2	3	0	0	0	1.1488E-09	1	18308	18308		156.48	101.99	1	5575700			1770	559	1043	1086	2391	2391	400	9606
MGGFQRGKYGTMAEGR	16	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))GGFQRGKYGTMAEGR_	M(1)GGFQRGKYGTMAEGR	M(33)GGFQRGKYGTM(-33)AEGR	1	1	2	Q96F15	Q96F15	Q96F15	GIMAP5	GTPase IMAP family member 5	MSMS	DP1141_6	1	902.4197387695312	2	902.416888	1802.81922	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.138	1	22.138	21.638	22.638	0								0	0	0	0.034622	1	16700	16700		51.979	11.463	2				1771	508	1044	1087	2392	2392	363	9606
MGGMVSFR	8	Oxidation (M)	_M(Oxidation (M))GGMVSFR_	M(1)GGMVSFR	M(70)GGM(-70)VSFR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	450.7713317871094	2	450.706948	899.399343	0.31627	0.00014255	-0.13576	-6.1187E-05	0.18052	8.136E-05	450.70681486543623	16.869	0.8756	16.869	16.729	17.605	0					16	9	2	0	0	0	0.030763	1	8400	8400		114.78	45.351	2	126510000			1772	367	1045	1088	2393	2393	276;277	9606
MGGMVSFR	8	Oxidation (M)	_MGGM(Oxidation (M))VSFR_	MGGM(1)VSFR	M(-41)GGM(41)VSFR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	450.7791442871094	2	450.706948	899.399343	0.42209	0.00019024	-0.34999	-0.00015774	0.072095	3.2494E-05	450.7067820968727	16.255	0.55198	16.255	16.105	16.657	0					7	5	2	0	0	0	0.027521	1	7323	7323		95.352	48.689	2	123650000			1773	367	1045	1088	2394	2394	276;277	9606
MGPAMGPALGAGIER	15	2 Oxidation (M)	_M(Oxidation (M))GPAM(Oxidation (M))GPALGAGIER_	M(1)GPAM(1)GPALGAGIER	M(110)GPAM(110)GPALGAGIER	0	2	0	P52272	P52272	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	MULTI-MSMS	DP1141_10	5	730.4049072265625	2	730.355236	1458.69592	0.3997	0.00029192	0.78268	0.00057164	1.1824	0.00086356	730.3556952660118	16.973	0.1578	16.973	16.847	17.005	0					4	2	2	0	0	0	0.0069784	2	9560	9560;9631		107.85	85.409	1	16162000			1774	263	1046	1089	2395;2396	2395	214;215	9606
MGPLGLDHMASSIER	15	2 Oxidation (M)	_M(Oxidation (M))GPLGLDHM(Oxidation (M))ASSIER_	M(1)GPLGLDHM(1)ASSIER	M(56)GPLGLDHM(56)ASSIER	0	2	0	P52272	P52272	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	MULTI-SECPEP	DP1141_10	5	549.560302734375	3	549.260602	1644.75998	0.36288	0.00019931	-0.023552	-1.2936E-05	0.33933	0.00018638	549.5950795733896	16.606	0.26657	16.606	16.46	16.727	0					7	3	3	0	0	0	0.015345	1	9065	9065		56.286	39.624	1	17604000			1775	263	1047	1090	2397	2397	216;217	9606
MGPLGLDHMASSIER	15	2 Oxidation (M)	_M(Oxidation (M))GPLGLDHM(Oxidation (M))ASSIER_	M(1)GPLGLDHM(1)ASSIER	M(68)GPLGLDHM(68)ASSIER	0	2	0	P52272	P52272	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	MULTI-SECPEP	DP1141_9	4	549.2257080078125	3	549.260602	1644.75998	0.56474	0.00031019	-0.5074	-0.00027869	0.057343	3.1496E-05	549.2604994153952	16.643	0.23434	16.643	16.458	16.693	0					8	2	4	0	0	0	0.0039714	1	8535	8535		68.033	48.71	1	26523000			1776	263	1047	1090	2398	2398	216;217	9606
MGPVIGMTPDK	11	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))GPVIGMTPDK_	M(1)GPVIGMTPDK	M(40)GPVIGM(-40)TPDK	1	1	0	P32314	P32314	P32314	FOXN2	Forkhead box protein N2	MULTI-MSMS	DP1141_8	3	602.794921875	2	602.291042	1202.56753	0.53905	0.00032467	0.87885	0.00052932	1.4179	0.00085399	602.7936508738082	15.549	1.0031	15.549	14.873	15.876	0					13	9	3	0	0	0	0.022698	1	7144	7144		66.429	11.318	2	12547000			1777	202	1048	1091	2399	2399	171	9606
MHLYLGAAK	9	Unmodified	_MHLYLGAAK_			0	0	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	502.7643737792969	2	502.273312	1002.53207	-0.20729	-0.00010412	0.23648	0.00011878	0.029187	1.466E-05	502.27343375697546	16.838	0.44591	16.838	16.657	17.103	0					9	5	2	0	0	0	0.0010996	1	8326	8326		128.38	128.38	1	83365000			1778	367;40	1049	1092	2400	2400		9606
MHLYLGAAK	9	Oxidation (M)	_M(Oxidation (M))HLYLGAAK_	M(1)HLYLGAAK	M(130)HLYLGAAK	0	1	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	509.60772705078125	2	510.27077	1018.52699	-0.29802	-0.00015207	0.74782	0.00038159	0.4498	0.00022952	510.27114712520637	15.259	1.0967	15.259	14.908	16.005	0					23	10	3	0	0	0	0.0098785	1	5698	5698		128.82	82.426	1	18974000			1779	367;40	1049	1093	2401	2401	35	9606
MIAGQVLDINLAAEPK	16	Oxidation (M)	_M(Oxidation (M))IAGQVLDINLAAEPK_	M(1)IAGQVLDINLAAEPK	M(120)IAGQVLDINLAAEPK	0	1	0	P07910	P07910	P07910	HNRNPC	Heterogeneous nuclear ribonucleoproteins C1/C2	MULTI-MSMS	DP1141_9	4	850.3840942382812	2	849.95838	1697.90221	0.11996	0.00010196	-0.18037	-0.0001533	-0.060404	-5.1341E-05	849.9584181673682	20.094	0.29832	20.094	19.938	20.237	0					8	2	4	0	0	0	0.0073832	1	14011	14011		119.25	76.17	1	19104000			1780	124	1050	1094	2402	2402	116	9606
MIASQVVDINLAAEPKVNR	19	Oxidation (M)	_M(Oxidation (M))IASQVVDINLAAEPKVNR_	M(1)IASQVVDINLAAEPKVNR	M(46)IASQVVDINLAAEPKVNR	0	1	1	A0A0G2JPF8;P0DMR1;O60812;B7ZW38	A0A0G2JPF8	A0A0G2JPF8	HNRNPCL4;HNRNPCL1;HNRNPCL3	Heterogeneous nuclear ribonucleoprotein C-like 4;Heterogeneous nuclear ribonucleoprotein C-like 1;Heterogeneous nuclear ribonucleoprotein C-like 3	MULTI-SECPEP	DP1141_8	3	695.0438232421875	3	695.377134	2083.10957	0.8486	0.0005901	0.32871	0.00022858	1.1773	0.00081868	695.3774630117639	22.702	0.40857	22.702	22.379	22.788	0					7	4	3	0	0	0	0.034478	1	17908	17908		46.121	18.157	1	34524000			1781	0	1051	1095	2403	2403	0	9606
MIDMLAANSGR	11	2 Oxidation (M)	_M(Oxidation (M))IDM(Oxidation (M))LAANSGR_	M(1)IDM(1)LAANSGR	M(93)IDM(93)LAANSGR	0	2	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MSMS	DP1141_6	1	605.9722900390625	2	605.781373	1209.54819	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.248	1	15.248	14.748	15.748	0								0	0	0	0.0078801	1	5791	5791		92.538	42.725	1				1782	445	1052	1096	2404	2404	326;327	9606
MIDMLAANSGR	11	2 Oxidation (M)	_M(Oxidation (M))IDM(Oxidation (M))LAANSGR_	M(1)IDM(1)LAANSGR	M(84)IDM(84)LAANSGR	0	2	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MSMS	DP1141_6	1	605.830810546875	2	605.781373	1209.54819	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.273	1	15.273	14.773	15.773	0								0	0	0	0.016009	1	5824	5824		83.862	55.463	1				1783	445	1052	1096	2405	2405	326;327	9606
MIDMLAANSGR	11	2 Oxidation (M)	_M(Oxidation (M))IDM(Oxidation (M))LAANSGR_	M(1)IDM(1)LAANSGR	M(78)IDM(78)LAANSGR	0	2	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-MSMS	DP1141_7	2	605.6368408203125	2	605.781373	1209.54819	0.13118	7.9466E-05	0.64339	0.00038975	0.77457	0.00046922	605.7818174731042	15.26	0.40022	15.26	15.009	15.409	0					6	3	2	0	0	0	0.030379	1	6579	6579		77.662	20.382	1	25058000			1784	445	1052	1096	2406	2406	326;327	9606
MIMDDSKRK	9	2 Oxidation (M)	_M(Oxidation (M))IM(Oxidation (M))DDSKRK_	M(1)IM(1)DDSKRK	M(72)IM(72)DDSKRK	0	2	2	O14786	O14786	O14786	NRP1	Neuropilin-1	MSMS	DP1141_6	1	577.7901611328125	2	578.278466	1154.54238	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.771	1	19.771	19.271	20.271	0								0	0	0	0.025528	1	13062	13062		71.715	21.083	1				1785	46	1053	1097	2407	2407	38;39	9606
MIMVEERLILQQKMVK	16	2 Oxidation (M)	_M(Oxidation (M))IM(Oxidation (M))VEERLILQQKMVK_	M(1)IM(1)VEERLILQQKMVK	M(40)IM(36)VEERLILQQKM(-36)VK	0	2	2	B1AJZ9	B1AJZ9	B1AJZ9	FHAD1	Forkhead-associated domain-containing protein 1	MSMS	DP1141_6	1	674.3593139648438	3	674.370046	2020.08831	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.823	1	18.823	18.323	19.323	0								0	0	0	0.035628	1	11582	11582		50.155	26.52	3				1786	5	1054	1098	2408	2408	4;5	9606
MIQMEPQFGGAPCPETVQRK	20	2 Oxidation (M)	_M(Oxidation (M))IQM(Oxidation (M))EPQFGGAPCPETVQRK_	M(1)IQM(1)EPQFGGAPCPETVQRK	M(49)IQM(49)EPQFGGAPCPETVQRK	0	2	1	Q9HCB6	Q9HCB6	Q9HCB6	SPON1	Spondin-1	MSMS	DP1141_6	1	779.3671875	3	779.365912	2335.07591	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.786	1	20.786	20.286	21.286	0								0	0	0	0.035808	1	14630	14630		49.141	19.421	1				1787	566	1055	1099	2409	2409	403;404	9606
MIVDPVEPHGEMK	13	2 Oxidation (M)	_M(Oxidation (M))IVDPVEPHGEM(Oxidation (M))K_	M(1)IVDPVEPHGEM(1)K	M(120)IVDPVEPHGEM(120)K	0	2	0	Q13263	Q13263	Q13263	TRIM28	Transcription intermediary factor 1-beta	MULTI-MSMS	DP1141_7	2	505.57354736328125	3	505.239027	1512.69525	-0.3992	-0.00020169	0.87349	0.00044132	0.47429	0.00023963	505.2395037044821	15.244	0.80552	15.244	14.909	15.714	0					16	7	3	0	0	0	0.0010736	1	6444	6444		116.24	84.582	1	90979000			1788	372	1056	1100	2410	2410	292;293	9606
MKEIAEAYLGK	11	Unmodified	_MKEIAEAYLGK_			0	0	1	P11142	P11142	P11142	HSPA8	Heat shock cognate 71 kDa protein	MSMS	DP1141_8	3	626.5781860351562	2	626.833931	1251.65331	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.117	1	17.117	16.617	17.617	0								0	0	0	3.7202E-23	1	9377	9377		178.46	84.151	1				1789	140	1057	1101	2411	2411		9606
MKEIAEAYLGK	11	Unmodified	_MKEIAEAYLGK_			0	0	1	P11142	P11142	P11142	HSPA8	Heat shock cognate 71 kDa protein	MSMS	DP1141_8	3	626.6409912109375	2	626.833931	1251.65331	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.154	1	17.154	16.654	17.654	0								0	0	0	0.0043178	1	9434	9434		138.22	59.703	1				1790	140	1057	1101	2412	2412		9606
MKEIAEAYLGYPVTNAVITVPAYFNDSQR	29	Oxidation (M)	_M(Oxidation (M))KEIAEAYLGYPVTNAVITVPAYFNDSQR_	M(1)KEIAEAYLGYPVTNAVITVPAYFNDSQR	M(88)KEIAEAYLGYPVTNAVITVPAYFNDSQR	0	1	1	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-MSMS	DP1141_8	3	1093.214599609375	3	1092.8797	3275.61726	1.0155	0.0011098	-0.56071	-0.00061278	0.45475	0.00049699	1093.2134321119418	22.029	0.39946	22.029	21.779	22.179	0					11	3	5	0	0	0	1.1587E-09	1	17008	17008		87.772	77.595	1	14248000			1791	135	1058	1102	2413	2413	128	9606
MKETAENYLGHTAK	14	Oxidation (M)	_M(Oxidation (M))KETAENYLGHTAK_	M(1)KETAENYLGHTAK	M(120)KETAENYLGHTAK	0	1	1	P38646	P38646	P38646	HSPA9	Stress-70 protein, mitochondrial	MULTI-MSMS	DP1141_8	3	536.9306640625	3	536.927729	1607.76136	0.24995	0.00013421	0.48676	0.00026135	0.73671	0.00039556	537.2623397627564	14.397	0.69409	14.397	14.179	14.873	0					13	7	3	0	0	0	0.0064112	1	5062	5062		116.79	79.129	1	54088000			1792	217	1059	1103	2414	2414	180	9606
MKIELFADVVPK	12	Oxidation (M)	_M(Oxidation (M))KIELFADVVPK_	M(1)KIELFADVVPK	M(63)KIELFADVVPK	0	1	1	O43447	O43447	O43447	PPIH	Peptidyl-prolyl cis-trans isomerase H	MSMS	DP1141_10	5	469.59564208984375	3	469.263501	1404.76867	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.41	1	19.41	18.91	19.91	0								0	0	0	0.03478	1	13556	13556		63.181	28.104	1				1793	58	1060	1104	2415	2415	50	9606
MKRHEMVAK	9	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))MKRHEM(Oxidation (M))VAK_	MKRHEM(1)VAK	M(-56)KRHEM(56)VAK	1	1	2	Q03924	Q03924	Q03924	ZNF117	Zinc finger protein 117	MSMS	DP1141_10	5	594.3114013671875	2	594.304818	1186.59508	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.538	1	15.538	15.038	16.038	0								0	0	0	0.026403	1	7211	7211		67.494	21.037	2				1794	346	1061	1105	2416	2416	259	9606
MKVQDQDLPNTPHSK	15	Oxidation (M)	_M(Oxidation (M))KVQDQDLPNTPHSK_	M(1)KVQDQDLPNTPHSK	M(110)KVQDQDLPNTPHSK	0	1	1	Q08554	Q08554	Q08554	DSC1	Desmocollin-1	MULTI-MSMS	DP1141_6	1	585.2901000976562	3	585.289437	1752.84648	0.85834	0.00050238	-0.32745	-0.00019165	0.53089	0.00031073	585.2892618841245	13.847	0.7289	13.847	13.404	14.133	0					16	8	4	0	0	0	0.0081317	1	3799	3799		108.66	81.714	1	962960			1795	358	1062	1106	2417	2417	261	9606
MLCDEEAQKRK	11	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))LCDEEAQKRK_	M(1)LCDEEAQKRK	M(50)LCDEEAQKRK	1	1	2	Q8N9Z0	Q8N9Z0	Q8N9Z0	ZNF610	Zinc finger protein 610	MSMS	DP1141_6	1	733.699951171875	2	733.342326	1464.6701	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.659	1	21.659	21.159	22.159	0								0	0	0	0.034607	1	15971	15971		50.04	13.723	1				1796	472	1063	1107	2418	2418	348	9606
MLGPEGGEGFVVK	13	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))LGPEGGEGFVVK_	M(1)LGPEGGEGFVVK	M(83)LGPEGGEGFVVK	1	1	0	P52597	P52597	P52597	HNRNPF	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed	MULTI-MSMS	DP1141_9	4	689.3372802734375	2	689.339578	1376.6646	0.17767	0.00012247	-1.4457	-0.00099656	-1.268	-0.00087409	689.3384166768134	20.422	0.40014	20.422	20.136	20.536	0					7	3	3	0	0	0	0.0050013	1	14619	14619		82.831	36.829	1	17752000			1797	266	1064	1108	2419	2419	220	9606
MLGPEGGEGFVVK	13	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))MLGPEGGEGFVVK_			1	0	0	P52597	P52597	P52597	HNRNPF	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed	MULTI-MSMS	DP1141_9	4	681.3350830078125	2	681.34212	1360.66969	-0.21416	-0.00014591	0.27959	0.0001905	0.065435	4.4584E-05	681.3423116048383	22.16	0.27518	22.16	21.93	22.205	0					6	2	3	0	0	0	0.00016214	2	17080	17080;17137		139.43	100.68	1	14329000			1798	266	1064	1109	2420;2421	2420		9606
MLQPCGPPADKPEEN	15	Oxidation (M)	_M(Oxidation (M))LQPCGPPADKPEEN_	M(1)LQPCGPPADKPEEN	M(170)LQPCGPPADKPEEN	0	1	1	Q9BWJ5	Q9BWJ5	Q9BWJ5	SF3B5	Splicing factor 3B subunit 5	MULTI-MSMS	DP1141_10	5	849.8768920898438	2	849.87673	1697.73891	0.098746	8.3922E-05	-0.359	-0.00030511	-0.26026	-0.00022119	849.8768513417124	15.24	0.75331	15.24	15.12	15.873	0					20	8	5	0	0	0	2.3056E-14	1	6855	6855		168.22	139.26	1	118620000			1799	543	1065	1110	2422	2422	389	9606
MLQPCGPPADKPEEN	15	Unmodified	_MLQPCGPPADKPEEN_			0	0	1	Q9BWJ5	Q9BWJ5	Q9BWJ5	SF3B5	Splicing factor 3B subunit 5	MULTI-MSMS	DP1141_10	5	842.8824462890625	2	841.879272	1681.74399	0.31464	0.00026489	0.16882	0.00014212	0.48346	0.00040701	841.8795254334401	16.016	0.39273	16.016	15.873	16.266	0					8	3	3	0	0	0	0.031707	2	8204	8194;8204		116.74	103.62	1	49462000			1800	543	1065	1111	2423;2424	2424		9606
MLQYCLQGLFHPAR	14	Oxidation (M)	_M(Oxidation (M))LQYCLQGLFHPAR_	M(1)LQYCLQGLFHPAR	M(100)LQYCLQGLFHPAR	0	1	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	583.9605102539062	3	583.956965	1748.84907	0.81918	0.00047837	-0.10462	-6.1094E-05	0.71456	0.00041727	584.2911802588484	20.17	0.70066	20.17	19.75	20.451	0					14	6	4	0	0	0	0.0017609	2	14144	14144;14346		104.59	69.329	1	43061000			1801	78	1066	1112	2425;2426	2425	69	9606
MLVSGAGDIK	10	Oxidation (M)	_M(Oxidation (M))LVSGAGDIK_	M(1)LVSGAGDIK	M(99)LVSGAGDIK	0	1	0	Q92526;P40227	Q92526	Q92526	CCT6B;CCT6A	T-complex protein 1 subunit zeta-2;T-complex protein 1 subunit zeta	MSMS	DP1141_9	4	503.74468994140625	2	503.765517	1005.51648	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.598	1	15.598	15.098	16.098	0								0	0	0	0.01399	1	6775	6775		99.136	35.988	1				1802	220	1067	1113	2427	2427	181	9606
MMNQQRTKMEIK	12	3 Oxidation (M)	_M(Oxidation (M))M(Oxidation (M))NQQRTKM(Oxidation (M))EIK_	M(1)M(1)NQQRTKM(1)EIK	M(50)M(50)NQQRTKM(50)EIK	0	3	2	Q9Y2R2	Q9Y2R2	Q9Y2R2	PTPN22	Tyrosine-protein phosphatase non-receptor type 22	MULTI-MSMS	DP1141_6	1	529.25537109375	3	529.254682	1584.74222	0.66437	0.00035162	0.64534	0.00034155	1.3097	0.00069317	529.2549260513725	17.374	0.301	17.374	17.204	17.505	0					8	2	4	0	0	0	0.021558	1	9428	9428		50.354	8.0368	1	6750700			1803	610	1068	1114	2428	2428	420;421;422	9606
MMYGVSPWGDSPIDFEDSAHVPCPR	25	2 Oxidation (M)	_M(Oxidation (M))M(Oxidation (M))YGVSPWGDSPIDFEDSAHVPCPR_	M(1)M(1)YGVSPWGDSPIDFEDSAHVPCPR	M(88)M(88)YGVSPWGDSPIDFEDSAHVPCPR	0	2	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	961.747802734375	3	961.412138	2881.21459	0.33432	0.00032142	0.054611	5.2504E-05	0.38893	0.00037392	962.0808605817365	20.812	0.56119	20.812	20.485	21.046	0					12	5	5	0	0	0	1.5113E-06	1	14718	14718		87.793	74.722	1	10619000			1804	367	1069	1115	2429	2429	278;279	9606
MMYGVSPWGDSPIDFEDSAHVPCPR	25	Oxidation (M)	_M(Oxidation (M))MYGVSPWGDSPIDFEDSAHVPCPR_	M(0.5)M(0.5)YGVSPWGDSPIDFEDSAHVPCPR	M(0)M(0)YGVSPWGDSPIDFEDSAHVPCPR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	956.7495727539062	3	956.0805	2865.21967	0.41776	0.00039941	0.4748	0.00045395	0.89256	0.00085336	956.4157930893433	21.121	0.25197	21.121	20.954	21.206	0					6	2	3	0	0	0	1.3141E-11	1	15262	15262		125.75	113.2	2	2108900			1805	367	1069	1116	2430	2430	278;279	9606
MNEVYTRLGEMNNAVR	16	2 Oxidation (M)	_M(Oxidation (M))NEVYTRLGEM(Oxidation (M))NNAVR_	M(1)NEVYTRLGEM(1)NNAVR	M(63)NEVYTRLGEM(63)NNAVR	0	2	1	Q8NHQ1	Q8NHQ1	Q8NHQ1	CEP70	Centrosomal protein of 70 kDa	MSMS	DP1141_8	3	964.9534912109375	2	964.951292	1927.88803	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.201	1	20.201	19.701	20.701	0								0	0	0	0.032437	1	14141	14141		62.528	16.764	1				1806	477	1070	1117	2431	2431	354;355	9606
MNQPGGAAAPQADGASAAGR	20	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))MNQPGGAAAPQADGASAAGR_			1	0	0	Q5T7W0	Q5T7W0	Q5T7W0	ZNF618	Zinc finger protein 618	MULTI-SECPEP	DP1141_6	1	614.6590576171875	3	613.951596	1838.83296	0.47135	0.00028939	-0.094989	-5.8319E-05	0.37636	0.00023107	613.9517588134827	15.663	0.79632	15.663	15.108	15.905	0					19	7	5	0	0	0	0.01873	1	6313	6313		50.392	18.107	1	26317000			1807	420	1071	1118	2432	2432		9606
MNVLADALK	9	Oxidation (M)	_M(Oxidation (M))NVLADALK_	M(1)NVLADALK	M(86)NVLADALK	0	1	0	P62244	P62244	P62244	RPS15A	40S ribosomal protein S15a	MSMS	DP1141_10	5	495.7721862792969	2	495.76806	989.521567	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.207	1	18.207	17.707	18.707	0								0	0	0	0.029466	1	11650	11650		85.862	22.443	1				1808	288	1072	1119	2433	2433	232	9606
MPGGPKPGGGPGLSTPGGHPKPPHR	25	Unmodified	_MPGGPKPGGGPGLSTPGGHPKPPHR_			0	0	2	P23246	P23246	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	MULTI-MSMS	DP1141_7	2	594.0446166992188	4	593.311652	2369.2175	0.52224	0.00030985	0.35529	0.0002108	0.87753	0.00052065	593.3122031701798	14.558	0.80078	14.558	14.309	15.109	0					12	7	3	0	0	0	0.017023	1	5255	5255		40.669	21.968	1	38398000			1809	181	1073	1120	2434	2434		9606
MPGGPKPGGGPGLSTPGGHPKPPHR	25	Unmodified	_MPGGPKPGGGPGLSTPGGHPKPPHR_			0	0	2	P23246	P23246	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	MULTI-MSMS	DP1141_8	3	593.31201171875	4	593.311652	2369.2175	0.27027	0.00016035	-0.0083671	-4.9643E-06	0.2619	0.00015539	593.5622576276218	14.584	0.49564	14.584	14.179	14.674	0					13	5	4	0	0	0	0.0043812	1	5307	5307		47.288	18.955	1	6664900			1810	181	1073	1120	2435	2435		9606
MPGGPKPGGGPGLSTPGGHPKPPHR	25	Oxidation (M)	_M(Oxidation (M))PGGPKPGGGPGLSTPGGHPKPPHR_	M(1)PGGPKPGGGPGLSTPGGHPKPPHR	M(88)PGGPKPGGGPGLSTPGGHPKPPHR	0	1	2	P23246	P23246	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	MULTI-MSMS	DP1141_8	3	597.312255859375	4	597.310381	2385.21242	0.079324	4.7381E-05	0.27316	0.00016316	0.35249	0.00021054	597.5610426775402	14.086	0.84925	14.086	13.66	14.509	0					20	10	4	0	0	0	4.4168E-06	2	4565	4565;4627		88	57.588	1	27920000			1811	181	1073	1121	2436;2437	2436	159	9606
MPGGPKPGGGPGLSTPGGHPKPPHR	25	Oxidation (M)	_M(Oxidation (M))PGGPKPGGGPGLSTPGGHPKPPHR_	M(1)PGGPKPGGGPGLSTPGGHPKPPHR	M(48)PGGPKPGGGPGLSTPGGHPKPPHR	0	1	2	P23246	P23246	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	MULTI-MSMS	DP1141_8	3	478.2502746582031	5	478.04976	2385.21242	0.15186	7.2596E-05	-0.19516	-9.3294E-05	-0.043296	-2.0698E-05	478.2502020001746	14.086	0.8146	14.086	13.453	14.268	0					13	10	2	0	0	0	0.0025096	1	4626	4626		47.822	27.382	1	29732000			1812	181	1073	1121	2438	2438	159	9606
MPLPAPSLSHQPPPAPR	17	Oxidation (M)	_M(Oxidation (M))PLPAPSLSHQPPPAPR_	M(1)PLPAPSLSHQPPPAPR	M(62)PLPAPSLSHQPPPAPR	0	1	0	P49750	P49750	P49750	YLPM1	YLP motif-containing protein 1	MULTI-MSMS	DP1141_8	3	603.988525390625	3	603.654051	1807.94032	0.040662	2.4546E-05	0.33436	0.00020184	0.37502	0.00022638	603.9884702238478	16.457	0.28613	16.457	16.276	16.562	0					4	2	2	0	0	0	0.011677	1	8440	8440		62.237	44.691	1	11948000			1813	250	1074	1122	2439	2439	203	9606
MPMRVPEEVTLR	12	Acetyl (Protein N-term),2 Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))PM(Oxidation (M))RVPEEVTLR_	M(1)PM(1)RVPEEVTLR	M(52)PM(52)RVPEEVTLR	1	2	1	F8W1W9	F8W1W9	F8W1W9	NPIPB9	Nuclear pore complex-interacting protein family member B9	MSMS	DP1141_7	2	766.3839721679688	2	766.383994	1530.75343	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.911	1	22.911	22.411	23.411	0								0	0	0	0.031491	1	18350	18350		52.482	22.09	1				1814	30	1075	1123	2440	2440	28;29	9606
MPWPFSESIKK	11	Oxidation (M)	_M(Oxidation (M))PWPFSESIKK_	M(1)PWPFSESIKK	M(78)PWPFSESIKK	0	1	1	Q96BY7	Q96BY7	Q96BY7	ATG2B	Autophagy-related protein 2 homolog B	MULTI-SECPEP	DP1141_7	2	683.5665893554688	2	683.347206	1364.67986	0.36454	0.00024911	-4.3458	-0.0029697	-3.9812	-0.0027206	683.3439790549711	15.595	0.50492	15.595	15.21	15.714	0					6	4	2	0	0	0	0.0095942	1	6881	6881		78.113	15.039	1	5156900			1815	503	1076	1124	2441	2441	362	9606
MQGQEAVLAMSSR	13	Oxidation (M)	_MQGQEAVLAM(Oxidation (M))SSR_	MQGQEAVLAM(1)SSR	M(-100)QGQEAVLAM(100)SSR	0	1	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	712.8458251953125	2	712.337043	1422.65953	0.56683	0.00040378	0.261	0.00018592	0.82784	0.0005897	712.3370611522905	15.955	0.30117	15.955	15.804	16.105	0					6	2	3	0	0	0	0.024864	1	6898	6898		111.52	80.956	2	12581000			1816	402	1077	1125	2442	2442	307;308	9606
MQGQEAVLAMSSR	13	2 Oxidation (M)	_M(Oxidation (M))QGQEAVLAM(Oxidation (M))SSR_	M(1)QGQEAVLAM(1)SSR	M(110)QGQEAVLAM(110)SSR	0	2	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_7	2	720.7008056640625	2	720.334501	1438.65445	-0.17028	-0.00012266	0.82382	0.00059342	0.65354	0.00047077	720.3350563455846	15.223	0.30025	15.223	15.009	15.309	0					4	2	2	0	0	0	0.0062798	1	6368	6368		112.43	65.634	1	26567000			1817	402	1077	1126	2443	2443	307;308	9606
MREIVHLQAGQCGNQIGAK	19	Unmodified	_MREIVHLQAGQCGNQIGAK_			0	0	1	P68371;P04350	P68371	P68371	TUBB4B;TUBB4A	Tubulin beta-4B chain;Tubulin beta-4A chain	MULTI-MSMS	DP1141_8	3	704.3609619140625	3	704.02633	2109.05716	0.31069	0.00021874	-0.1375	-9.6803E-05	0.17319	0.00012193	704.3607007636396	16.23	0.60068	16.23	15.776	16.376	0					12	5	5	0	0	0	0.00070112	1	8075	8075		122.01	0	1	99293000			1818	323	1078	1127	2444	2444		9606
MRPGVACSVSQAQK	14	Unmodified	_MRPGVACSVSQAQK_			0	0	1	P32969	P32969	P32969	RPL9	60S ribosomal protein L9	MULTI-MSMS	DP1141_10	5	507.2534484863281	3	506.922032	1517.74427	0.1923	9.7481E-05	-1.4851	-0.00075283	-1.2928	-0.00065535	506.9218188737211	14.372	0.38575	14.372	14.153	14.539	0					14	5	4	0	0	0	0.031621	1	5365	5365		88.224	59.864	1	13221000			1819	203	1079	1128	2445	2445		9606
MRPGVACSVSQAQK	14	Oxidation (M)	_M(Oxidation (M))RPGVACSVSQAQK_	M(1)RPGVACSVSQAQK	M(87)RPGVACSVSQAQK	0	1	1	P32969	P32969	P32969	RPL9	60S ribosomal protein L9	MSMS	DP1141_10	5	512.2536010742188	3	512.25367	1533.73918	NaN	NaN	NaN	NaN	NaN	NaN	NaN	13.744	1	13.744	13.244	14.244	0								0	0	0	0.015867	1	4425	4425		87.083	63.011	1				1820	203	1079	1129	2446	2446	172	9606
MRPNSNTPVNETATASDSK	19	Oxidation (M)	_M(Oxidation (M))RPNSNTPVNETATASDSK_	M(1)RPNSNTPVNETATASDSK	M(110)RPNSNTPVNETATASDSK	0	1	1	O15014	O15014	O15014	ZNF609	Zinc finger protein 609	MULTI-MSMS	DP1141_7	2	679.3167724609375	3	679.316492	2034.92765	0.43318	0.00029426	0.088847	6.0355E-05	0.52202	0.00035462	679.3164015518022	13.082	0.89607	13.082	12.724	13.62	0					17	8	4	0	0	0	1.404E-05	2	3209	3209;3325		110.56	86.51	1	1064600			1821	48	1080	1130	2447;2448	2447	40	9606
MSATFIGNSTAIQELFK	17	Oxidation (M)	_M(Oxidation (M))SATFIGNSTAIQELFK_	M(1)SATFIGNSTAIQELFK	M(280)SATFIGNSTAIQELFK	0	1	0	P68371;Q13885;Q9BVA1	P68371;Q13885	P68371	TUBB4B;TUBB2A;TUBB2B	Tubulin beta-4B chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_6	1	937.4727783203125	2	937.471851	1872.92915	0.48153	0.00045142	0.016293	1.5274E-05	0.49782	0.0004667	937.4719992238901	22.272	0.36393	22.272	22.001	22.365	0					6	5	2	0	0	0	0	1	16925	16925		284.92	43.082	1	9119600			1822	323;381	1081	1131	2449	2449	250	9606
MSATFIGNSTAIQELFK	17	Oxidation (M)	_M(Oxidation (M))SATFIGNSTAIQELFK_	M(1)SATFIGNSTAIQELFK	M(200)SATFIGNSTAIQELFK	0	1	0	P68371;Q13885;Q9BVA1	P68371;Q13885	P68371	TUBB4B;TUBB2A;TUBB2B	Tubulin beta-4B chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MSMS	DP1141_7	2	937.474853515625	2	937.471851	1872.92915	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.319	1	22.319	21.819	22.819	0								0	0	0	1.7265000000000002E-97	1	17454	17454		196.5	27.889	1				1823	323;381	1081	1131	2450	2450	250	9606
MSATFIGNSTAIQELFK	17	Oxidation (M)	_M(Oxidation (M))SATFIGNSTAIQELFK_	M(1)SATFIGNSTAIQELFK	M(220)SATFIGNSTAIQELFK	0	1	0	P68371;Q13885;Q9BVA1	P68371;Q13885	P68371	TUBB4B;TUBB2A;TUBB2B	Tubulin beta-4B chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_9	4	937.4722900390625	2	937.471851	1872.92915	0.61479	0.00057635	-0.20057	-0.00018803	0.41422	0.00038832	937.9731768831152	22.306	0.23526	22.306	22.119	22.354	0					8	2	4	0	0	0	2.5357999999999998E-104	2	17342	17342;17349		216.34	45.554	1	19714000			1824	323;381	1081	1131	2451;2452	2451	250	9606
MSAWAAASLSR	11	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))SAWAAASLSR_	M(1)SAWAAASLSR	M(54)SAWAAASLSR	1	1	0	Q9BSH4	Q9BSH4	Q9BSH4	TACO1	Translational activator of cytochrome c oxidase 1	MSMS	DP1141_6	1	604.7888793945312	2	604.790055	1207.56556	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.948	1	20.948	20.448	21.448	0								0	0	0	0.03558	1	14871	14871		53.775	27.67	1				1825	538	1082	1132	2453	2453	385	9606
MSGAFFMRRTFGGNK	15	2 Oxidation (M)	_M(Oxidation (M))SGAFFM(Oxidation (M))RRTFGGNK_	M(1)SGAFFM(1)RRTFGGNK	M(49)SGAFFM(49)RRTFGGNK	0	2	2	O15228	O15228	O15228	GNPAT	Dihydroxyacetone phosphate acyltransferase	MULTI-MSMS	DP1141_9	4	580.6119384765625	3	580.276586	1737.80793	0.28331	0.0001644	0.90204	0.00052343	1.1853	0.00068783	580.6118515215928	16.042	0.58541	16.042	15.573	16.158	0					12	5	4	0	0	0	0.025285	1	6751	6751		48.527	21.429	1	7010800			1826	51	1083	1133	2454	2454	44;45	9606
MSGEPIQTVESIR	13	Oxidation (M)	_M(Oxidation (M))SGEPIQTVESIR_	M(1)SGEPIQTVESIR	M(130)SGEPIQTVESIR	0	1	0	Q5VT52	Q5VT52	Q5VT52	RPRD2	Regulation of nuclear pre-mRNA domain-containing protein 2	MSMS	DP1141_7	2	731.9000244140625	2	731.863948	1461.71334	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.859	1	17.859	17.359	18.359	0								0	0	0	0.0080248	1	10680	10680		126.03	88.47	1				1827	424	1084	1134	2455	2455	321	9606
MSMKEVDEQMLNVQNK	16	3 Oxidation (M)	_M(Oxidation (M))SM(Oxidation (M))KEVDEQM(Oxidation (M))LNVQNK_	M(1)SM(1)KEVDEQM(1)LNVQNK	M(120)SM(120)KEVDEQM(120)LNVQNK	0	3	1	P07437;P68371;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB4B;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_10	5	657.8161010742188	3	657.965526	1970.87475	-0.47207	-0.00031061	0.82625	0.00054365	0.35419	0.00023304	658.3006352508492	14.843	0.34494	14.843	14.539	14.884	0					7	4	3	0	0	0	0.00040003	2	6067	6067;6116		122.33	104.62	1	11202000			1828	122;323;381	1085	1135	2456;2457	2456	107;114;115	9606
MSMKEVDEQMLNVQNK	16	3 Oxidation (M)	_M(Oxidation (M))SM(Oxidation (M))KEVDEQM(Oxidation (M))LNVQNK_	M(1)SM(1)KEVDEQM(1)LNVQNK	M(74)SM(74)KEVDEQM(74)LNVQNK	0	3	1	P07437;P68371;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB4B;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-SECPEP	DP1141_9	4	658.3201293945312	3	657.965526	1970.87475	1.1324	0.00074511	-0.66503	-0.00043757	0.46741	0.00030754	657.9649865518262	14.84	0.25321	14.84	14.634	14.887	0					4	2	2	0	0	0	0.007384	1	5504	5504		74.296	49.816	1	11896000			1829	122;323;381	1085	1135	2458	2458	107;114;115	9606
MSRSPDAK	8	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))MSRSPDAK_			1	0	1	O95628	O95628	O95628	CNOT4	CCR4-NOT transcription complex subunit 4	MULTI-SECPEP	DP1141_6	1	466.7690124511719	2	467.226559	932.438566	-0.018156	-8.4828E-06	-3.4801	-0.001626	-3.4982	-0.0016345	467.2251388606909	16.555	0.45174	16.555	16.205	16.657	0					7	4	2	0	0	0	0.016804	1	7879	7879		73.975	10.827	1	4214100			1830	93	1086	1136	2459	2459		9606
MSVQPTVSLGGFEITPPVVLR	21	Oxidation (M)	_M(Oxidation (M))SVQPTVSLGGFEITPPVVLR_	M(1)SVQPTVSLGGFEITPPVVLR	M(99)SVQPTVSLGGFEITPPVVLR	0	1	0	P06748	P06748	P06748	NPM1	Nucleophosmin	MULTI-MSMS	DP1141_9	4	748.743408203125	3	748.408323	2242.20314	0.61473	0.00046007	0.16586	0.00012413	0.78059	0.0005842	748.7429941542714	22.705	0.19732	22.705	22.582	22.779	0					8	2	4	0	0	0	3.452E-05	1	17996	17996		98.562	78.665	1	4946100			1831	120	1087	1137	2460	2460	105	9606
MTLDDFR	7	Oxidation (M)	_M(Oxidation (M))TLDDFR_	M(1)TLDDFR	M(82)TLDDFR	0	1	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_6	1	913.9873046875	1	913.408394	912.401117	-0.24522	-0.00022399	0.91645	0.00083709	0.67123	0.00061311	913.409457227817	17.053	0.31236	17.053	16.891	17.204	0					5	3	2	0	0	0	0.011322	2	8698	8698;8858		82.305	37.694	1	2604100		+	1832	19	1088	1138	2461;2462	2461	19	9606
MTLDDFR	7	Oxidation (M)	_M(Oxidation (M))TLDDFR_	M(1)TLDDFR	M(120)TLDDFR	0	1	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_7	2	457.2080383300781	2	457.207835	912.401117	0.70292	0.00032138	-0.38302	-0.00017512	0.3199	0.00014626	457.2076898251552	17.01	0.71165	17.01	16.738	17.45	0					15	7	5	0	0	0	0.00053071	1	9446	9446		124.89	92.532	1	172670000		+	1833	19	1088	1138	2463	2463	19	9606
MTLDDFR	7	Oxidation (M)	_M(Oxidation (M))TLDDFR_	M(1)TLDDFR	M(140)TLDDFR	0	1	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_8	3	457.2080078125	2	457.207835	912.401117	-0.10076	-4.607E-05	0.63549	0.00029055	0.53473	0.00024448	457.20810603925423	17.023	0.3453	17.023	16.828	17.173	0					6	3	2	0	0	0	1.1184E-07	1	9273	9273		138.48	97.559	1	25736000		+	1834	19	1088	1138	2464	2464	19	9606
MTLDDFR	7	Oxidation (M)	_M(Oxidation (M))TLDDFR_	M(1)TLDDFR	M(130)TLDDFR	0	1	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_9	4	457.20794677734375	2	457.207835	912.401117	-0.40205	-0.00018382	0.61704	0.00028211	0.21499	9.8294E-05	457.20810529654017	17.088	0.44116	17.088	16.896	17.338	0					7	4	2	0	0	0	9.1062E-05	1	9263	9263		128.38	93.277	1	78866000		+	1835	19	1088	1138	2465	2465	19	9606
MTPPIKDLLPR	11	Oxidation (M)	_M(Oxidation (M))TPPIKDLLPR_	M(1)TPPIKDLLPR	M(96)TPPIKDLLPR	0	1	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	432.916259765625	3	432.916324	1295.72714	0.39187	0.00016965	-0.25396	-0.00010994	0.13791	5.9703E-05	432.9162755545645	18.299	1.0008	18.299	17.649	18.65	0					31	9	5	0	0	0	0.0092444	1	11114	11114		96.113	75.651	1	218340000			1836	78	1089	1139	2466	2466	70	9606
MTPPIKDLLPR	11	Oxidation (M)	_M(Oxidation (M))TPPIKDLLPR_	M(1)TPPIKDLLPR	M(130)TPPIKDLLPR	0	1	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	648.8717041015625	2	648.870848	1295.72714	-0.13811	-8.9614E-05	1.0049	0.00065208	0.86683	0.00056246	648.8712925637716	18.36	0.90103	18.36	17.749	18.65	0					21	8	4	0	0	0	0.01897	2	11431	11341;11431		130.66	102.83	1	53176000			1837	78	1089	1139	2467;2468	2468	70	9606
MTPPIKDLLPR	11	Unmodified	_MTPPIKDLLPR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	427.5846862792969	3	427.584686	1279.73223	0.19271	8.24E-05	0.049118	2.1002E-05	0.24183	0.0001034	427.58467686685975	18.9	0.70076	18.9	18.449	19.15	0					14	6	3	0	0	0	0.025769	1	12399	12399		120.63	100.97	1	35168000			1838	78	1089	1140	2469	2469		9606
MTSASPEDQNAPVGCPK	17	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))TSASPEDQNAPVGCPK_	M(1)TSASPEDQNAPVGCPK	M(41)TSASPEDQNAPVGCPK	1	1	0	Q96N96	Q96N96	Q96N96	SPATA13	Spermatogenesis-associated protein 13	MSMS	DP1141_6	1	616.2715454101562	3	616.269714	1845.78731	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.167	1	20.167	19.667	20.667	0								0	0	0	0.035267	1	13666	13666		41.014	12.202	1				1839	517	1090	1141	2470	2470	365	9606
MTVPISITNPDLLR	14	Oxidation (M)	_M(Oxidation (M))TVPISITNPDLLR_	M(1)TVPISITNPDLLR	M(93)TVPISITNPDLLR	0	1	0	O00763	O00763	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	794.9078979492188	2	793.434541	1584.85453	0.064347	5.1055E-05	0.75606	0.00059988	0.8204	0.00065094	793.4353002598322	20.241	0.29255	20.241	19.998	20.291	0					6	2	3	0	0	0	0.03067	1	13735	13735		92.866	64.662	1	5290300			1840	40	1091	1142	2471	2471	36	9606
MVAAVACAQVPK	12	Oxidation (M)	_M(Oxidation (M))VAAVACAQVPK_	M(1)VAAVACAQVPK	M(99)VAAVACAQVPK	0	1	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_6	1	630.9819946289062	2	630.825583	1259.63661	0.74891	0.00047243	-0.55098	-0.00034757	0.19792	0.00012485	630.8253762690623	15.855	0.59636	15.855	15.408	16.005	0					9	5	3	0	0	0	0.032501	1	6810	6810		99.136	49.599	1	47760000			1841	567	1092	1143	2472	2472	406	9606
MVAAVACAQVPK	12	Oxidation (M)	_M(Oxidation (M))VAAVACAQVPK_	M(1)VAAVACAQVPK	M(120)VAAVACAQVPK	0	1	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	631.3270874023438	2	630.825583	1259.63661	0.38966	0.00024581	-0.89057	-0.0005618	-0.50091	-0.00031599	630.8254610855647	15.826	0.99728	15.826	15.472	16.469	0					24	9	4	0	0	0	0.024426	1	7271	7271		115.71	64.438	1	1168700000			1842	567	1092	1143	2473	2473	406	9606
MVAAVACAQVPK	12	Oxidation (M)	_M(Oxidation (M))VAAVACAQVPK_	M(1)VAAVACAQVPK	M(110)VAAVACAQVPK	0	1	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	630.8253173828125	2	630.825583	1259.63661	0.48073	0.00030326	-0.21235	-0.00013396	0.26838	0.0001693	630.825416910376	15.822	0.58541	15.822	15.573	16.158	0					7	5	2	0	0	0	0.02534	1	7232	7232		112.41	54.861	1	144560000			1843	567	1092	1143	2474	2474	406	9606
MVAAVACAQVPK	12	Unmodified	_MVAAVACAQVPK_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-SECPEP	DP1141_9	4	622.3176879882812	2	622.828126	1243.6417	0.19474	0.00012129	-0.93959	-0.0005852	-0.74485	-0.00046391	623.329918634989	16.643	0.2287	16.643	16.553	16.782	0					6	2	3	0	0	0	0.015672	1	8559	8559		110.87	42.501	1	11834000			1844	567	1092	1144	2475	2475		9606
MVGVGGGDVEDVTPR	15	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))MVGVGGGDVEDVTPR_			1	0	0	P09038	P09038	P09038	FGF2	Fibroblast growth factor 2	MULTI-MSMS	DP1141_6	1	765.3676147460938	2	765.366855	1528.71916	0.039767	3.0436E-05	0.60666	0.00046432	0.64643	0.00049476	765.3677575202433	20.339	0.48367	20.339	19.906	20.39	0					12	4	5	0	0	0	0.03333	1	13949	13949		48.998	6.7554	1	18430000			1845	128	1093	1145	2476	2476		9606
MVGVGGGDVEDVTPR	15	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))M(Oxidation (M))VGVGGGDVEDVTPR_	M(1)VGVGGGDVEDVTPR	M(53)VGVGGGDVEDVTPR	1	1	0	P09038	P09038	P09038	FGF2	Fibroblast growth factor 2	MULTI-SECPEP	DP1141_6	1	773.7257080078125	2	773.364312	1544.71407	0.088879	6.8736E-05	0.56879	0.00043989	0.65767	0.00050862	773.3647535977011	20.438	1.1486	20.438	19.806	20.954	0					14	11	2	0	0	0	0.016818	1	13485	13485		52.579	27.282	1	118540000			1846	128	1093	1146	2477	2477	122	9606
MVMETIEK	8	Unmodified	_MVMETIEK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	491.2500305175781	2	490.743196	979.471839	0.4617	0.00022658	0.051958	2.5498E-05	0.51366	0.00025207	490.74306389245436	16.566	0.32318	16.566	16.415	16.738	0					9	3	4	0	0	0	1.0237E-05	1	8541	8541		143.11	41.895	1	61300000			1847	78	1094	1147	2478	2478		9606
MVNDAEKFAEEDKK	14	Unmodified	_MVNDAEKFAEEDKK_			0	0	2	P11021	P11021	P11021	HSPA5	78 kDa glucose-regulated protein	MULTI-SECPEP	DP1141_8	3	414.88885498046875	4	414.200173	1652.77159	0.62516	0.00025894	-1.1011	-0.00045608	-0.47594	-0.00019713	414.45020143583423	15.188	0.29834	15.188	14.972	15.271	0					4	2	2	0	0	0	0.0037761	1	6193	6193		109.16	75.109	1	3128000			1848	139	1095	1148	2479	2479		9606
MVPAGMGAGLER	12	2 Oxidation (M)	_M(Oxidation (M))VPAGM(Oxidation (M))GAGLER_	M(1)VPAGM(1)GAGLER	M(76)VPAGM(76)GAGLER	0	2	0	P52272	P52272	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	MULTI-SECPEP	DP1141_8	3	610.8197021484375	2	610.79174	1219.56893	0.57951	0.00035396	-0.26168	-0.00015983	0.31783	0.00019413	610.7918454254152	14.832	0.69594	14.832	14.674	15.37	0					14	6	3	0	0	0	0.013147	1	5755	5755		76.282	45.67	1	16693000			1849	263	1096	1149	2480	2480	218;219	9606
MVQEAEKYKAEDEVQR	16	Oxidation (M)	_M(Oxidation (M))VQEAEKYKAEDEVQR_	M(1)VQEAEKYKAEDEVQR	M(70)VQEAEKYKAEDEVQR	0	1	2	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-MSMS	DP1141_10	5	656.9825439453125	3	656.982562	1967.92586	-0.50739	-0.00033335	0.39483	0.0002594	-0.11256	-7.3948E-05	656.9830313556329	14.372	0.25737	14.372	14.215	14.472	0					7	3	3	0	0	0	0.033739	1	5457	5457		70.26	31.748	1	13106000			1850	135	1097	1150	2481	2481	129	9606
MYVFGGWVPLVMDDVK	16	2 Oxidation (M)	_M(Oxidation (M))YVFGGWVPLVM(Oxidation (M))DDVK_	M(1)YVFGGWVPLVM(1)DDVK	M(82)YVFGGWVPLVM(82)DDVK	0	2	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-MSMS	DP1141_7	2	944.9566040039062	2	944.454616	1886.89468	0.45542	0.00043013	0.011967	1.1302E-05	0.46739	0.00044143	944.956497434431	22.858	0.17739	22.858	22.728	22.906	0					8	2	4	0	0	0	0.019394	1	18303	18303		81.676	60.819	1	7836100			1851	259	1098	1151	2482	2482	207;208	9606
NACDHLSGFNVCNR	14	Unmodified	_NACDHLSGFNVCNR_			0	0	0	Q9Y3B4	Q9Y3B4	Q9Y3B4	SF3B6	Splicing factor 3B subunit 6	MULTI-MSMS	DP1141_10	5	555.2406616210938	3	555.240312	1662.69911	0.41274	0.00022917	-0.53243	-0.00029563	-0.11969	-6.6455E-05	555.2403348883144	16.893	0.3902	16.893	16.797	17.187	0					18	5	5	0	0	0	1.9853E-14	1	9492	9492		164.92	134.79	1	599140000			1852	615	1099	1152	2483	2483		9606
NACDHLSGFNVCNR	14	Unmodified	_NACDHLSGFNVCNR_			0	0	0	Q9Y3B4	Q9Y3B4	Q9Y3B4	SF3B6	Splicing factor 3B subunit 6	MULTI-MSMS	DP1141_10	5	832.3574829101562	2	832.35683	1662.69911	-0.065786	-5.4757E-05	-0.045377	-3.777E-05	-0.11116	-9.2527E-05	832.3572041755789	16.893	0.20826	16.893	16.797	17.005	0					13	3	5	0	0	0	4.749499999999999E-280	2	9499	9499;9524		278.38	206.06	1	223440000			1853	615	1099	1152	2484;2485	2484		9606
NAHSATTWSGQYVGGAEAR	19	Unmodified	_NAHSATTWSGQYVGGAEAR_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MULTI-MSMS	DP1141_10	5	654.9734497070312	3	654.973277	1961.898	-0.35679	-0.00023369	0.42242	0.00027667	0.065628	4.2985E-05	655.307822813386	16.51	1.4216	16.51	16.166	17.588	0					40	17	5	0	0	0	2.1737E-170	5	8855	8760;8855;8875;9269;9951		205.98	172.68	1	13554000000		+	1854	29	1100	1153	2486;2487;2488;2489;2490	2487		
NAHSATTWSGQYVGGAEAR	19	Unmodified	_NAHSATTWSGQYVGGAEAR_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MULTI-MSMS	DP1141_10	5	981.9560546875	2	981.956277	1961.898	0.26269	0.00025795	-0.67925	-0.000667	-0.41657	-0.00040905	982.4569631879152	16.51	0.5307	16.51	16.266	16.797	0					25	6	6	0	0	0	0	2	8869	8869;8889		351.2	329.55	1	5204700000		+	1855	29	1100	1153	2491;2492	2491		
NAHSATTWSGQYVGGAEAR	19	Unmodified	_NAHSATTWSGQYVGGAEAR_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MULTI-SECPEP	DP1141_10	5	491.27178955078125	4	491.481777	1961.898	0.39125	0.00019229	-0.38972	-0.00019154	0.001528	7.5099E-07	491.4816402596904	16.51	0.22775	16.51	16.363	16.591	0					8	2	4	0	0	0	1.8377E-07	1	8870	8870		107.65	83.816	1	171530000		+	1856	29	1100	1153	2493	2493		
NAHSATTWSGQYVGGAEAR	19	Unmodified	_NAHSATTWSGQYVGGAEAR_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MULTI-MSMS	DP1141_6	1	981.9562377929688	2	981.956277	1961.898	-0.36909	-0.00036243	0.32194	0.00031613	-0.047159	-4.6308E-05	981.9566565881329	16.555	0.2519	16.555	16.405	16.657	0					4	2	2	0	0	0	0.012969	1	8042	8042		75.669	54.368	1	139220000		+	1857	29	1100	1153	2494	2494		
NAHSATTWSGQYVGGAEAR	19	Unmodified	_NAHSATTWSGQYVGGAEAR_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MULTI-MSMS	DP1141_9	4	655.33447265625	3	654.973277	1961.898	0.81861	0.00053617	-0.60539	-0.00039652	0.21321	0.00013965	655.3072526884731	16.508	0.53442	16.508	16.158	16.693	0					6	5	2	0	0	0	2.3152E-106	2	8395	8395;8448		174.87	152.44	1	118420000		+	1858	29	1100	1153	2495;2496	2495		
NALESYAFNMK	11	Unmodified	_NALESYAFNMK_			0	0	0	P0DMV8;P0DMV9;P34931	P0DMV8	P0DMV8	HSPA1A;HSPA1B;HSPA1L	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like	MULTI-MSMS	DP1141_8	3	644.3341064453125	2	644.305538	1286.59652	0.95917	0.000618	-0.090136	-5.8075E-05	0.86903	0.00055992	644.3055507384362	19.626	0.50144	19.626	19.275	19.777	0					7	4	3	0	0	0	3.9705E-30	1	13249	13249		175.91	152.59	1	384660000			1859	135	1101	1154	2497	2497		9606
NALESYAFNMK	11	Oxidation (M)	_NALESYAFNM(Oxidation (M))K_	NALESYAFNM(1)K	NALESYAFNM(160)K	0	1	0	P0DMV8;P0DMV9;P34931	P0DMV8	P0DMV8	HSPA1A;HSPA1B;HSPA1L	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like	MULTI-SECPEP	DP1141_8	3	652.0266723632812	2	652.302995	1302.59144	1.1839	0.00077229	-0.082446	-5.378E-05	1.1015	0.00071851	652.3029470534608	18.425	0.9003	18.425	18.175	19.075	0					18	8	4	0	0	0	4.8211E-08	1	11485	11485		158.76	133.18	1	411830000			1860	135	1101	1155	2498	2498	130	9606
NALTTLAGPLTPPVK	15	Unmodified	_NALTTLAGPLTPPVK_			0	0	0	Q9H3P2	Q9H3P2	Q9H3P2	NELFA	Negative elongation factor A	MULTI-MSMS	DP1141_8	3	746.7130737304688	2	746.940316	1491.86608	0.75444	0.00056352	0.48678	0.0003636	1.2412	0.00092712	746.9405534532916	20.427	0.60157	20.427	20.076	20.678	0					7	5	2	0	0	0	0.0023614	2	14344	14344;14413		132.03	78.431	1	8437200			1861	560	1102	1156	2499;2500	2499		9606
NAMTSAPSKDQVQLK	15	Oxidation (M)	_NAM(Oxidation (M))TSAPSKDQVQLK_	NAM(1)TSAPSKDQVQLK	NAM(91)TSAPSKDQVQLK	0	1	1	A3KN83	A3KN83	A3KN83	SBNO1	Protein strawberry notch homolog 1	MULTI-MSMS	DP1141_6	1	545.2491455078125	3	545.27865	1632.81412	-0.10546	-5.7505E-05	0.63172	0.00034446	0.52626	0.00028696	545.6133520973993	14.315	0.52275	14.315	13.886	14.409	0					6	5	2	0	0	0	0.0099151	1	4496	4496		90.861	52.092	1	1011300			1862	1	1103	1157	2501	2501	1	9606
NAQGIINPIEAK	12	Unmodified	_NAQGIINPIEAK_			0	0	0	Q9UBB9	Q9UBB9	Q9UBB9	TFIP11	Tuftelin-interacting protein 11	MSMS	DP1141_7	2	634.7935180664062	2	634.353877	1266.6932	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.673	1	17.673	17.173	18.173	0								0	0	0	0.020273	1	10377	10377		113.44	59.67	1				1863	586	1104	1158	2502	2502		9606
NAVPITPTLNR	11	Unmodified	_NAVPITPTLNR_			0	0	0	CON__P02663	CON__P02663	CON__P02663			MULTI-MSMS	DP1141_9	4	598.7881469726562	2	598.343312	1194.67207	0.087241	5.22E-05	0.95783	0.00057311	1.0451	0.00062531	598.3438291316653	17.288	0.29037	17.288	17.047	17.338	0					4	2	2	0	0	0	0.014691	1	9564	9564		86.67	52.417	1	13080000		+	1864	12	1105	1159	2503	2503		
NDLAVVDVR	9	Unmodified	_NDLAVVDVR_			0	0	0	P19338	P19338	P19338	NCL	Nucleolin	MULTI-MSMS	DP1141_10	5	501.2853088378906	2	500.774731	999.534909	-0.19955	-9.9931E-05	0.083652	4.1891E-05	-0.1159	-5.804E-05	500.7745787670521	17.538	0.40013	17.538	17.387	17.788	0					5	3	2	0	0	0	0.022396	1	10545	10545		82.75	24.521	1	6031700			1865	171	1106	1160	2504	2504		9606
NEPYQVVECAMR	12	Oxidation (M)	_NEPYQVVECAM(Oxidation (M))R_	NEPYQVVECAM(1)R	NEPYQVVECAM(52)R	0	1	0	Q96AE7	Q96AE7	Q96AE7	TTC17	Tetratricopeptide repeat protein 17	MULTI-MSMS	DP1141_8	3	504.5602111816406	3	504.558759	1510.65445	0.53351	0.00026919	2.1982	0.0011091	2.7317	0.0013783	504.5599336347246	17.424	0.40098	17.424	17.173	17.574	0					5	3	2	0	0	0	0.035152	1	10060	10060		51.979	15.979	1	26932000			1866	502	1107	1161	2505	2505	361	9606
NFDLTAIPCANHK	13	Unmodified	_NFDLTAIPCANHK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	500.9139404296875	3	500.913642	1499.7191	0.67196	0.0003366	-0.27881	-0.00013966	0.39315	0.00019694	500.913525346759	18.454	0.49965	18.454	18.205	18.705	0					10	4	3	0	0	0	0.01742	1	11038	11038		58.781	37.386	1	123290000			1867	367	1108	1162	2506	2506		9606
NFDLTAIPCANHK	13	Unmodified	_NFDLTAIPCANHK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	750.8688354492188	2	750.866825	1499.7191	0.23748	0.00017831	0.45306	0.00034018	0.69053	0.0005185	750.8674736798101	18.454	0.49965	18.454	18.205	18.705	0					8	4	3	0	0	0	0.0061085	1	11048	11048		95.483	59.819	1	69050000			1868	367	1108	1162	2507	2507		9606
NFGDQPDIR	9	Unmodified	_NFGDQPDIR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	531.7662963867188	2	531.254163	1060.49377	0.18625	9.8946E-05	0.1079	5.7322E-05	0.29415	0.00015627	531.2542064088407	16.555	0.41854	16.555	16.405	16.824	0					14	4	4	0	0	0	0.000734	2	7852	7852;8040		131.03	102.11	1	115550000			1869	402	1109	1163	2508;2509	2508		9606
NFGDQPDIR	9	Unmodified	_NFGDQPDIR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_7	2	531.2543334960938	2	531.254163	1060.49377	0.42244	0.00022443	-0.20229	-0.00010747	0.22015	0.00011696	531.2540406774312	16.567	0.51666	16.567	16.315	16.831	0					13	5	4	0	0	0	0.0040594	1	8618	8618		105.52	78.828	1	130540000			1870	402	1109	1163	2510	2510		9606
NFGDQPDIR	9	Unmodified	_NFGDQPDIR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_8	3	531.29833984375	2	531.254163	1060.49377	-0.20635	-0.00010963	0.078721	4.1821E-05	-0.12763	-6.7805E-05	531.254198884018	16.513	0.35479	16.513	16.376	16.731	0					6	3	2	0	0	0	0.0041905	1	8394	8394		106.36	72.806	1	24031000			1871	402	1109	1163	2511	2511		9606
NFYNEHEEITNLTPQQLIDLR	21	Unmodified	_NFYNEHEEITNLTPQQLIDLR_			0	0	0	Q86XP3	Q86XP3	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	MULTI-MSMS	DP1141_7	2	863.7682495117188	3	863.097753	2586.27143	0.62816	0.00054216	0.65641	0.00056654	1.2846	0.0011087	863.43252132918	21.3	0.49971	21.3	21.05	21.55	0					11	4	5	0	0	0	5.7162E-05	1	15991	15991		126.91	86.115	1	61336000			1872	460	1110	1164	2512	2512		9606
NGIAFMGPPSQAMWALGDK	19	2 Oxidation (M)	_NGIAFM(Oxidation (M))GPPSQAM(Oxidation (M))WALGDK_	NGIAFM(1)GPPSQAM(1)WALGDK	NGIAFM(110)GPPSQAM(110)WALGDK	0	2	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	1012.4762573242188	2	1011.97424	2021.93392	0.1777	0.00017983	0.39299	0.00039769	0.57069	0.00057752	1012.4759461005142	20.241	0.39493	20.241	20.09	20.485	0					6	3	2	0	0	0	1.5261E-05	1	13941	13941		111.64	81.08	1	49643000			1873	367	1111	1165	2513	2513	280;281	9606
NGIAFMGPPSQAMWALGDK	19	Oxidation (M)	_NGIAFM(Oxidation (M))GPPSQAMWALGDK_	NGIAFM(1)GPPSQAMWALGDK	NGIAFM(34)GPPSQAM(-34)WALGDK	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	1003.977783203125	2	1003.97678	2005.939	0.44443	0.0004462	-0.08108	-8.1403E-05	0.36335	0.0003648	1004.4784463100737	21.335	0.34422	21.335	21.126	21.47	0					10	3	4	0	0	0	0.0015507	1	15514	15514		123.63	95.395	2	30482000			1874	367	1111	1166	2514	2514	280;281	9606
NHEEEMLALR	10	Oxidation (M)	_NHEEEM(Oxidation (M))LALR_	NHEEEM(1)LALR	NHEEEM(160)LALR	0	1	0	CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8	CON__P08779	CON__P08779	KRT16	Keratin, type I cytoskeletal 16	MULTI-SECPEP	DP1141_9	4	628.8574829101562	2	629.298244	1256.58194	0.61472	0.00038684	-0.22365	-0.00014074	0.39107	0.0002461	629.2982245681195	15.353	0.49853	15.353	15.174	15.673	0					7	4	3	0	0	0	2.3021E-07	1	6375	6375		157.34	131.54	1	14727000		+	1875	16	1112	1167	2515	2515	13	9606
NHPGLLLMDTTFR	13	Oxidation (M)	_NHPGLLLM(Oxidation (M))DTTFR_	NHPGLLLM(1)DTTFR	NHPGLLLM(88)DTTFR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	510.77734375	3	510.929292	1529.76605	0.35855	0.00018319	-0.10584	-5.4078E-05	0.25271	0.00012912	510.9293082509124	18.654	0.30064	18.654	18.504	18.805	0					6	2	3	0	0	0	0.0028239	1	11281	11281		87.719	48.139	1	76933000			1876	142	1113	1168	2516	2516	144	9606
NHPGLLLMDTTFR	13	Oxidation (M)	_NHPGLLLM(Oxidation (M))DTTFR_	NHPGLLLM(1)DTTFR	NHPGLLLM(140)DTTFR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	511.2596130371094	3	510.929292	1529.76605	-0.099796	-5.0989E-05	0.16054	8.2027E-05	0.060748	3.1038E-05	510.9294535986667	18.6	0.70076	18.6	18.449	19.15	0					14	6	4	0	0	0	5.8963E-05	4	11992	11805;11992;12032;12046		144.28	84.442	1	376710000			1877	142	1113	1168	2517;2518;2519;2520	2518	144	9606
NHPGLLLMDTTFR	13	Oxidation (M)	_NHPGLLLM(Oxidation (M))DTTFR_	NHPGLLLM(1)DTTFR	NHPGLLLM(96)DTTFR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MSMS	DP1141_8	3	766.3375244140625	2	765.8903	1529.76605	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.61	1	18.61	18.11	19.11	0								0	0	0	0.01684	1	11745	11745		96.334	49.106	1				1878	142	1113	1168	2521	2521	144	9606
NHPGLLLMDTTFR	13	Oxidation (M)	_NHPGLLLM(Oxidation (M))DTTFR_	NHPGLLLM(1)DTTFR	NHPGLLLM(120)DTTFR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MSMS	DP1141_8	3	766.3627319335938	2	765.8903	1529.76605	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.64	1	18.64	18.14	19.14	0								0	0	0	0.0058731	1	11788	11788		118.23	65.144	1				1879	142	1113	1168	2522	2522	144	9606
NHPGLLLMDTTFR	13	Oxidation (M)	_NHPGLLLM(Oxidation (M))DTTFR_	NHPGLLLM(1)DTTFR	NHPGLLLM(59)DTTFR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-SECPEP	DP1141_9	4	510.2560119628906	3	510.929292	1529.76605	-0.091362	-4.6679E-05	-0.030302	-1.5482E-05	-0.12166	-6.2162E-05	510.92940676211833	18.687	0.29997	18.687	18.437	18.737	0					6	2	3	0	0	0	0.027328	1	11747	11747		59.116	34.152	1	6861800			1880	142	1113	1168	2523	2523	144	9606
NHPGLLLMDTTFR	13	Unmodified	_NHPGLLLMDTTFR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	757.9445190429688	2	757.892843	1513.77113	0.0070645	5.3541E-06	2.5307	0.001918	2.5378	0.0019233	757.8953575587116	20.252	0.48367	20.252	19.906	20.39	0					6	4	2	0	0	0	0.026268	1	13540	13540		76.927	48.723	1	3183800			1881	142	1113	1169	2524	2524		9606
NHPGLLLMDTTFR	13	Unmodified	_NHPGLLLMDTTFR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	505.7344055175781	3	505.597654	1513.77113	0.18526	9.3666E-05	-0.030168	-1.5253E-05	0.15509	7.8413E-05	505.59776611817745	20	0.30032	20	19.85	20.15	0					6	2	3	0	0	0	2.7100999999999997E-40	2	14004	14004;14180		184.87	123.66	1	292380000			1882	142	1113	1169	2525;2526	2525		9606
NHQGPLPPVPLHLR	14	Unmodified	_NHQGPLPPVPLHLR_			0	0	0	Q96S55	Q96S55	Q96S55	WRNIP1	ATPase WRNIP1	MULTI-SECPEP	DP1141_8	3	526.2288208007812	3	525.63532	1573.88413	0.16443	8.643E-05	0.47901	0.00025178	0.64344	0.00033821	525.6353357310751	17.486	0.40086	17.486	17.273	17.674	0					5	3	2	0	0	0	0.015895	1	9945	9945		62.732	30.255	1	13621000			1883	522	1114	1170	2527	2527		9606
NIETIINTFHQYSVK	15	Unmodified	_NIETIINTFHQYSVK_			0	0	0	P06702	P06702	P06702	S100A9	Protein S100-A9	MULTI-MSMS	DP1141_10	5	904.4208374023438	2	903.972876	1805.9312	0.54683	0.00049432	0.2327	0.00021036	0.77953	0.00070467	903.973097680284	21.409	0.48337	21.409	21.276	21.759	0					5	4	2	0	0	0	0.022564	1	16684	16684		94.547	51.25	1	94950000			1884	119	1115	1171	2528	2528		9606
NIIHGSDSVESAEK	14	Unmodified	_NIIHGSDSVESAEK_			0	0	0	P15531	P15531	P15531	NME1	Nucleoside diphosphate kinase A	MSMS	DP1141_10	5	495.90289306640625	3	495.910843	1484.7107	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.877	1	14.877	14.377	15.377	0								0	0	0	0.0051621	1	6145	6145		98.943	77.287	1				1885	154	1116	1172	2529	2529		9606
NIIVGFAR	8	Unmodified	_NIIVGFAR_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-SECPEP	DP1141_10	5	444.9190979003906	2	445.266345	888.518136	-0.015209	-6.7722E-06	0.30815	0.00013721	0.29294	0.00013044	445.2664245950721	18.724	0.48978	18.724	18.387	18.877	0					11	4	4	0	0	0	0.0092779	1	12569	12569		105.2	24.202	1	184420000			1886	111	1117	1173	2530	2530		9606
NIIVGFAR	8	Unmodified	_NIIVGFAR_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	445.7242126464844	2	445.266345	888.518136	0.29277	0.00013036	0.1563	6.9595E-05	0.44907	0.00019995	445.2663900443996	18.725	0.50065	18.725	18.475	18.976	0					8	4	3	0	0	0	1.2332E-05	1	11978	11978		138.07	62.764	1	582250000			1887	111	1117	1173	2531	2531		9606
NITYLPAGQSVLLQLPQ	17	Unmodified	_NITYLPAGQSVLLQLPQ_			0	0	0	P35232	P35232	P35232	PHB	Prohibitin	MULTI-MSMS	DP1141_10	5	928.5208740234375	2	928.019826	1854.0251	0.43616	0.00040476	-0.073768	-6.8458E-05	0.36239	0.0003363	928.5215533666142	23.519	0.25066	23.519	23.301	23.551	0					7	3	3	0	0	0	0.00017104	1	19707	19707		118.9	64.419	1	15264000			1888	206	1118	1174	2532	2532		9606
NIVEAAAVR	9	Unmodified	_NIVEAAAVR_			0	0	0	Q5JNZ5;P62854	Q5JNZ5	Q5JNZ5	RPS26P11;RPS26	Putative 40S ribosomal protein S26-like 1;40S ribosomal protein S26	MULTI-MSMS	DP1141_10	5	472.26080322265625	2	471.771991	941.529429	0.32086	0.00015137	-0.33938	-0.00016011	-0.018514	-8.7346E-06	471.77182179101095	16.116	0.48482	16.116	15.781	16.266	0					5	4	2	0	0	0	0.019603	1	8314	8314		84.743	39.408	1	27426000			1889	309	1119	1175	2533	2533		9606
NKFPGDSVVTGR	12	Unmodified	_NKFPGDSVVTGR_			0	0	1	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	638.835693359375	2	638.835851	1275.65715	0.52732	0.00033687	-0.11178	-7.1411E-05	0.41554	0.00026546	638.8357679947499	15.926	0.50083	15.926	15.675	16.176	0					11	4	3	0	0	0	0.020376	1	7449	7449		123.51	84.738	1	113410000			1890	111	1120	1176	2534	2534		9606
NKFPGDSVVTGR	12	Unmodified	_NKFPGDSVVTGR_			0	0	1	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	426.2263488769531	3	426.226326	1275.65715	0.028871	1.2306E-05	0.24444	0.00010419	0.27331	0.00011649	426.22641304640985	15.926	0.90596	15.926	15.37	16.276	0					16	8	3	0	0	0	0.016727	1	7559	7559		87.831	36.554	1	23616000			1891	111	1120	1176	2535	2535		9606
NKHPDEDAVEAEGHEVKR	18	Unmodified	_NKHPDEDAVEAEGHEVKR_			0	0	2	Q9NY27	Q9NY27	Q9NY27	PPP4R2	Serine/threonine-protein phosphatase 4 regulatory subunit 2	MULTI-MSMS	DP1141_8	3	412.80157470703125	5	412.801655	2058.97189	0.09396	3.8787E-05	-0.13067	-5.3941E-05	-0.036711	-1.5154E-05	412.80163048139707	13.765	0.44778	13.765	13.52	13.968	0					18	5	5	0	0	0	0.00065059	2	4106	4071;4106		120.59	99.053	1	11477000			1892	578	1121	1177	2536;2537	2537		9606
NKHPDEDAVEAEGHEVKR	18	Unmodified	_NKHPDEDAVEAEGHEVKR_			0	0	2	Q9NY27	Q9NY27	Q9NY27	PPP4R2	Serine/threonine-protein phosphatase 4 regulatory subunit 2	MULTI-MSMS	DP1141_8	3	516.0008544921875	4	515.75025	2058.97189	0.12396	6.3933E-05	-0.19047	-9.8233E-05	-0.066506	-3.4301E-05	516.0007785874794	13.765	0.3636	13.765	13.52	13.884	0					10	4	3	0	0	0	6.2296E-08	1	4107	4107		154.47	134.92	1	8540200			1893	578	1121	1177	2538	2538		9606
NKHPDEDAVEAEGHEVKR	18	Unmodified	_NKHPDEDAVEAEGHEVKR_			0	0	2	Q9NY27	Q9NY27	Q9NY27	PPP4R2	Serine/threonine-protein phosphatase 4 regulatory subunit 2	MULTI-MSMS	DP1141_9	4	515.7505493164062	4	515.75025	2058.97189	-0.013008	-6.709E-06	0.40062	0.00020662	0.38761	0.00019991	516.0013595399249	13.731	0.66197	13.731	13.391	14.053	0					14	9	3	0	0	0	5.9609E-05	2	3911	3911;3996		117.13	97.083	1	2925800			1894	578	1121	1177	2539;2540	2539		9606
NKHPDEDAVEAEGHEVKR	18	Unmodified	_NKHPDEDAVEAEGHEVKR_			0	0	2	Q9NY27	Q9NY27	Q9NY27	PPP4R2	Serine/threonine-protein phosphatase 4 regulatory subunit 2	MULTI-MSMS	DP1141_9	4	412.80181884765625	5	412.801655	2058.97189	0.11555	4.7699E-05	0.018347	7.5738E-06	0.1339	5.5272E-05	412.80169268034757	13.709	0.4026	13.709	13.474	13.877	0					18	5	5	0	0	0	0.0076506	2	3995	3955;3995		93.495	61.404	1	3623400			1895	578	1121	1177	2541;2542	2542		9606
NKLEGLEDALQKAK	14	Unmodified	_NKLEGLEDALQKAK_			0	0	2	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;P04259	CON__P02538;P04259	CON__P02538	KRT6A;KRT6C;KRT6B	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 6B	MULTI-MSMS	DP1141_9	4	519.6036376953125	3	519.626267	1555.85697	0.088094	4.5776E-05	0.099628	5.177E-05	0.18772	9.7546E-05	519.6263015725026	18.087	0.2994	18.087	17.837	18.137	0					6	2	3	0	0	0	0.021922	1	10747	10747		71.513	26.399	1	11418000		+	1896	10;101	1122	1178	2543	2543		9606
NKLNDLEDALQQAK	14	Unmodified	_NKLNDLEDALQQAK_			0	0	1	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_6	1	800.420654296875	2	800.420476	1598.8264	0.15225	0.00012187	0.39457	0.00031582	0.54682	0.00043769	800.4206666528613	19.355	0.30029	19.355	19.205	19.506	0					6	2	3	0	0	0	0.01237	1	12606	12606		130.44	84.029	1	21615000		+	1897	102	1123	1179	2544	2544		9606
NKLNDLEDALQQAKEDLAR	19	Unmodified	_NKLNDLEDALQQAKEDLAR_			0	0	2	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_10	5	728.6866455078125	3	728.713351	2183.11822	1.2093	0.00088122	-0.99492	-0.00072501	0.21437	0.00015621	728.7123256369322	21.509	0.28329	21.509	21.276	21.559	0					4	2	2	0	0	0	0.00056048	1	16680	16680		131.48	105.9	1	5468800		+	1898	102	1124	1180	2545	2545		9606
NKLNDLEDALQQAKEDLAR	19	Unmodified	_NKLNDLEDALQQAKEDLAR_			0	0	2	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_7	2	728.7135009765625	3	728.713351	2183.11822	0.39078	0.00028476	0.32373	0.0002359	0.7145	0.00052067	729.0477649798227	21.5	0.3997	21.5	21.25	21.65	0					9	3	3	0	0	0	0	1	16298	16298		268.6	233.85	1	107350000		+	1899	102	1124	1180	2546	2546		9606
NKLNDLEDALQQAKEDLAR	19	Unmodified	_NKLNDLEDALQQAKEDLAR_			0	0	2	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_8	3	728.7139892578125	3	728.713351	2183.11822	0.39936	0.00029102	0.47773	0.00034813	0.87709	0.00063915	728.7135734667465	21.529	0.40077	21.529	21.279	21.679	0					7	3	3	0	0	0	1.9316E-05	1	16134	16134		114.9	91.922	1	13029000		+	1900	102	1124	1180	2547	2547		9606
NKLNDLEEALQQAKEDLAR	19	Unmodified	_NKLNDLEEALQQAKEDLAR_			0	0	2	CON__P35908v2;CON__P35908;P35908	CON__P35908v2	CON__P35908v2	KRT2	Keratin, type II cytoskeletal 2 epidermal	MULTI-MSMS	DP1141_7	2	733.7201538085938	3	733.385235	2197.13387	0.50266	0.00036864	0.17762	0.00013027	0.68028	0.00049891	733.7198028577919	21.6	0.40002	21.6	21.45	21.85	0					5	3	2	0	0	0	0.022695	1	16579	16579		67.995	47.408	1	10164000		+	1901	20	1125	1181	2548	2548		9606
NKNPAPPIDAVEQILPTLVR	20	Unmodified	_NKNPAPPIDAVEQILPTLVR_			0	0	1	P52292	P52292	P52292	KPNA2	Importin subunit alpha-1	MULTI-MSMS	DP1141_8	3	729.083740234375	3	729.082827	2184.22665	0.45693	0.00033314	0.32754	0.00023881	0.78447	0.00057194	729.0830494904893	22.229	0.29991	22.229	21.979	22.279	0					6	2	3	0	0	0	0.014191	1	17162	17162		86.258	70.597	1	12973000			1902	264	1126	1182	2549	2549		9606
NKYEDEINKR	10	Unmodified	_NKYEDEINKR_			0	0	2	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;CON__Q8VED5;P05787;CON__P05787;CON__H-INV:HIT000016045;CON__P13647;P13647;CON__Q6IFZ6;P04259;P04264;CON__P04264	CON__P02538;CON__P13647;CON__Q6IFZ6;P04259;P04264	P04264	KRT6A;KRT6C;KRT8;KRT5;KRT6B;KRT1	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 8;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_10	5	436.88543701171875	3	436.889603	1307.64698	-0.046111	-2.0145E-05	0.37455	0.00016364	0.32844	0.00014349	436.8896498459781	14.183	0.2492	14.183	14.09	14.339	0					7	3	3	0	0	0	0.0059414	2	5047	5047;5147		113.93	84	1	4476600		+	1903	102;10;101;18;27	1127	1183	2550;2551	2550		9606
NKYEDEINKR	10	Unmodified	_NKYEDEINKR_			0	0	2	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;CON__Q8VED5;P05787;CON__P05787;CON__H-INV:HIT000016045;CON__P13647;P13647;CON__Q6IFZ6;P04259;P04264;CON__P04264	CON__P02538;CON__P13647;CON__Q6IFZ6;P04259;P04264	P04264	KRT6A;KRT6C;KRT8;KRT5;KRT6B;KRT1	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 8;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_6	1	436.88946533203125	3	436.889603	1307.64698	0.76146	0.00033268	-0.55658	-0.00024316	0.20488	8.9511E-05	436.88939689988626	14.262	0.54034	14.262	13.968	14.509	0					14	5	4	0	0	0	1.2024E-40	2	4409	4393;4409		194.94	150.98	1	35498000		+	1904	102;10;101;18;27	1127	1183	2552;2553	2553		9606
NKYEDEINKR	10	Unmodified	_NKYEDEINKR_			0	0	2	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;CON__Q8VED5;P05787;CON__P05787;CON__H-INV:HIT000016045;CON__P13647;P13647;CON__Q6IFZ6;P04259;P04264;CON__P04264	CON__P02538;CON__P13647;CON__Q6IFZ6;P04259;P04264	P04264	KRT6A;KRT6C;KRT8;KRT5;KRT6B;KRT1	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 8;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_7	2	436.885986328125	3	436.889603	1307.64698	0.6623	0.00028935	-0.34362	-0.00015013	0.31868	0.00013923	436.8894297792359	14.162	0.27384	14.162	14.035	14.309	0					6	2	3	0	0	0	2.0941E-14	3	4807	4767;4807;4924		170.47	133.79	1	16049000		+	1905	102;10;101;18;27	1127	1183	2554;2555;2556	2555		9606
NKYEDEINKR	10	Unmodified	_NKYEDEINKR_			0	0	2	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;CON__Q8VED5;P05787;CON__P05787;CON__H-INV:HIT000016045;CON__P13647;P13647;CON__Q6IFZ6;P04259;P04264;CON__P04264	CON__P02538;CON__P13647;CON__Q6IFZ6;P04259;P04264	P04264	KRT6A;KRT6C;KRT8;KRT5;KRT6B;KRT1	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 8;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 1	MSMS	DP1141_9	4	436.8897705078125	3	436.889603	1307.64698	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.281	1	14.281	13.781	14.781	0								0	0	0	0.0083432	1	4710	4710		114.89	91.668	1			+	1906	102;10;101;18;27	1127	1183	2557	2557		9606
NLDIERPTYTNLNR	14	Unmodified	_NLDIERPTYTNLNR_			0	0	1	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-SECPEP	DP1141_8	3	573.8037719726562	3	573.632192	1717.87475	0.026379	1.5132E-05	0.3551	0.0002037	0.38148	0.00021883	573.6324487273699	17.624	0.60087	17.624	17.273	17.874	0					8	5	2	0	0	0	0.00055002	1	10257	10257		138.24	101.95	1	831970000			1907	321;442;322	1128	1184	2558	2558		9606
NLDIERPTYTNLNR	14	Unmodified	_NLDIERPTYTNLNR_			0	0	1	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_9	4	573.6324462890625	3	573.632192	1717.87475	0.12798	7.3416E-05	0.52077	0.00029873	0.64875	0.00037215	573.6324860562618	17.688	0.49986	17.688	17.338	17.837	0					16	4	6	0	0	0	0.0059534	1	10248	10248		161.25	121.48	1	166490000			1908	321;442;322	1128	1184	2559	2559		9606
NLDLDSIIAEVK	12	Unmodified	_NLDLDSIIAEVK_			0	0	0	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;O95678;CON__O95678;CON__Q8VED5;CON__P13647;P13647;P04259;CON__P35908v2;CON__P35908;P35908;CON__Q5XKE5;Q5XKE5	CON__P02538;CON__P13647;P04259;CON__P35908v2	CON__P35908v2	KRT6A;KRT6C;KRT75;KRT5;KRT6B;KRT2;KRT79	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 75;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 2 epidermal;Keratin, type II cytoskeletal 79	MULTI-MSMS	DP1141_7	2	665.8372802734375	2	665.36665	1328.71875	0.27992	0.00018625	0.22472	0.00014952	0.50464	0.00033577	665.3667348083968	22.522	0.26249	22.522	22.4	22.663	0					4	2	2	0	0	0	1.5019E-05	1	17840	17840		150.15	100.44	1	23809000		+	1909	20;10;101;18	1129	1185	2560	2560		9606
NLDLDSIIAEVK	12	Unmodified	_NLDLDSIIAEVK_			0	0	0	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;O95678;CON__O95678;CON__Q8VED5;CON__P13647;P13647;P04259;CON__P35908v2;CON__P35908;P35908;CON__Q5XKE5;Q5XKE5	CON__P02538;CON__P13647;P04259;CON__P35908v2	CON__P35908v2	KRT6A;KRT6C;KRT75;KRT5;KRT6B;KRT2;KRT79	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 75;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 2 epidermal;Keratin, type II cytoskeletal 79	MULTI-MSMS	DP1141_8	3	665.3671264648438	2	665.36665	1328.71875	0.73566	0.00048948	0.83874	0.00055807	1.5744	0.0010476	665.3667093565956	22.636	0.69363	22.636	22.179	22.872	0					16	7	4	0	0	0	0.017753	1	17720	17720		82.831	46.274	1	11434000		+	1910	20;10;101;18	1129	1185	2561	2561		9606
NLDLDSIIAEVK	12	Unmodified	_NLDLDSIIAEVK_			0	0	0	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;O95678;CON__O95678;CON__Q8VED5;CON__P13647;P13647;P04259;CON__P35908v2;CON__P35908;P35908;CON__Q5XKE5;Q5XKE5	CON__P02538;CON__P13647;P04259;CON__P35908v2	CON__P35908v2	KRT6A;KRT6C;KRT75;KRT5;KRT6B;KRT2;KRT79	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 75;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 2 epidermal;Keratin, type II cytoskeletal 79	MULTI-MSMS	DP1141_9	4	665.3668823242188	2	665.36665	1328.71875	1.0607	0.00070577	-0.46504	-0.00030942	0.59568	0.00039635	665.3661760707023	22.543	0.50545	22.543	22.354	22.86	0					16	6	4	0	0	0	0.0028575	4	17801	17712;17788;17801;17804		134.84	83.719	1	78422000		+	1911	20;10;101;18	1129	1185	2562;2563;2564;2565	2564		9606
NLIQTLVSGIAPATR	15	Unmodified	_NLIQTLVSGIAPATR_			0	0	0	Q8WVB6	Q8WVB6	Q8WVB6	CHTF18	Chromosome transmission fidelity protein 18 homolog	MULTI-MSMS	DP1141_7	2	777.9558715820312	2	777.454122	1552.89369	0.67896	0.00052786	0.075741	5.8885E-05	0.7547	0.00058674	777.4541422325221	23.321	0.41585	23.321	23.065	23.481	0					8	5	2	0	0	0	0.0018584	2	19038	19038;19090		125.28	63.865	1	11145000			1912	484	1130	1186	2566;2567	2566		9606
NLNPHSTMDSILGALAPYAVLSSSNVR	27	Oxidation (M)	_NLNPHSTM(Oxidation (M))DSILGALAPYAVLSSSNVR_	NLNPHSTM(1)DSILGALAPYAVLSSSNVR	NLNPHSTM(150)DSILGALAPYAVLSSSNVR	0	1	0	P98175	P98175	P98175	RBM10	RNA-binding protein 10	MULTI-MSMS	DP1141_7	2	948.5310668945312	3	948.48339	2842.42834	0.54203	0.00051411	-0.1587	-0.00015053	0.38332	0.00036358	949.1520648143083	22.201	0.56895	22.201	21.75	22.319	0					15	5	5	0	0	0	3.6295E-15	4	17322	17220;17322;17393;17422		147.22	109.73	1	19183000			1913	335	1131	1187	2568;2569;2570;2571	2569	255	9606
NLPFDFTWK	9	Unmodified	_NLPFDFTWK_			0	0	0	P52272	P52272	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	MULTI-MSMS	DP1141_8	3	584.2955932617188	2	584.295299	1166.57605	0.33924	0.00019822	0.39213	0.00022912	0.73137	0.00042734	584.2953458765962	22.329	0.60871	22.329	22.179	22.788	0					12	6	3	0	0	0	0.014798	1	17440	17440		87.639	55.285	1	14705000			1914	263	1132	1188	2572	2572		9606
NLPLPPPPPPR	11	Unmodified	_NLPLPPPPPPR_			0	0	0	P61978	P61978	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	MULTI-MSMS	DP1141_10	5	597.8535766601562	2	597.853316	1193.69208	0.26555	0.00015876	0.61641	0.00036852	0.88196	0.00052728	597.853515225623	17.738	1.2889	17.738	17.488	18.777	0					26	12	3	0	0	0	0.0078471	2	11050	11050;11085		93.143	57.263	1	43514000			1915	284	1133	1189	2573;2574	2573		9606
NLPLPPPPPPR	11	Unmodified	_NLPLPPPPPPR_			0	0	0	P61978	P61978	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	MULTI-MSMS	DP1141_8	3	597.8538208007812	2	597.853316	1193.69208	0.48051	0.00028727	0.31375	0.00018758	0.79425	0.00047485	597.8534838319991	17.724	1.3019	17.724	17.574	18.876	0					26	12	3	0	0	0	0.0044334	1	10523	10523		122.18	69.239	1	94915000			1916	284	1133	1189	2575	2575		9606
NLPLPPPPPPR	11	Unmodified	_NLPLPPPPPPR_			0	0	0	P61978	P61978	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	MULTI-MSMS	DP1141_9	4	597.8541870117188	2	597.853316	1193.69208	0.047227	2.8235E-05	0.86079	0.00051463	0.90802	0.00054286	597.8536241396242	17.741	0.59947	17.741	17.537	18.137	0					11	5	3	0	0	0	0.0045488	1	10457	10457		104.44	63.555	1	8583000			1917	284	1133	1189	2576	2576		9606
NMDAIIVDSEK	11	Oxidation (M)	_NM(Oxidation (M))DAIIVDSEK_	NM(1)DAIIVDSEK	NM(98)DAIIVDSEK	0	1	0	Q14683	Q14683	Q14683	SMC1A	Structural maintenance of chromosomes protein 1A	MSMS	DP1141_7	2	626.0137329101562	2	625.800285	1249.58602	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.361	1	16.361	15.861	16.861	0								0	0	0	0.0086452	1	8223	8223		97.734	46.388	1				1918	389	1134	1190	2577	2577	300	9606
NMGGPYGGGNYGPGGSGGSGGYGGR	25	Oxidation (M)	_NM(Oxidation (M))GGPYGGGNYGPGGSGGSGGYGGR_	NM(1)GGPYGGGNYGPGGSGGSGGYGGR	NM(71)GGPYGGGNYGPGGSGGSGGYGGR	0	1	0	P22626	P22626	P22626	HNRNPA2B1	Heterogeneous nuclear ribonucleoproteins A2/B1	MULTI-MSMS	DP1141_9	4	1103.452880859375	2	1103.45377	2204.89299	-0.6402	-0.00070644	-0.21795	-0.00024049	-0.85815	-0.00094693	1103.4535279695103	16.508	0.43461	16.508	16.258	16.693	0					6	4	2	0	0	0	0.00058225	1	8470	8470		71.143	65.827	1	26543000			1919	179	1135	1191	2578	2578	157	9606
NMQDMVEDYR	10	2 Oxidation (M)	_NM(Oxidation (M))QDM(Oxidation (M))VEDYR_	NM(1)QDM(1)VEDYR	NM(81)QDM(81)VEDYR	0	2	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_10	5	666.763671875	2	666.763377	1331.5122	-0.13305	-8.8712E-05	0.55645	0.00037102	0.4234	0.00028231	666.7638443137124	15.415	0.34036	15.415	15.12	15.46	0					6	3	2	0	0	0	0.030027	1	6905	6905		80.916	56.927	1	9517900		+	1920	102	1136	1192	2579	2579	84;85	9606
NMQDMVEDYR	10	2 Oxidation (M)	_NM(Oxidation (M))QDM(Oxidation (M))VEDYR_	NM(1)QDM(1)VEDYR	NM(99)QDM(99)VEDYR	0	2	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_6	1	666.7637939453125	2	666.763377	1331.5122	0.2994	0.00019963	-0.0097641	-6.5103E-06	0.28964	0.00019312	666.7635452446323	15.358	0.40211	15.358	15.108	15.51	0					12	3	4	0	0	0	0.011488	2	5967	5967;5996		99.013	93.092	1	17160000		+	1921	102	1136	1192	2580;2581	2580	84;85	9606
NMQDMVEDYR	10	2 Oxidation (M)	_NM(Oxidation (M))QDM(Oxidation (M))VEDYR_	NM(1)QDM(1)VEDYR	NM(110)QDM(110)VEDYR	0	2	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_7	2	667.7661743164062	2	666.763377	1331.5122	-0.18553	-0.00012371	0.56235	0.00037495	0.37682	0.00025125	666.7640687679179	15.26	0.40227	15.26	15.109	15.512	0					11	3	4	0	0	0	0.0043871	2	6627	6605;6627		108.57	88.429	1	70416000		+	1922	102	1136	1192	2582;2583	2583	84;85	9606
NMQDMVEDYR	10	2 Oxidation (M)	_NM(Oxidation (M))QDM(Oxidation (M))VEDYR_	NM(1)QDM(1)VEDYR	NM(110)QDM(110)VEDYR	0	2	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_8	3	666.7637939453125	2	666.763377	1331.5122	0.81772	0.00054523	-0.28624	-0.00019085	0.53149	0.00035437	666.7632664894204	15.42	0.40026	15.42	15.072	15.472	0					7	3	3	0	0	0	0.0066281	1	6617	6617		113.66	104.96	1	34487000		+	1923	102	1136	1192	2584	2584	84;85	9606
NMQDMVEDYR	10	2 Oxidation (M)	_NM(Oxidation (M))QDM(Oxidation (M))VEDYR_	NM(1)QDM(1)VEDYR	NM(100)QDM(100)VEDYR	0	2	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_9	4	666.8046875	2	666.763377	1331.5122	1.1604	0.0007737	-1.0144	-0.0006764	0.14593	9.7303E-05	666.763053806053	15.419	0.59776	15.419	15.075	15.673	0					12	5	4	0	0	0	0.0046232	3	6336	6336;6398;6479		119.62	102.78	1	54979000		+	1924	102	1136	1192	2585;2586;2587	2585	84;85	9606
NMQDMVEDYR	10	Oxidation (M)	_NMQDM(Oxidation (M))VEDYR_	NMQDM(1)VEDYR	NM(-65)QDM(65)VEDYR	0	1	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_6	1	659.7682495117188	2	658.76592	1315.51729	0.079357	5.2278E-05	0.19722	0.00012992	0.27658	0.0001822	658.7663295551117	16.956	0.48038	16.956	16.824	17.304	0					11	5	4	0	0	0	0.018465	1	8747	8747		109.48	89.337	2	36265000		+	1925	102	1136	1193	2588	2588	84;85	9606
NMQDMVEDYR	10	Oxidation (M)	_NMQDM(Oxidation (M))VEDYR_	NMQDM(1)VEDYR	NM(-66)QDM(66)VEDYR	0	1	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-SECPEP	DP1141_8	3	659.347412109375	2	658.76592	1315.51729	0.66045	0.00043508	-0.44407	-0.00029254	0.21638	0.00014254	658.7658391530973	16.923	0.24507	16.923	16.828	17.073	0					6	2	3	0	0	0	0.0037615	1	9105	9105		113.71	95.034	2	13369000		+	1926	102	1136	1193	2589	2589	84;85	9606
NMQDMVEDYR	10	Oxidation (M)	_NMQDM(Oxidation (M))VEDYR_	NMQDM(1)VEDYR	NM(-73)QDM(73)VEDYR	0	1	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_9	4	658.8460083007812	2	658.76592	1315.51729	1.0011	0.00065948	-1.0578	-0.00069686	-0.05673	-3.7372E-05	658.7654236576418	17.088	0.28422	17.088	16.854	17.138	0					8	3	3	0	0	0	0.020594	1	9176	9176		110.87	91.11	2	67161000		+	1927	102	1136	1193	2590	2590	84;85	9606
NMQDMVEDYR	10	Unmodified	_NMQDMVEDYR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_9	4	650.980712890625	2	650.768462	1299.52237	0.83184	0.00054134	-0.2161	-0.00014063	0.61574	0.0004007	650.7683051110059	18.625	0.29997	18.625	18.437	18.737	0					4	2	2	0	0	0	6.686299999999999E-21	1	11768	11768		187.22	144.13	1	4197700		+	1928	102	1136	1194	2591	2591		9606
NMQDMVEDYRNK	12	2 Oxidation (M)	_NM(Oxidation (M))QDM(Oxidation (M))VEDYRNK_	NM(1)QDM(1)VEDYRNK	NM(59)QDM(59)VEDYRNK	0	2	1	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_6	1	525.498291015625	3	525.557307	1573.65009	0.13563	7.1279E-05	0.2275	0.00011956	0.36312	0.00019084	525.5573725301928	14.262	0.27606	14.262	14.133	14.409	0					4	2	2	0	0	0	0.032785	1	4410	4410		58.754	44.5	1	1161800		+	1929	102	1137	1195	2592	2592	84;85	9606
NMSVHLSPCFR	11	Oxidation (M)	_NM(Oxidation (M))SVHLSPCFR_	NM(1)SVHLSPCFR	NM(71)SVHLSPCFR	0	1	0	P62280	P62280	P62280	RPS11	40S ribosomal protein S11	MULTI-SECPEP	DP1141_10	5	455.2449035644531	3	455.213035	1362.61727	-0.11679	-5.3165E-05	0.1098	4.9984E-05	-0.0069883	-3.1812E-06	455.21311767369053	16.51	0.38283	16.51	16.266	16.649	0					10	4	3	0	0	0	0.020547	1	8939	8939		70.942	46.71	1	90957000			1930	295	1138	1196	2593	2593	235	9606
NMVPQQALVIR	11	Oxidation (M)	_NM(Oxidation (M))VPQQALVIR_	NM(1)VPQQALVIR	NM(130)VPQQALVIR	0	1	0	P05023;P13637;P50993;Q13733	P05023;P13637	P13637	ATP1A1;ATP1A3;ATP1A2;ATP1A4	Sodium/potassium-transporting ATPase subunit alpha-1;Sodium/potassium-transporting ATPase subunit alpha-3;Sodium/potassium-transporting ATPase subunit alpha-2;Sodium/potassium-transporting ATPase subunit alpha-4	MULTI-MSMS	DP1141_6	1	643.2922973632812	2	642.858272	1283.70199	0.70794	0.00045511	-0.27223	-0.000175	0.43571	0.0002801	642.8581224579602	17.455	0.30075	17.455	17.304	17.605	0					6	2	3	0	0	0	0.016517	1	9371	9371		125.31	61.781	1	22335000			1931	147;106	1139	1197	2594	2594	89	9606
NMVQTAVVPVK	11	Oxidation (M)	_NM(Oxidation (M))VQTAVVPVK_	NM(1)VQTAVVPVK	NM(190)VQTAVVPVK	0	1	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_10	5	601.33447265625	2	601.334098	1200.65364	0.536	0.00032231	-0.45055	-0.00027093	0.085446	5.1382E-05	601.3339189472267	15.826	0.35947	15.826	15.609	15.968	0					10	3	4	0	0	0	8.2522E-40	2	7693	7693;7708		186.41	141.96	1	138900000			1932	365	1140	1198	2595;2596	2595	264	9606
NMVQTAVVPVK	11	Oxidation (M)	_NM(Oxidation (M))VQTAVVPVK_	NM(1)VQTAVVPVK	NM(81)VQTAVVPVK	0	1	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MSMS	DP1141_7	2	601.3342895507812	2	601.334098	1200.65364	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.868	1	15.868	15.368	16.368	0								0	0	0	0.034465	1	7407	7407		80.688	25.966	1				1933	365	1140	1198	2597	2597	264	9606
NMVQTAVVPVK	11	Oxidation (M)	_NM(Oxidation (M))VQTAVVPVK_	NM(1)VQTAVVPVK	NM(180)VQTAVVPVK	0	1	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	601.334228515625	2	601.334098	1200.65364	0.32821	0.00019736	0.064869	3.9008E-05	0.39308	0.00023637	601.3342085367889	15.826	1.4982	15.826	15.575	17.073	0					19	15	2	0	0	0	1.0918E-29	1	7244	7244		179.1	137.67	1	1051199999.9999999			1934	365	1140	1198	2598	2598	264	9606
NMVQTAVVPVK	11	Oxidation (M)	_NM(Oxidation (M))VQTAVVPVK_	NM(1)VQTAVVPVK	NM(200)VQTAVVPVK	0	1	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	601.2838745117188	2	601.334098	1200.65364	-0.015324	-9.2148E-06	0.071834	4.3196E-05	0.05651	3.3981E-05	601.3342647690383	15.822	0.78535	15.822	15.573	16.358	0					16	7	5	0	0	0	2.0684E-65	2	7117	7117;7150		200.56	159.11	1	244760000			1935	365	1140	1198	2599;2600	2599	264	9606
NMVQTAVVPVK	11	Unmodified	_NMVQTAVVPVK_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_10	5	592.8539428710938	2	593.336641	1184.65873	0.22875	0.00013572	0.51622	0.00030629	0.74497	0.00044202	593.3368843153642	17.137	0.25388	17.137	16.933	17.187	0					4	2	2	0	0	0	0.0031579	1	9827	9827		125.68	86.429	1	32237000			1936	365	1140	1199	2601	2601		9606
NMVQTAVVPVK	11	Unmodified	_NMVQTAVVPVK_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-SECPEP	DP1141_6	1	593.2793579101562	2	593.336641	1184.65873	0.33626	0.00019952	-0.015946	-9.4616E-06	0.32031	0.00019005	593.3366394933898	17.153	0.26879	17.153	16.935	17.204	0					4	2	2	0	0	0	0.015972	1	8820	8820		139.43	91.776	1	21849000			1937	365	1140	1199	2602	2602		9606
NMVQTAVVPVK	11	Unmodified	_NMVQTAVVPVK_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	593.3369140625	2	593.336641	1184.65873	0.21805	0.00012938	0.081908	4.8599E-05	0.29996	0.00017798	593.336747786714	17.123	0.54215	17.123	16.731	17.273	0					8	5	3	0	0	0	0.020438	1	9428	9428		82.749	53.276	1	263110000			1938	365	1140	1199	2603	2603		9606
NMVQTAVVPVKK	12	Oxidation (M)	_NM(Oxidation (M))VQTAVVPVKK_	NM(1)VQTAVVPVKK	NM(150)VQTAVVPVKK	0	1	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_10	5	443.92352294921875	3	443.923479	1328.74861	-0.25777	-0.00011443	0.045989	2.0415E-05	-0.21178	-9.4013E-05	443.92369786260537	14.372	0.52068	14.372	14.215	14.736	0					25	7	6	0	0	0	1.7976E-06	2	5352	5352;5393		152.96	115.36	1	361100000			1939	365	1141	1200	2604;2605	2604	264	9606
NMVQTAVVPVKK	12	Oxidation (M)	_NM(Oxidation (M))VQTAVVPVKK_	NM(1)VQTAVVPVKK	NM(170)VQTAVVPVKK	0	1	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_10	5	665.3817749023438	2	665.38158	1328.74861	-0.23651	-0.00015737	0.15939	0.00010606	-0.077116	-5.1312E-05	665.3818123245429	14.372	0.25737	14.372	14.215	14.472	0					8	3	3	0	0	0	4.1207E-14	3	5389	5389;5428;5449		166.07	126.01	1	32569000			1940	365	1141	1200	2606;2607;2608	2606	264	9606
NMVQTAVVPVKK	12	Oxidation (M)	_NM(Oxidation (M))VQTAVVPVKK_	NM(1)VQTAVVPVKK	NM(160)VQTAVVPVKK	0	1	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_6	1	443.92376708984375	3	443.923479	1328.74861	0.46836	0.00020792	-0.55561	-0.00024665	-0.087246	-3.8731E-05	443.92346297282023	14.36	1.3776	14.36	14.133	15.51	0					30	13	6	0	0	0	1.1185E-09	2	4658	4658;4670		155.99	124.64	1	76649000			1941	365	1141	1200	2609;2610	2609	264	9606
NMVQTAVVPVKK	12	Oxidation (M)	_NM(Oxidation (M))VQTAVVPVKK_	NM(1)VQTAVVPVKK	NM(170)VQTAVVPVKK	0	1	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_6	1	665.382080078125	2	665.38158	1328.74861	0.24473	0.00016284	0.13983	9.3039E-05	0.38456	0.00025588	665.3817547234115	14.37	0.2936	14.37	14.215	14.509	0					8	2	4	0	0	0	1.4602E-20	1	4664	4664		169.65	121.69	1	7460200			1942	365	1141	1200	2611	2611	264	9606
NMVQTAVVPVKK	12	Oxidation (M)	_NM(Oxidation (M))VQTAVVPVKK_	NM(1)VQTAVVPVKK	NM(180)VQTAVVPVKK	0	1	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_7	2	666.3168334960938	2	665.38158	1328.74861	0.26605	0.00017702	0.81278	0.00054081	1.0788	0.00071783	665.3821734713069	14.358	0.29793	14.358	14.21	14.508	0					4	2	2	0	0	0	3.7316E-30	1	5060	5060		182.39	134.52	1	11231000			1943	365	1141	1200	2612	2612	264	9606
NMVQTAVVPVKK	12	Oxidation (M)	_NM(Oxidation (M))VQTAVVPVKK_	NM(1)VQTAVVPVKK	NM(94)VQTAVVPVKK	0	1	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_7	2	443.9237365722656	3	443.923479	1328.74861	0.5323	0.0002363	-0.13649	-6.059E-05	0.39581	0.00017571	443.92345430272167	14.358	0.4876	14.358	14.121	14.608	0					8	4	3	0	0	0	0.0021521	1	5211	5211		93.623	77.151	1	107190000			1944	365	1141	1200	2613	2613	264	9606
NMVQTAVVPVKK	12	Oxidation (M)	_NM(Oxidation (M))VQTAVVPVKK_	NM(1)VQTAVVPVKK	NM(160)VQTAVVPVKK	0	1	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	443.923583984375	3	443.923479	1328.74861	-0.049801	-2.2108E-05	-0.13196	-5.8582E-05	-0.18177	-8.069E-05	443.9236237958652	14.397	1.4661	14.397	14.109	15.575	0					42	15	6	0	0	0	1.1137E-09	3	5024	5024;5061;5482		156.01	116.23	1	2117299999.9999998			1945	365	1141	1200	2614;2615;2616	2614	264	9606
NMVQTAVVPVKK	12	Oxidation (M)	_NM(Oxidation (M))VQTAVVPVKK_	NM(1)VQTAVVPVKK	NM(170)VQTAVVPVKK	0	1	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	665.3818969726562	2	665.38158	1328.74861	0.48905	0.00032541	-0.2836	-0.0001887	0.20546	0.00013671	665.3813600228027	14.397	0.59354	14.397	14.179	14.772	0					14	6	3	0	0	0	6.180999999999999E-21	2	5052	5052;5082		173.24	139.86	1	245030000			1946	365	1141	1200	2617;2618	2617	264	9606
NMVQTAVVPVKK	12	Oxidation (M)	_NM(Oxidation (M))VQTAVVPVKK_	NM(1)VQTAVVPVKK	NM(160)VQTAVVPVKK	0	1	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	665.3819580078125	2	665.38158	1328.74861	1.1391	0.00075793	-0.60243	-0.00040084	0.53666	0.00035709	665.3812237934244	14.432	0.38696	14.432	14.247	14.634	0					10	4	4	0	0	0	6.2441E-14	3	4943	4833;4943;4956		164.68	116.81	1	26274000			1947	365	1141	1200	2619;2620;2621	2620	264	9606
NMVQTAVVPVKK	12	Oxidation (M)	_NM(Oxidation (M))VQTAVVPVKK_	NM(1)VQTAVVPVKK	NM(150)VQTAVVPVKK	0	1	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	443.9237060546875	3	443.923479	1328.74861	-0.09883	-4.3873E-05	0.1264	5.6113E-05	0.027573	1.224E-05	443.92376180569227	14.432	0.89709	14.432	14.178	15.075	0					31	10	6	0	0	0	7.8204E-06	3	4934	4925;4934;4945		147.58	118.67	1	281880000			1948	365	1141	1200	2622;2623;2624	2623	264	9606
NMVQTAVVPVKK	12	Unmodified	_NMVQTAVVPVKK_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_10	5	438.9261779785156	3	438.59184	1312.75369	-0.049779	-2.1833E-05	0.19287	8.4592E-05	0.14309	6.2759E-05	438.5919670545618	15.56	0.41356	15.56	15.368	15.781	0					9	4	3	0	0	0	0.0039255	1	7347	7347		87.719	74.762	1	142350000			1949	365	1141	1201	2625	2625		9606
NMVQTAVVPVKK	12	Unmodified	_NMVQTAVVPVKK_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-SECPEP	DP1141_6	1	437.8926086425781	3	438.59184	1312.75369	0.72572	0.00031829	-0.17201	-7.5443E-05	0.55371	0.00024285	438.59175059369176	15.563	0.4963	15.563	15.408	15.905	0					7	4	3	0	0	0	0.0075273	1	6244	6244		72.29	49.962	1	34404000			1950	365	1141	1201	2626	2626		9606
NMVQTAVVPVKK	12	Unmodified	_NMVQTAVVPVKK_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	658.8253784179688	2	657.384122	1312.75369	0.93715	0.00061607	-0.10329	-6.7899E-05	0.83387	0.00054817	657.3839808413068	15.625	0.50364	15.625	15.172	15.675	0					7	4	3	0	0	0	0.018034	1	6848	6848		140.11	111.9	1	102560000			1951	365	1141	1201	2627	2627		9606
NMVQTAVVPVKK	12	Unmodified	_NMVQTAVVPVKK_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	438.5920104980469	3	438.59184	1312.75369	0.18121	7.9475E-05	-0.070886	-3.109E-05	0.11032	4.8385E-05	438.59193674591495	15.625	0.60405	15.625	15.172	15.776	0					11	5	4	0	0	0	5.7418E-06	1	6930	6930		122.55	110.49	1	278400000			1952	365	1141	1201	2628	2628		9606
NMVQTAVVPVKK	12	Unmodified	_NMVQTAVVPVKK_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	438.5918884277344	3	438.59184	1312.75369	0.11829	5.1881E-05	0.040498	1.7762E-05	0.15879	6.9644E-05	438.59191663647374	15.623	0.49853	15.623	15.174	15.673	0					7	4	3	0	0	0	0.0040631	1	6841	6841		89.356	71.989	1	53227000			1953	365	1141	1201	2629	2629		9606
NNASTDYDLSDK	12	Unmodified	_NNASTDYDLSDK_			0	0	0	P39023	P39023	P39023	RPL3	60S ribosomal protein L3	MULTI-MSMS	DP1141_6	1	671.7919921875	2	671.791503	1341.56845	0.66625	0.00044758	1.0881	0.000731	1.7544	0.0011786	671.7916610698147	15.677	0.29349	15.677	15.51	15.804	0					6	2	3	0	0	0	0.013359	1	6600	6600		86.014	66.024	1	5147900			1954	219	1142	1202	2630	2630		9606
NNFAVGYR	8	Unmodified	_NNFAVGYR_			0	0	0	P45880	P45880	P45880	VDAC2	Voltage-dependent anion-selective channel protein 2	MULTI-MSMS	DP1141_9	4	470.7353210449219	2	470.735409	939.456264	0.1306	6.1479E-05	0.29483	0.00013879	0.42543	0.00020027	470.7354471161725	16.643	0.32355	16.643	16.458	16.782	0					6	3	2	0	0	0	0.00022212	1	8536	8536		128.82	58.548	1	30452000			1955	231	1143	1203	2631	2631		9606
NNTQVLINCR	10	Unmodified	_NNTQVLINCR_			0	0	0	P62316	P62316	P62316	SNRPD2	Small nuclear ribonucleoprotein Sm D2	MULTI-MSMS	DP1141_10	5	616.3434448242188	2	616.314229	1230.6139	-0.18165	-0.00011195	-0.87523	-0.00053942	-1.0569	-0.00065137	616.3133565820044	16.116	0.63321	16.116	15.533	16.166	0					8	6	2	0	0	0	1.0166E-13	1	8045	8045		166.68	125.65	1	35513000			1956	298	1144	1204	2632	2632		9606
NPDLCDFTIDHQSCSR	16	Unmodified	_NPDLCDFTIDHQSCSR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_10	5	982.445068359375	2	982.914906	1963.81526	-0.22435	-0.00022052	0.85403	0.00083944	0.62968	0.00061892	983.4173321703956	18.137	0.29973	18.137	17.987	18.287	0					4	2	2	0	0	0	2.7452E-15	2	11499	11499;11741		152.16	143.43	1	18473000			1957	365	1145	1205	2633;2634	2633		9606
NPDLCDFTIDHQSCSR	16	Unmodified	_NPDLCDFTIDHQSCSR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-SECPEP	DP1141_10	5	656.3618774414062	3	655.612363	1963.81526	-0.80977	-0.00053089	0.9473	0.00062106	0.13753	9.0167E-05	655.9474433779675	18.137	0.39954	18.137	17.987	18.387	0					11	3	4	0	0	0	0.00044607	1	11474	11474		111.88	103.63	1	87014000			1958	365	1145	1205	2635	2635		9606
NPDLCDFTIDHQSCSR	16	Unmodified	_NPDLCDFTIDHQSCSR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_6	1	982.9154663085938	2	982.914906	1963.81526	0.61047	0.00060004	-0.26317	-0.00025868	0.3473	0.00034137	982.9147954414902	18.155	0.39948	18.155	18.005	18.405	0					10	3	4	0	0	0	5.5416E-22	2	10695	10695;10717		172.57	151.2	1	25862000			1959	365	1145	1205	2636;2637	2636		9606
NPDLCDFTIDHQSCSR	16	Unmodified	_NPDLCDFTIDHQSCSR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-SECPEP	DP1141_6	1	656.3568725585938	3	655.612363	1963.81526	0.89988	0.00058997	-0.65505	-0.00042946	0.24483	0.00016051	655.9464712445247	18.155	0.79944	18.155	17.805	18.604	0					18	7	5	0	0	0	4.4026999999999996E-36	1	10561	10561		172.85	162.66	1	152870000			1960	365	1145	1205	2638	2638		9606
NPDLCDFTIDHQSCSR	16	Unmodified	_NPDLCDFTIDHQSCSR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_7	2	655.9468994140625	3	655.612363	1963.81526	-0.076283	-5.0012E-05	0.82648	0.00054185	0.75019	0.00049184	655.947073560192	18.199	0.60071	18.199	17.949	18.55	0					9	5	2	0	0	0	0.0015032	2	11246	11246;11410		107.74	88.66	1	64787000			1961	365	1145	1205	2639;2640	2639		9606
NPDLCDFTIDHQSCSR	16	Unmodified	_NPDLCDFTIDHQSCSR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_7	2	983.415771484375	2	982.914906	1963.81526	0.3654	0.00035916	-0.1289	-0.00012669	0.2365	0.00023246	983.4157387704429	18.158	0.50039	18.158	17.949	18.449	0					7	4	3	0	0	0	2.2077E-69	1	11321	11321		208.08	187.88	1	11635000			1962	365	1145	1205	2641	2641		9606
NPDLCDFTIDHQSCSR	16	Unmodified	_NPDLCDFTIDHQSCSR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	655.6127319335938	3	655.612363	1963.81526	1.0531	0.00069043	-0.74903	-0.00049107	0.30407	0.00019935	655.6125259228277	18.125	1.1019	18.125	17.774	18.876	0					35	10	7	0	0	0	3.4198E-55	2	10895	10895;11152		194.77	177.2	1	2389800000			1963	365	1145	1205	2642;2643	2642		9606
NPDLCDFTIDHQSCSR	16	Unmodified	_NPDLCDFTIDHQSCSR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	655.6127319335938	3	655.612363	1963.81526	0.87895	0.00057625	-0.75346	-0.00049398	0.12549	8.2274E-05	655.9463701127117	18.186	0.99956	18.186	17.738	18.737	0					31	9	6	0	0	0	1.943E-69	2	11043	11043;11051		200.55	184.12	1	343630000			1964	365	1145	1205	2644;2645	2644		9606
NPDLCDFTIDHQSCSR	16	Unmodified	_NPDLCDFTIDHQSCSR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	983.4163208007812	2	982.914906	1963.81526	0.33806	0.00033228	-0.22496	-0.00022111	0.1131	0.00011117	982.9148652249833	18.187	0.69958	18.187	17.738	18.437	0					16	6	4	0	0	0	0	2	11057	11057;11206		299.2	289.42	1	64144000			1965	365	1145	1205	2646;2647	2646		9606
NPPNQSSNERPPSLLVIETK	20	Unmodified	_NPPNQSSNERPPSLLVIETK_			0	0	1	O15042	O15042	O15042	U2SURP	U2 snRNP-associated SURP motif-containing protein	MULTI-MSMS	DP1141_7	2	741.0598754882812	3	740.72548	2219.15461	0.46731	0.00034615	-0.16317	-0.00012086	0.30415	0.00022529	741.0596099878774	18.099	0.4002	18.099	17.949	18.349	0					11	3	4	0	0	0	0.014619	1	11235	11235		92.236	74.452	1	108760000			1966	49	1146	1206	2648	2648		9606
NPSGINDDYGQLK	13	Unmodified	_NPSGINDDYGQLK_			0	0	0	O60934	O60934	O60934	NBN	Nibrin	MULTI-SECPEP	DP1141_9	4	710.3779907226562	2	710.838788	1419.66302	0.71122	0.00050556	-3.3704	-0.0023958	-2.6592	-0.0018903	711.3391158914765	16.997	0.19361	16.997	16.854	17.047	0					6	2	3	0	0	0	0.012706	1	9136	9136		97.813	54.301	1	9183700			1967	68	1147	1207	2649	2649		9606
NQLTSNPENTVFDAKR	16	Unmodified	_NQLTSNPENTVFDAKR_			0	0	1	P11021	P11021	P11021	HSPA5	78 kDa glucose-regulated protein	MSMS	DP1141_8	3	611.8121337890625	3	611.974506	1832.90169	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.093	1	17.093	16.593	17.593	0								0	0	0	0.0014429	1	9336	9336		108.36	85.502	1				1968	139	1148	1208	2650	2650		9606
NQTGDVACGSYTLWEEDLK	19	Unmodified	_NQTGDVACGSYTLWEEDLK_			0	0	0	Q9H227	Q9H227	Q9H227	GBA3	Cytosolic beta-glucosidase	MSMS	DP1141_7	2	729.3273315429688	3	729.328397	2184.96336	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.927	1	14.927	14.427	15.427	0								0	0	0	0.012314	1	5926	5926		49.343	22.019	1				1969	557	1149	1209	2651	2651		9606
NQVALNPQNTVFDAK	15	Unmodified	_NQVALNPQNTVFDAK_			0	0	0	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-MSMS	DP1141_10	5	829.929443359375	2	829.928468	1657.84238	0.22083	0.00018327	0.30248	0.00025104	0.52331	0.00043431	829.9288746013588	18.537	0.49438	18.537	18.187	18.682	0					10	4	4	0	0	0	0.0031334	1	12229	12229		158.42	122.42	1	119260000			1970	135	1150	1210	2652	2652		9606
NQVALNPQNTVFDAK	15	Unmodified	_NQVALNPQNTVFDAK_			0	0	0	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-MSMS	DP1141_6	1	830.3892822265625	2	829.928468	1657.84238	1.1507	0.00095498	-0.64769	-0.00053754	0.50299	0.00041744	830.4295092947834	18.555	0.29951	18.555	18.305	18.604	0					4	2	2	0	0	0	4.2989E-05	1	11073	11073		168.83	132.26	1	15720000			1971	135	1150	1210	2653	2653		9606
NQVALNPQNTVFDAK	15	Unmodified	_NQVALNPQNTVFDAK_			0	0	0	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-MSMS	DP1141_8	3	829.9296264648438	2	829.928468	1657.84238	0.95928	0.00079613	-0.33586	-0.00027874	0.62341	0.00051739	829.928347652964	18.525	0.70071	18.525	18.175	18.876	0					14	6	4	0	0	0	7.5851E-56	3	11622	11391;11528;11622		210.95	168.48	1	1445100000			1972	135	1150	1210	2654;2655;2656	2656		9606
NQVALNPQNTVFDAK	15	Unmodified	_NQVALNPQNTVFDAK_			0	0	0	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-SECPEP	DP1141_9	4	829.3997192382812	2	829.928468	1657.84238	-0.29551	-0.00024525	0.39968	0.00033171	0.10417	8.6451E-05	829.9289548112697	18.487	0.40002	18.487	18.237	18.637	0					5	3	2	0	0	0	0.019461	1	11416	11416		105.36	55.075	1	65913000			1973	135	1150	1210	2657	2657		9606
NQVALNPQNTVFDAKR	16	Unmodified	_NQVALNPQNTVFDAKR_			0	0	1	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MSMS	DP1141_10	5	605.2953491210938	3	605.655108	1813.94349	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.509	1	17.509	17.009	18.009	0								0	0	0	1.1277E-10	1	10509	10509		141	105.29	1				1974	135	1151	1211	2658	2658		9606
NQVALNPQNTVFDAKR	16	Unmodified	_NQVALNPQNTVFDAKR_			0	0	1	P0DMV8;P0DMV9	P0DMV8	P0DMV8	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	MULTI-SECPEP	DP1141_8	3	606.0385131835938	3	605.655108	1813.94349	0.44106	0.00026713	-0.036094	-2.1861E-05	0.40496	0.00024527	605.6552987547932	17.424	0.40098	17.424	17.173	17.574	0					15	3	5	0	0	0	4.7272E-36	1	9915	9915		178.67	139.69	1	60688000			1975	135	1151	1211	2659	2659		9606
NQVAMNPTNTVFDAK	15	Oxidation (M)	_NQVAM(Oxidation (M))NPTNTVFDAK_	NQVAM(1)NPTNTVFDAK	NQVAM(120)NPTNTVFDAK	0	1	0	P11142	P11142	P11142	HSPA8	Heat shock cognate 71 kDa protein	MULTI-MSMS	DP1141_10	5	834.8633422851562	2	833.398686	1664.78282	-0.19677	-0.00016399	0.40476	0.00033733	0.20799	0.00017334	833.9003433722819	17.137	0.28207	17.137	17.005	17.287	0					6	2	3	0	0	0	0.013538	1	10015	10015		121.68	94.791	1	10168000			1976	140	1152	1212	2660	2660	135	9606
NQVAMNPTNTVFDAK	15	Oxidation (M)	_NQVAM(Oxidation (M))NPTNTVFDAK_	NQVAM(1)NPTNTVFDAK	NQVAM(180)NPTNTVFDAK	0	1	0	P11142	P11142	P11142	HSPA8	Heat shock cognate 71 kDa protein	MULTI-MSMS	DP1141_8	3	833.9058227539062	2	833.398686	1664.78282	0.66743	0.00055624	0.41385	0.0003449	1.0813	0.00090114	833.3991261917452	17.123	0.54606	17.123	16.828	17.374	0					14	5	4	0	0	0	6.3031E-30	2	9470	9470;9558		179.35	142.37	1	65979000			1977	140	1152	1212	2661;2662	2661	135	9606
NQVAMNPTNTVFDAK	15	Oxidation (M)	_NQVAM(Oxidation (M))NPTNTVFDAK_	NQVAM(1)NPTNTVFDAK	NQVAM(150)NPTNTVFDAK	0	1	0	P11142	P11142	P11142	HSPA8	Heat shock cognate 71 kDa protein	MULTI-MSMS	DP1141_9	4	833.9053955078125	2	833.398686	1664.78282	-0.19617	-0.00016348	3.9716	0.0033099	3.7754	0.0031464	833.4017999984068	17.129	0.2812	17.129	16.957	17.238	0					8	2	4	0	0	0	0.0002174	1	9461	9461		148.13	119.17	1	19461000			1978	140	1152	1212	2663	2663	135	9606
NREEEWDPEYTPK	13	Unmodified	_NREEEWDPEYTPK_			0	0	1	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_7	2	846.8793334960938	2	846.878641	1691.74273	0.65869	0.00055783	-0.060414	-5.1163E-05	0.59828	0.00050667	846.878419823009	17.099	0.25668	17.099	16.892	17.149	0					6	2	3	0	0	0	0.0036361	1	9476	9476		139.31	108.12	1	37236000			1979	612	1153	1213	2664	2664		9606
NRPLSDEELDAMFPEGYK	18	Oxidation (M)	_NRPLSDEELDAM(Oxidation (M))FPEGYK_	NRPLSDEELDAM(1)FPEGYK	NRPLSDEELDAM(130)FPEGYK	0	1	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	1064.490478515625	2	1063.98859	2125.96263	0.21573	0.00022953	-0.064086	-6.8186E-05	0.15164	0.00016134	1064.4899974272846	18.6	0.30019	18.6	18.449	18.75	0					6	2	3	0	0	0	0.01139	1	12039	12039		128.73	106.41	1	80958000			1980	78	1154	1214	2665	2665	71	9606
NRPLSDEELDAMFPEGYK	18	Oxidation (M)	_NRPLSDEELDAM(Oxidation (M))FPEGYK_	NRPLSDEELDAM(1)FPEGYK	NRPLSDEELDAM(120)FPEGYK	0	1	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MSMS	DP1141_7	2	709.6619873046875	3	709.661488	2125.96263	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.702	1	18.702	18.202	19.202	0								0	0	0	0.0015373	1	12033	12033		122.97	88.877	1				1981	78	1154	1214	2666	2666	71	9606
NRPLSDEELDAMFPEGYK	18	Oxidation (M)	_NRPLSDEELDAM(Oxidation (M))FPEGYK_	NRPLSDEELDAM(1)FPEGYK	NRPLSDEELDAM(120)FPEGYK	0	1	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	709.9962158203125	3	709.661488	2125.96263	0.65832	0.00046718	-0.065421	-4.6427E-05	0.59289	0.00042075	709.9953719323693	18.625	0.70045	18.625	18.075	18.775	0					12	6	4	0	0	0	0.00018189	1	11814	11814		115.56	86.928	1	30696000			1982	78	1154	1214	2667	2667	71	9606
NRPLSDEELDAMFPEGYK	18	Unmodified	_NRPLSDEELDAMFPEGYK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	705.3616333007812	3	704.32985	2109.96772	0.9583	0.00067496	-0.66369	-0.00046746	0.29461	0.0002075	704.6638629499837	20.1	0.60064	20.1	19.75	20.351	0					14	5	5	0	0	0	0.00055498	2	14189	14189;14219		127.37	106.01	1	152590000			1983	78	1154	1215	2668;2669	2668		9606
NRPLSDEELDAMFPEGYK	18	Unmodified	_NRPLSDEELDAMFPEGYK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	1055.9918212890625	2	1055.99114	2109.96772	0.5446	0.0005751	-0.1774	-0.00018734	0.3672	0.00038776	1056.4922921705618	20.1	0.40048	20.1	19.85	20.251	0					5	3	2	0	0	0	4.4522E-09	1	14257	14257		144.4	103.02	1	55773000			1984	78	1154	1215	2670	2670		9606
NRWDETPKTER	11	Unmodified	_NRWDETPKTER_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	477.2375793457031	3	477.904023	1430.69024	0.78374	0.00037455	0.1183	5.6536E-05	0.90204	0.00043109	478.23829437888355	14.152	0.4473	14.152	13.861	14.309	0					8	4	2	0	0	0	0.018164	1	4777	4777		81.676	49.052	1	24430000			1985	78	1155	1216	2671	2671		9606
NSDEADLVPAK	11	Unmodified	_NSDEADLVPAK_			0	0	0	P83916	P83916	P83916	CBX1	Chromobox protein homolog 1	MULTI-MSMS	DP1141_10	5	579.8591918945312	2	579.785492	1157.55643	0.43614	0.00025287	-0.37251	-0.00021597	0.063631	3.6892E-05	579.7852304524603	15.826	0.43533	15.826	15.533	15.968	0					6	4	2	0	0	0	0.0055648	1	7559	7559		114.5	70.845	1	31587000			1986	331	1156	1217	2672	2672		9606
NSMHVDMADEAYSIGPAPSQQSYLSMEK	28	Oxidation (M)	_NSMHVDMADEAYSIGPAPSQQSYLSM(Oxidation (M))EK_	NSMHVDMADEAYSIGPAPSQQSYLSM(1)EK	NSM(-110)HVDM(-100)ADEAYSIGPAPSQQSYLSM(100)EK	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	1035.123046875	3	1034.78782	3101.34164	0.85656	0.00088635	-0.40929	-0.00042353	0.44727	0.00046283	1035.121516855547	19.125	0.60007	19.125	18.976	19.576	0					8	5	2	0	0	0	2.4346E-13	2	12733	12520;12733		128.91	117.14	3	17368000			1987	521	1157	1218	2673;2674	2674	374	9606
NSNPDEIEIDFETLKPSTLR	20	Unmodified	_NSNPDEIEIDFETLKPSTLR_			0	0	1	O60885	O60885	O60885	BRD4	Bromodomain-containing protein 4	MULTI-SECPEP	DP1141_7	2	772.7320556640625	3	773.388533	2317.14377	0.9646	0.00074601	0.63732	0.00049289	1.6019	0.0012389	773.7231005127452	20.8	0.29979	20.8	20.651	20.95	0					4	2	2	0	0	0	7.934E-07	1	15273	15273		94.856	65.582	1	10718000			1988	66	1158	1219	2675	2675		9606
NSSYFVEWIPNNVK	14	Unmodified	_NSSYFVEWIPNNVK_			0	0	0	P07437;P68371;P04350;Q13885;Q9BVA1;Q13509	P07437;P68371;Q13885;Q13509	P68371	TUBB;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain	MULTI-MSMS	DP1141_9	4	848.9204711914062	2	848.920112	1695.82567	0.019062	1.6182E-05	0.56393	0.00047874	0.583	0.00049492	848.9204312383405	21.388	0.50096	21.388	21.037	21.538	0					8	4	3	0	0	0	0.0064228	1	16107	16107		106.16	77.199	1	29146000			1989	122;323;381;376	1159	1220	2676	2676		9606
NSVSNFLHSLER	12	Unmodified	_NSVSNFLHSLER_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MSMS	DP1141_6	1	467.7841491699219	3	468.240635	1401.70008	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.393	1	20.393	19.893	20.893	0								0	0	0	0.012666	1	14018	14018		116.74	80.053	1				1990	367	1160	1221	2677	2677		9606
NSVTPDMMEEMYKK	14	3 Oxidation (M)	_NSVTPDM(Oxidation (M))M(Oxidation (M))EEM(Oxidation (M))YKK_	NSVTPDM(1)M(1)EEM(1)YKK	NSVTPDM(55)M(55)EEM(55)YKK	0	3	1	P46777	P46777	P46777	RPL5	60S ribosomal protein L5	MULTI-MSMS	DP1141_6	1	584.2498779296875	3	584.249263	1749.72596	0.68373	0.00039947	-0.15546	-9.0828E-05	0.52827	0.00030864	584.2494488552119	14.012	0.40429	14.012	13.811	14.215	0					11	4	4	0	0	0	0.013854	1	4197	4197		55.261	42.113	1	2480900			1991	233	1161	1222	2678	2678	187;188;189	9606
NSVTPDMMEEMYKK	14	3 Oxidation (M)	_NSVTPDM(Oxidation (M))M(Oxidation (M))EEM(Oxidation (M))YKK_	NSVTPDM(1)M(1)EEM(1)YKK	NSVTPDM(43)M(43)EEM(43)YKK	0	3	1	P46777	P46777	P46777	RPL5	60S ribosomal protein L5	MULTI-MSMS	DP1141_9	4	585.0787353515625	3	584.249263	1749.72596	0.40681	0.00023768	1.235	0.00072154	1.6418	0.00095922	584.5844791351756	14.06	0.30087	14.06	13.877	14.178	0					9	4	3	0	0	0	0.031066	1	4401	4401		43.297	29.879	1	4919700			1992	233	1161	1222	2679	2679	187;188;189	9606
NTCEAVVLGTLHPR	14	Unmodified	_NTCEAVVLGTLHPR_			0	0	0	Q9NQT4	Q9NQT4	Q9NQT4	EXOSC5	Exosome complex component RRP46	MULTI-MSMS	DP1141_10	5	523.2569580078125	3	522.94008	1565.79841	-0.034059	-1.7811E-05	0.15971	8.3521E-05	0.12566	6.571E-05	522.9402390187138	18.137	0.49945	18.137	17.887	18.387	0					7	4	3	0	0	0	0.0191	1	11609	11609		53.946	34.66	1	47808000			1993	571	1162	1223	2680	2680		9606
NVKEDSTADDSKDSVAQGTTNVHSSEHAGR	30	Unmodified	_NVKEDSTADDSKDSVAQGTTNVHSSEHAGR_			0	0	2	P46013	P46013	P46013	MKI67	Antigen KI-67	MULTI-MSMS	DP1141_7	2	629.6925659179688	5	629.291177	3141.4195	0.13123	8.2579E-05	0.47665	0.00029995	0.60788	0.00038253	629.4921559482435	12.83	1.1557	12.83	12.624	13.78	0					35	11	5	0	0	0	1.3969E-10	2	3085	3085;3203		92.613	69.481	1	7720900			1994	232	1163	1224	2681;2682	2681		9606
NVKEDSTADDSKDSVAQGTTNVHSSEHAGR	30	Unmodified	_NVKEDSTADDSKDSVAQGTTNVHSSEHAGR_			0	0	2	P46013	P46013	P46013	MKI67	Antigen KI-67	MULTI-MSMS	DP1141_8	3	629.4920654296875	5	629.291177	3141.4195	0.23122	0.0001455	0.40639	0.00025574	0.63761	0.00040124	629.4921010760967	13.626	0.51679	13.626	13.288	13.805	0					17	6	5	0	0	0	5.1854E-09	1	3915	3915		82.086	53.692	1	10583000			1995	232	1163	1224	2683	2683		9606
NVLLDPQLVPGGGASEMAVAHALTEK	26	Oxidation (M)	_NVLLDPQLVPGGGASEM(Oxidation (M))AVAHALTEK_	NVLLDPQLVPGGGASEM(1)AVAHALTEK	NVLLDPQLVPGGGASEM(88)AVAHALTEK	0	1	0	P49368	P49368	P49368	CCT3	T-complex protein 1 subunit gamma	MULTI-SECPEP	DP1141_8	3	878.9691772460938	3	878.458294	2632.35305	0.53497	0.00046995	-0.92516	-0.00081272	-0.39019	-0.00034277	878.7922974025995	21.128	0.40106	21.128	20.978	21.379	0					6	3	2	0	0	0	1.8514E-08	1	15527	15527		88.001	66.385	1	18348000			1996	246	1164	1225	2684	2684	199	9606
NVQDAIADAEQR	12	Unmodified	_NVQDAIADAEQR_			0	0	0	CON__P35908v2;CON__P35908;P35908	CON__P35908v2	CON__P35908v2	KRT2	Keratin, type II cytoskeletal 2 epidermal	MULTI-MSMS	DP1141_6	1	665.3287963867188	2	665.323305	1328.63206	1.169	0.00077776	0.70004	0.00046576	1.869	0.0012435	665.3237976481821	17.763	0.40041	17.763	17.505	17.905	0					6	3	2	0	0	0	2.0788E-66	1	9971	9971		201.84	144.29	1	17589000		+	1997	20	1165	1226	2685	2685		9606
NVQDAIADAEQR	12	Unmodified	_NVQDAIADAEQR_			0	0	0	CON__P35908v2;CON__P35908;P35908	CON__P35908v2	CON__P35908v2	KRT2	Keratin, type II cytoskeletal 2 epidermal	MSMS	DP1141_8	3	664.859375	2	665.323305	1328.63206	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.761	1	17.761	17.261	18.261	0								0	0	0	3.3844E-15	1	10414	10414		153.1	113.03	1			+	1998	20	1165	1226	2686	2686		9606
NVQLQENEIR	10	Unmodified	_NVQLQENEIR_			0	0	0	P36873	P36873	P36873	PPP1CC	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_10	5	621.8258056640625	2	621.825483	1241.63641	-0.40199	-0.00024997	0.88208	0.0005485	0.4801	0.00029854	621.8260832659346	16.316	0.39442	16.316	16.066	16.46	0					5	3	2	0	0	0	0.0037612	2	8677	8465;8677		124.23	81.632	1	345450000			1999	212	1166	1227	2687;2688	2688		9606
NVQLQENEIR	10	Unmodified	_NVQLQENEIR_			0	0	0	P36873	P36873	P36873	PPP1CC	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-SECPEP	DP1141_8	3	622.3173217773438	2	621.825483	1241.63641	0.0062026	3.8569E-06	-0.078529	-4.8831E-05	-0.072327	-4.4975E-05	621.8258648878101	16.326	0.89694	16.326	16.076	16.973	0					17	9	3	0	0	0	0.0066207	1	8551	8551		95.358	62.466	1	6219099999.999999			2000	212	1166	1227	2689	2689		9606
NVQLQENEIR	10	Unmodified	_NVQLQENEIR_			0	0	0	P36873	P36873	P36873	PPP1CC	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MSMS	DP1141_9	4	621.825927734375	2	621.825483	1241.63641	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.409	1	16.409	15.909	16.909	0								0	0	0	0.00444	1	8121	8121		130.56	94.944	1				2001	212	1166	1227	2690	2690		9606
NVQLSLLTER	10	Unmodified	_NVQLSLLTER_			0	0	0	P49959	P49959	P49959	MRE11A	Double-strand break repair protein MRE11A	MULTI-SECPEP	DP1141_8	3	587.3222045898438	2	586.83532	1171.65609	0.42052	0.00024678	-0.017244	-1.0119E-05	0.40328	0.00023666	586.8351325272123	19.426	0.3004	19.426	19.175	19.476	0					4	2	2	0	0	0	0.0044792	1	12891	12891		105.1	69.656	1	14988000			2002	254	1167	1228	2691	2691		9606
NVQLTENEIR	10	Unmodified	_NVQLTENEIR_			0	0	0	P62136	P62136	P62136	PPP1CA	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit	MULTI-MSMS	DP1141_9	4	608.3197021484375	2	608.320034	1214.62551	-0.20759	-0.00012628	0.43233	0.000263	0.22474	0.00013672	608.3202006336172	16.752	0.40352	16.752	16.553	16.957	0					7	5	2	0	0	0	1.6995E-08	1	8706	8706		159.58	95.32	1	133030000			2003	286	1168	1229	2692	2692		9606
NVSEELDRTPPEVSK	15	Unmodified	_NVSEELDRTPPEVSK_			0	0	1	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	567.9105834960938	3	567.288091	1698.84244	0.2007	0.00011385	-0.43815	-0.00024856	-0.23745	-0.0001347	567.2875777230242	16.355	0.65237	16.355	16.005	16.657	0					18	6	5	0	0	0	0.023288	1	7481	7481		109.44	69.065	1	52347000			2004	402	1169	1230	2693	2693		9606
NVSEELDRTPPEVSK	15	Unmodified	_NVSEELDRTPPEVSK_			0	0	1	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	850.9298095703125	2	850.428498	1698.84244	0.5245	0.00044605	-0.30588	-0.00026013	0.21862	0.00018592	850.4281674077104	16.355	0.39983	16.355	16.105	16.505	0					8	3	3	0	0	0	1.4002E-53	2	7597	7597;7744		167.03	114.99	1	17914000			2005	402	1169	1230	2694;2695	2694		9606
NVSEELDRTPPEVSK	15	Unmodified	_NVSEELDRTPPEVSK_			0	0	1	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_7	2	850.4287719726562	2	850.428498	1698.84244	0.67265	0.00057204	-0.46847	-0.0003984	0.20418	0.00017364	850.4281861466096	16.265	0.30022	16.265	16.114	16.415	0					6	2	3	0	0	0	0.012216	1	8237	8237		104.55	78.137	1	84983000			2006	402	1169	1230	2696	2696		9606
NVSTGDVNVEMNAAPGVDLTQLLNNMR	27	2 Oxidation (M)	_NVSTGDVNVEM(Oxidation (M))NAAPGVDLTQLLNNM(Oxidation (M))R_	NVSTGDVNVEM(1)NAAPGVDLTQLLNNM(1)R	NVSTGDVNVEM(74)NAAPGVDLTQLLNNM(74)R	0	2	0	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_6	1	969.1342163085938	3	968.79905	2903.37532	0.48695	0.00047176	0.16372	0.00015861	0.65067	0.00063037	969.1338188718413	21.431	0.2509	21.431	21.296	21.546	0					10	2	5	0	0	0	6.7376E-06	1	15745	15745		74.287	62.546	1	11995000		+	2007	17	1170	1231	2697	2697	15;16	9606
NVSTGDVNVEMNAAPGVDLTQLLNNMR	27	2 Oxidation (M)	_NVSTGDVNVEM(Oxidation (M))NAAPGVDLTQLLNNM(Oxidation (M))R_	NVSTGDVNVEM(1)NAAPGVDLTQLLNNM(1)R	NVSTGDVNVEM(94)NAAPGVDLTQLLNNM(94)R	0	2	0	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_6	1	1453.1959228515625	2	1452.69494	2903.37532	0.23382	0.00033967	-0.13629	-0.00019798	0.097538	0.00014169	1453.1964822291202	21.449	0.2509	21.449	21.296	21.546	0					6	2	3	0	0	0	1.1096E-06	1	15772	15772		93.768	73.834	1	3427500		+	2008	17	1170	1231	2698	2698	15;16	9606
NVSTGDVNVEMNAAPGVDLTQLLNNMR	27	2 Oxidation (M)	_NVSTGDVNVEM(Oxidation (M))NAAPGVDLTQLLNNM(Oxidation (M))R_	NVSTGDVNVEM(1)NAAPGVDLTQLLNNM(1)R	NVSTGDVNVEM(58)NAAPGVDLTQLLNNM(58)R	0	2	0	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_8	3	968.9747314453125	3	968.79905	2903.37532	0.41013	0.00039733	-0.16359	-0.00015849	0.24653	0.00023884	969.132597524552	21.529	0.30042	21.529	21.279	21.579	0					4	2	2	0	0	0	4.797E-05	1	16048	16048		57.738	40.641	1	5872200		+	2009	17	1170	1231	2699	2699	15;16	9606
PAGPVQAVPPPPPVPTEPK	19	Unmodified	_PAGPVQAVPPPPPVPTEPK_			0	0	0	Q15459	Q15459	Q15459	SF3A1	Splicing factor 3A subunit 1	MULTI-MSMS	DP1141_7	2	938.4940795898438	2	938.022369	1874.03018	0.40247	0.00037752	-0.80139	-0.00075172	-0.39892	-0.0003742	938.0219409576586	18.099	0.30035	18.099	17.849	18.149	0					6	2	3	0	0	0	0.0052188	1	10886	10886		83.877	50.604	1	10497000			2010	405	1171	1232	2700	2700		9606
PEFLEDPSVLTK	12	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))PEFLEDPSVLTK_			1	0	0	P42166	P42166	P42166	TMPO	Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin	MSMS	DP1141_8	3	708.6122436523438	2	708.866482	1415.71841	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.901	1	20.901	20.401	21.401	0								0	0	0	0.0052723	1	15169	15169		102.95	76.513	1				2011	225	1172	1233	2701	2701		9606
PGASLPPLDLQALEK	15	Unmodified	_PGASLPPLDLQALEK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	774.9356079101562	2	774.935231	1547.85591	0.23455	0.00018176	0.45314	0.00035115	0.68769	0.00053291	774.9354430712951	20.997	0.52097	20.997	20.862	21.383	0					10	5	3	0	0	0	0.0065122	1	15107	15107		92.611	27.77	1	20486000			2012	142	1173	1234	2702	2702		9606
PGASLPPLDLQALEK	15	Unmodified	_PGASLPPLDLQALEK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	774.7858276367188	2	774.935231	1547.85591	0.92671	0.00071814	-0.08161	-6.3242E-05	0.8451	0.0006549	774.9353462258678	21	1.0978	21	20.85	21.948	0					25	10	4	0	0	0	7.7959E-69	4	15591	15591;15661;15662;15897		201.09	155.5	1	225660000			2013	142	1173	1234	2703;2704;2705;2706	2703		9606
PGASLPPLDLQALEK	15	Unmodified	_PGASLPPLDLQALEK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_9	4	774.93603515625	2	774.935231	1547.85591	0.83898	0.00065015	0.019262	1.4927E-05	0.85824	0.00066508	774.9351938440208	20.988	0.50118	20.988	20.837	21.338	0					7	4	3	0	0	0	0.019002	1	15510	15510		77.387	39.879	1	15900000			2014	142	1173	1234	2707	2707		9606
PGETEEPRPPEQQDQEGGEAAK	22	Unmodified	_PGETEEPRPPEQQDQEGGEAAK_			0	0	1	Q96JP5	Q96JP5	Q96JP5	ZFP91	E3 ubiquitin-protein ligase ZFP91	MULTI-MSMS	DP1141_8	3	793.69482421875	3	793.694685	2378.06223	0.44458	0.00035286	-0.41236	-0.00032729	0.032218	2.5571E-05	793.6943523908117	14.492	0.30864	14.492	14.268	14.577	0					7	3	3	0	0	0	4.3856E-05	1	5235	5235		100.27	86.535	1	30976000			2015	515	1174	1235	2708	2708		9606
PGGGPGLSTPGGHPKPPHR	19	Unmodified	_PGGGPGLSTPGGHPKPPHR_			0	0	1	P23246	P23246	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	MULTI-SECPEP	DP1141_7	2	450.89971923828125	4	451.490676	1801.9336	0.7708	0.00034801	-0.3861	-0.00017432	0.3847	0.00017369	451.4904901727746	13.904	0.89502	13.904	13.226	14.121	0					27	9	4	0	0	0	4.5278E-08	1	4389	4389		115.04	97.491	1	46413000			2016	181	1175	1236	2709	2709		9606
PGGGPGLSTPGGHPKPPHR	19	Unmodified	_PGGGPGLSTPGGHPKPPHR_			0	0	1	P23246	P23246	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	MULTI-MSMS	DP1141_8	3	451.23846435546875	4	451.490676	1801.9336	-0.19199	-8.6679E-05	0.12497	5.6424E-05	-0.067012	-3.0255E-05	451.49074681703905	13.923	0.44778	13.923	13.52	13.968	0					13	5	4	0	0	0	0.019666	1	4358	4358		85.469	62.994	1	13304000			2017	181	1175	1236	2710	2710		9606
PLTMTKATYCKPHMQTK	17	Oxidation (M)	_PLTM(Oxidation (M))TKATYCKPHMQTK_	PLTM(1)TKATYCKPHMQTK	PLTM(57)TKATYCKPHM(-57)QTK	0	1	2	Q9UBW7	Q9UBW7	Q9UBW7	ZMYM2	Zinc finger MYM-type protein 2	MSMS	DP1141_10	5	1026.51171875	2	1026.50739	2051.00022	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.384	1	20.384	19.884	20.884	0								0	0	0	0.031385	1	15021	15021		97.163	10.252	2				2018	589	1176	1237	2711	2711	415	9606
PLVLPSPLVTPGSNSQER	18	Unmodified	_PLVLPSPLVTPGSNSQER_			0	0	0	Q96QC0	Q96QC0	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	MULTI-SECPEP	DP1141_7	2	946.2071533203125	2	946.017815	1890.02108	0.64313	0.00060841	0.25239	0.00023877	0.89552	0.00084718	946.0180130119129	20.301	0.30056	20.301	20.05	20.351	0					8	2	4	0	0	0	3.2371E-22	1	14523	14523		155.14	112.93	1	62520000			2019	520	1177	1238	2712	2712		9606
PMIHELLTEGR	11	Oxidation (M)	_PM(Oxidation (M))IHELLTEGR_	PM(1)IHELLTEGR	PM(54)IHELLTEGR	0	1	0	Q14974	Q14974	Q14974	KPNB1	Importin subunit beta-1	MULTI-MSMS	DP1141_7	2	437.7244873046875	3	437.8957	1310.66527	0.67872	0.00029721	-0.40075	-0.00017549	0.27797	0.00012172	437.8955227990625	17.003	0.45718	17.003	16.892	17.349	0					5	4	2	0	0	0	0.032579	1	9344	9344		54.486	23.662	1	7924700			2020	395	1178	1239	2713	2713	305	9606
PVIVEPLEQLDDEDGLPEK	19	Unmodified	_PVIVEPLEQLDDEDGLPEK_			0	0	0	P23246	P23246	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	MSMS	DP1141_7	2	1068.043212890625	2	1068.04135	2134.06815	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.251	1	21.251	20.751	21.751	0								0	0	0	5.1834E-104	1	15880	15880		231.07	192.49	1				2021	181	1179	1240	2714	2714		9606
PVQMMFMKKK	10	3 Oxidation (M)	_PVQM(Oxidation (M))M(Oxidation (M))FM(Oxidation (M))KKK_	PVQM(1)M(1)FM(1)KKK	PVQM(44)M(44)FM(44)KKK	0	3	2	P48595	P48595	P48595	SERPINB10	Serpin B10	MSMS	DP1141_8	3	658.7660522460938	2	658.332187	1314.64982	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.672	1	16.672	16.172	17.172	0								0	0	0	0.035659	1	8641	8641		44.117	8.5754	1				2022	242	1180	1241	2715	2715	192;193;194	9606
PYGLDWAELSR	11	Unmodified	_PYGLDWAELSR_			0	0	0	O14525	O14525	O14525	ASTN1	Astrotactin-1	MULTI-SECPEP	DP1141_6	1	653.2572021484375	2	653.824952	1305.63535	0.78308	0.000512	-2.126	-0.00139	-1.3429	-0.00087805	653.8241334263105	18.259	0.70004	18.259	18.105	18.805	0					23	6	6	0	0	0	0.02716	1	10753	10753		88.819	6.393	1	1143700000			2023	42	1181	1242	2716	2716		9606
PYGLDWAELSR	11	Unmodified	_PYGLDWAELSR_			0	0	0	O14525	O14525	O14525	ASTN1	Astrotactin-1	MULTI-MSMS	DP1141_7	2	653.8359985351562	2	653.824952	1305.63535	-0.13552	-8.8604E-05	0.16721	0.00010932	0.03169	2.072E-05	653.8250819175008	18.285	0.4002	18.285	17.949	18.349	0					7	3	3	0	0	0	0.021565	1	11359	11359		104.06	21.631	1	27832000			2024	42	1181	1242	2717	2717		9606
QAASSLQQASLK	12	Unmodified	_QAASSLQQASLK_			0	0	0	P38646	P38646	P38646	HSPA9	Stress-70 protein, mitochondrial	MULTI-MSMS	DP1141_8	3	616.7560424804688	2	616.335684	1230.65681	0.6199	0.00038206	-0.22494	-0.00013864	0.39495	0.00024342	616.335588578334	15.42	0.30058	15.42	15.172	15.472	0					4	2	2	0	0	0	0.0026841	1	6534	6534		131.82	84.161	1	43135000			2025	217	1182	1243	2718	2718		9606
QADVFPDR	8	Unmodified	_QADVFPDR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-SECPEP	DP1141_8	3	474.7485656738281	2	474.232699	946.450845	-0.046557	-2.2079E-05	0.19574	9.2827E-05	0.14918	7.0748E-05	474.23281896437294	16.326	0.39356	16.326	16.076	16.469	0					9	3	3	0	0	0	0.00046438	1	8105	8105		98.629	54.513	1	67708000			2026	567	1183	1244	2719	2719		9606
QADVFPDRDHFGR	13	Unmodified	_QADVFPDRDHFGR_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	780.3713989257812	2	780.371121	1558.72769	0.018164	1.4175E-05	0.12207	9.5259E-05	0.14023	0.00010943	780.3711246545412	16.612	0.37204	16.612	16.276	16.648	0					8	3	3	0	0	0	2.2494000000000002E-20	2	8450	8450;8567		173.24	145.22	1	87489000			2027	567	1184	1245	2720;2721	2720		9606
QAQIEVVPSASALIIK	16	Unmodified	_QAQIEVVPSASALIIK_			0	0	0	P30050	P30050	P30050	RPL12	60S ribosomal protein L12	MULTI-SECPEP	DP1141_10	5	834.1511840820312	2	833.990537	1665.96652	0.75717	0.00063147	-0.054396	-4.5366E-05	0.70277	0.0005861	834.491913996838	20.526	0.29956	20.526	20.276	20.576	0					6	2	3	0	0	0	4.7633E-06	1	15097	15097		129.74	97.126	1	15871000			2028	197	1185	1246	2722	2722		9606
QAVDFLSNEGHIYSTVDDDHFK	22	Unmodified	_QAVDFLSNEGHIYSTVDDDHFK_			0	0	0	P15927	P15927	P15927	RPA2	Replication protein A 32 kDa subunit	MULTI-MSMS	DP1141_9	4	635.0440063476562	4	635.044938	2536.15065	0.57162	0.000363	-1.0969	-0.00069658	-0.52528	-0.00033358	635.2951723871028	19.428	0.50109	19.428	19.138	19.639	0					13	4	4	0	0	0	0.019457	1	13140	13140		43.463	26.786	1	26470000			2029	156	1186	1247	2723	2723		9606
QAVDVSPLR	9	Unmodified	_QAVDVSPLR_			0	0	0	P46782	P46782	P46782	RPS5	40S ribosomal protein S5;40S ribosomal protein S5, N-terminally processed	MULTI-MSMS	DP1141_10	5	492.7376403808594	2	492.777274	983.539994	0.30595	0.00015077	-0.11617	-5.7246E-05	0.18978	9.352E-05	492.77712525794885	16.576	0.18863	16.576	16.46	16.649	0					4	2	2	0	0	0	0.034505	1	8926	8926		75.043	30.649	1	11788000			2030	237	1187	1248	2724	2724		9606
QAVTNPNNTFYATK	14	Unmodified	_QAVTNPNNTFYATK_			0	0	0	P38646	P38646	P38646	HSPA9	Stress-70 protein, mitochondrial	MULTI-MSMS	DP1141_8	3	786.3226928710938	2	784.888812	1567.76307	0.086218	6.7672E-05	-0.21395	-0.00016793	-0.12773	-0.00010026	785.3899906183501	16.595	0.27197	16.595	16.376	16.648	0					6	2	3	0	0	0	0.027114	1	8520	8520		69.672	42.368	1	17437000			2031	217	1188	1249	2725	2725		9606
QCCGTDGVEANYIK	14	Unmodified	_QCCGTDGVEANYIK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	807.8480224609375	2	807.847972	1613.68139	0.80962	0.00065405	-0.80864	-0.00065326	0.00098293	7.9406E-07	807.8474964008824	16.781	0.37354	16.781	16.58	16.953	0					12	4	4	0	0	0	0.0013604	2	8951	8951;8984		141.89	120.49	1	174820000			2032	78	1189	1250	2726;2727	2726		9606
QEGIIFIGPPPSAIR	15	Unmodified	_QEGIIFIGPPPSAIR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_10	5	797.95166015625	2	797.951215	1593.88788	0.87187	0.00069571	-0.28234	-0.00022529	0.58952	0.00047041	797.9509233661199	21.026	0.40068	21.026	20.775	21.176	0					10	3	4	0	0	0	3.3393E-05	2	15996	15996;16026		179.59	154.2	1	30984000			2033	521	1190	1251	2728;2729	2728		9606
QEGIIFIGPPPSAIR	15	Unmodified	_QEGIIFIGPPPSAIR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	799.4283447265625	2	797.951215	1593.88788	0.33878	0.00027033	0.0435	3.4711E-05	0.38228	0.00030504	797.951283203325	20.997	0.3446	20.997	20.862	21.206	0					12	3	4	0	0	0	0.0021194	3	15010	15010;15103;15104		140.45	108.76	1	95815000			2034	521	1190	1251	2730;2731;2732	2730		9606
QEGIIFIGPPPSAIR	15	Unmodified	_QEGIIFIGPPPSAIR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_7	2	798.7322387695312	2	797.951215	1593.88788	0.8394	0.0006698	-0.26272	-0.00020964	0.57668	0.00046016	797.950919152948	21	0.29955	21	20.85	21.15	0					6	2	3	0	0	0	1.6562999999999999E-21	1	15422	15422		205.02	179.79	1	65513000			2035	521	1190	1251	2733	2733		9606
QEGIIFIGPPPSAIR	15	Unmodified	_QEGIIFIGPPPSAIR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-SECPEP	DP1141_8	3	797.348388671875	2	797.951215	1593.88788	0.61908	0.00049399	-0.14256	-0.00011376	0.47651	0.00038023	797.9510653818938	21.028	0.50072	21.028	20.778	21.279	0					15	4	5	0	0	0	0.018007	1	15464	15464		117.2	103.24	1	237860000			2036	521	1190	1251	2734	2734		9606
QEGIIFIGPPPSAIR	15	Unmodified	_QEGIIFIGPPPSAIR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_9	4	798.9199829101562	2	797.951215	1593.88788	0.21439	0.00017107	0.64643	0.00051582	0.86082	0.00068689	797.9516526333258	20.988	0.40113	20.988	20.837	21.238	0					9	3	3	0	0	0	1.3263000000000002E-68	3	15323	15323;15501;15504		244.18	244.18	1	119840000			2037	521	1190	1251	2735;2736;2737	2735		9606
QELSHALYQHDAACR	15	Unmodified	_QELSHALYQHDAACR_			0	0	0	Q9UMS4	Q9UMS4	Q9UMS4	PRPF19	Pre-mRNA-processing factor 19	MULTI-MSMS	DP1141_8	3	600.289794921875	3	600.281165	1797.82167	0.67982	0.00040808	-0.61634	-0.00036997	0.063484	3.8108E-05	600.6149469702182	15.312	0.59939	15.312	14.873	15.472	0					15	5	4	0	0	0	0.0032996	1	6416	6416		113.37	78.449	1	13140000			2038	603	1191	1252	2738	2738		9606
QEQVTAAVAHAVEQQMQK	18	Oxidation (M)	_QEQVTAAVAHAVEQQM(Oxidation (M))QK_	QEQVTAAVAHAVEQQM(1)QK	QEQVTAAVAHAVEQQM(100)QK	0	1	0	Q8IWX8	Q8IWX8	Q8IWX8	CHERP	Calcium homeostasis endoplasmic reticulum protein	MULTI-MSMS	DP1141_7	2	671.3342895507812	3	671.333706	2010.97929	0.38066	0.00025555	-0.23427	-0.00015727	0.14639	9.8277E-05	671.3337304372046	17.853	0.50013	17.853	17.649	18.149	0					14	4	4	0	0	0	9.0617E-05	1	10772	10772		102.36	74.329	1	43068000			2039	463	1192	1253	2739	2739	343	9606
QESGSEIHVEVK	12	Unmodified	_QESGSEIHVEVK_			0	0	0	P46013	P46013	P46013	MKI67	Antigen KI-67	MULTI-SECPEP	DP1141_8	3	447.4607849121094	3	447.893013	1340.65721	0.26495	0.00011867	0.012849	5.7548E-06	0.2778	0.00012442	447.89292569878353	14.974	0.29967	14.974	14.772	15.072	0					4	2	2	0	0	0	0.012416	1	5849	5849		74.611	34.114	1	2092300			2040	232	1193	1254	2740	2740		9606
QEYDESGPSIVHR	13	Unmodified	_QEYDESGPSIVHR_			0	0	0	P60709;Q6S8J3;A5A3E0;Q9BYX7;P0CG38;P0CG39;P63261	P60709;P63261	P60709	ACTB;POTEE;POTEF;POTEKP;POTEI;POTEJ;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;POTE ankyrin domain family member E;POTE ankyrin domain family member F;Putative beta-actin-like protein 3;Putative beta-actin-like protein 3, N-terminally processed;POTE ankyrin domain family member I;POTE ankyrin domain family member J;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	MULTI-SECPEP	DP1141_9	4	758.3583984375	2	758.854969	1515.69539	0.76117	0.00057762	3.2559	0.0024708	4.0171	0.0030484	758.8574722396305	15.722	0.49417	15.722	15.471	15.965	0					5	4	2	0	0	0	0.0099149	1	7036	7036		96.113	52.479	1	20020000			2041	277;318	1194	1255	2741	2741		9606
QFSSADEAALKEPIIK	16	Unmodified	_QFSSADEAALKEPIIK_			0	0	1	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MSMS	DP1141_9	4	582.656982421875	3	582.980598	1745.91997	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.021	1	18.021	17.521	18.521	0								0	0	0	0.017817	1	10773	10773		147.12	102.61	1				2042	567	1195	1256	2742	2742		9606
QFSSADEAALKEPIIKK	17	Unmodified	_QFSSADEAALKEPIIKK_			0	0	2	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	626.000732421875	3	625.678919	1874.01493	0.21213	0.00013273	0.47851	0.00029939	0.69064	0.00043212	626.0135301173233	16.878	0.32454	16.878	16.648	16.973	0					6	3	2	0	0	0	0.004676	1	8891	8891		130.95	104.75	1	20991000			2043	567	1196	1257	2743	2743		9606
QFSSSYLSR	9	Unmodified	_QFSSSYLSR_			0	0	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_9	4	538.2622680664062	2	537.764363	1073.51417	0.51555	0.00027724	0.037516	2.0175E-05	0.55306	0.00029742	538.2658876308967	17.122	0.38107	17.122	16.957	17.338	0					5	3	2	0	0	0	0.022727	1	9309	9309		82.426	25.705	1	7965500		+	2044	19	1197	1258	2744	2744		9606
QGDEVSVHYDPMIAK	15	Oxidation (M)	_QGDEVSVHYDPM(Oxidation (M))IAK_	QGDEVSVHYDPM(1)IAK	QGDEVSVHYDPM(85)IAK	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	569.2696533203125	3	568.934772	1703.78249	0.16766	9.5386E-05	0.30412	0.00017302	0.47177	0.00026841	568.9350309983884	16.68	0.31879	16.68	16.505	16.824	0					11	3	4	0	0	0	0.003621	1	8126	8126		85.163	70.174	1	65483000			2045	521	1198	1259	2745	2745	375	9606
QGDEVSVHYDPMIAK	15	Oxidation (M)	_QGDEVSVHYDPM(Oxidation (M))IAK_	QGDEVSVHYDPM(1)IAK	QGDEVSVHYDPM(57)IAK	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	568.9349975585938	3	568.934772	1703.78249	-0.43987	-0.00025026	0.71933	0.00040925	0.27946	0.00015899	568.9353647073518	16.684	0.60333	16.684	16.469	17.073	0					14	6	4	0	0	0	0.017032	1	8678	8678		56.527	37	1	596810000			2046	521	1198	1259	2746	2746	375	9606
QGDEVSVHYDPMIAK	15	Oxidation (M)	_QGDEVSVHYDPM(Oxidation (M))IAK_	QGDEVSVHYDPM(1)IAK	QGDEVSVHYDPM(99)IAK	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MSMS	DP1141_8	3	852.8988647460938	2	852.898519	1703.78249	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.783	1	16.783	16.283	17.283	0								0	0	0	0.012217	1	8823	8823		99.215	72.557	1				2047	521	1198	1259	2747	2747	375	9606
QGDEVSVHYDPMIAK	15	Oxidation (M)	_QGDEVSVHYDPM(Oxidation (M))IAK_	QGDEVSVHYDPM(1)IAK	QGDEVSVHYDPM(65)IAK	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_9	4	569.2699584960938	3	568.934772	1703.78249	0.09043	5.1449E-05	0.010503	5.9757E-06	0.10093	5.7424E-05	568.9349995597948	16.643	0.43827	16.643	16.458	16.896	0					10	5	3	0	0	0	0.0082197	1	8637	8637		64.842	40.908	1	31535000			2048	521	1198	1259	2748	2748	375	9606
QGDEVSVHYDPMIAK	15	Unmodified	_QGDEVSVHYDPMIAK_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MSMS	DP1141_6	1	563.6049194335938	3	563.603133	1687.78757	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.534	1	17.534	17.034	18.034	0								0	0	0	0.0015686	1	9507	9507		115.12	67.873	1				2049	521	1198	1260	2749	2749		9606
QGILGAQPQLIFQPHR	16	Unmodified	_QGILGAQPQLIFQPHR_			0	0	0	Q8N163	Q8N163	Q8N163	CCAR2	Cell cycle and apoptosis regulator protein 2	MULTI-MSMS	DP1141_7	2	601.7796020507812	3	601.672322	1801.99514	0.69897	0.00042055	-0.16362	-9.8445E-05	0.53535	0.00032211	601.6721836869282	19.968	0.30009	19.968	19.75	20.05	0					6	2	3	0	0	0	0.0008157	1	14029	14029		89.26	56.557	1	13683000			2050	467	1199	1261	2750	2750		9606
QGIVTPIEAQTR	12	Unmodified	_QGIVTPIEAQTR_			0	0	0	P98175	P98175	P98175	RBM10	RNA-binding protein 10	MULTI-MSMS	DP1141_7	2	657.2979125976562	2	656.864608	1311.71466	0.18664	0.0001226	0.44513	0.00029239	0.63177	0.00041499	656.8649406433273	17.199	0.29853	17.199	17.051	17.349	0					4	2	2	0	0	0	0.005173	1	9584	9584		104.52	43.17	1	25367000			2051	335	1200	1262	2751	2751		9606
QGPLHGMLINTPYVTK	16	Oxidation (M)	_QGPLHGM(Oxidation (M))LINTPYVTK_	QGPLHGM(1)LINTPYVTK	QGPLHGM(81)LINTPYVTK	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	595.310791015625	3	595.650307	1783.92909	1.005	0.00059862	-0.66781	-0.00039778	0.33717	0.00020084	595.9842618502838	17.774	0.50021	17.774	17.605	18.105	0					14	4	5	0	0	0	0.004719	2	9820	9820;10030		80.719	43.194	1	192450000			2052	367	1201	1263	2752;2753	2752	282	9606
QGPLHGMLINTPYVTK	16	Oxidation (M)	_QGPLHGM(Oxidation (M))LINTPYVTK_	QGPLHGM(1)LINTPYVTK	QGPLHGM(94)LINTPYVTK	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	893.4736328125	2	892.971822	1783.92909	0.8733	0.00077983	-0.46622	-0.00041632	0.40708	0.00036351	893.4728341990948	17.763	0.30014	17.763	17.605	17.905	0					10	2	5	0	0	0	0.028952	1	10043	10043		93.649	66.218	1	18882000			2053	367	1201	1263	2754	2754	282	9606
QGPLHGMLINTPYVTK	16	Unmodified	_QGPLHGMLINTPYVTK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	590.3187866210938	3	590.318668	1767.93418	0.69456	0.00041001	-0.69667	-0.00041126	-0.0021144	-1.2482E-06	590.6528689711662	19.05	0.90104	19.05	18.504	19.406	0					26	8	7	0	0	0	2.8423E-06	2	11961	11862;11961		153.41	83.536	1	107490000			2054	367	1201	1264	2755;2756	2756		9606
QGPLHGMLINTPYVTK	16	Unmodified	_QGPLHGMLINTPYVTK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MSMS	DP1141_6	1	884.974365234375	2	884.974364	1767.93418	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.106	1	19.106	18.606	19.606	0								0	0	0	0.019801	1	12029	12029		123.26	68.472	1				2055	367	1201	1264	2757	2757		9606
QGPQHGMLINTPYVTK	16	Oxidation (M)	_QGPQHGM(Oxidation (M))LINTPYVTK_	QGPQHGM(1)LINTPYVTK	QGPQHGM(48)LINTPYVTK	0	1	0	O00763	O00763	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	600.6420288085938	3	600.641811	1798.9036	0.017738	1.0654E-05	0.37379	0.00022451	0.39153	0.00023517	600.6421764851053	16.635	0.22432	16.635	16.505	16.729	0					8	2	4	0	0	0	0.033425	1	8135	8135		47.537	24.552	1	12504000			2056	40	1202	1265	2758	2758	37	9606
QGTIFLAGPPLVK	13	Unmodified	_QGTIFLAGPPLVK_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_6	1	670.9009399414062	2	670.900463	1339.78637	1.0759	0.00072185	-0.14123	-9.4753E-05	0.93471	0.0006271	670.9003062635095	20.438	0.67114	20.438	20.19	20.862	0					17	6	4	0	0	0	0.0048383	3	14251	14221;14251;14257		112.75	99.294	1	35461000			2057	567	1203	1266	2759;2760;2761	2760		9606
QGTIFLAGPPLVK	13	Unmodified	_QGTIFLAGPPLVK_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	670.9010009765625	2	670.900463	1339.78637	0.47038	0.00031558	0.35085	0.00023539	0.82123	0.00055096	670.9007324275213	20.427	0.90123	20.427	20.277	21.178	0					27	8	5	0	0	0	0.00047882	3	14627	14588;14627;14629		127.76	111.27	1	654590000			2058	567	1203	1266	2762;2763;2764	2763		9606
QGTIFLAGPPLVK	13	Unmodified	_QGTIFLAGPPLVK_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	671.031982421875	2	670.900463	1339.78637	0.61832	0.00041483	0.19243	0.0001291	0.81075	0.00054393	670.9005387174815	20.387	0.70067	20.387	20.237	20.937	0					21	6	5	0	0	0	0.00065698	3	14581	14581;14607;14616		136.52	112.99	1	52552000			2059	567	1203	1266	2765;2766;2767	2765		9606
QGVDADINGLR	11	Unmodified	_QGVDADINGLR_			0	0	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MSMS	DP1141_6	1	579.3250732421875	2	579.299101	1156.58365	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.394	1	17.394	16.894	17.894	0								0	0	0	2.4166E-160	1	9280	9280		223.88	126.28	1			+	2060	19	1204	1267	2768	2768		9606
QGVDADINGLR	11	Unmodified	_QGVDADINGLR_			0	0	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MSMS	DP1141_9	4	579.2894897460938	2	579.299101	1156.58365	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.371	1	17.371	16.871	17.871	0								0	0	0	1.229E-119	1	9719	9719		213.85	94.293	1			+	2061	19	1204	1267	2769	2769		9606
QHHPPYHQQHHQGPPPGGPGGR	22	Unmodified	_QHHPPYHQQHHQGPPPGGPGGR_			0	0	0	P23246	P23246	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	MULTI-MSMS	DP1141_7	2	602.0411987304688	4	601.53922	2402.12778	0.33571	0.00020194	0.12363	7.4368E-05	0.45934	0.00027631	601.7900750812659	12.574	0.9867	12.574	12.34	13.327	0					27	9	5	0	0	0	0.00015747	3	2803	2803;2810;2982		93.812	69.901	1	18974000			2062	181	1205	1268	2770;2771;2772	2770		9606
QHHPPYHQQHHQGPPPGGPGGR	22	Unmodified	_QHHPPYHQQHHQGPPPGGPGGR_			0	0	0	P23246	P23246	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	MULTI-MSMS	DP1141_7	2	481.633544921875	5	481.432832	2402.12778	0.20213	9.7314E-05	-0.050152	-2.4145E-05	0.15198	7.317E-05	481.63340052740455	12.574	1.3609	12.574	12.34	13.701	0					35	13	4	0	0	0	0.0051231	1	2809	2809		52.19	37.1	1	22253000			2063	181	1205	1268	2773	2773		9606
QHHPPYHQQHHQGPPPGGPGGR	22	Unmodified	_QHHPPYHQQHHQGPPPGGPGGR_			0	0	0	P23246	P23246	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	MULTI-MSMS	DP1141_8	3	601.7903442382812	4	601.53922	2402.12778	0.40579	0.0002441	-0.17902	-0.00010768	0.22678	0.00013641	601.7898998015014	12.565	0.96768	12.565	12.404	13.372	0					21	9	5	0	0	0	0.00026556	2	2697	2697;2978		84.436	63.576	1	11360000			2064	181	1205	1268	2774;2775	2774		9606
QHHPPYHQQHHQGPPPGGPGGR	22	Unmodified	_QHHPPYHQQHHQGPPPGGPGGR_			0	0	0	P23246	P23246	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	MULTI-MSMS	DP1141_8	3	481.633544921875	5	481.432832	2402.12778	0.50421	0.00024275	-0.64149	-0.00030883	-0.13727	-6.6087E-05	481.63325752272544	12.61	1.1901	12.61	12.33	13.52	0					32	12	3	0	0	0	0.0023237	1	2698	2698		58.29	41.259	1	11617000			2065	181	1205	1268	2776	2776		9606
QHPVPPPAQNQNQVR	15	Unmodified	_QHPVPPPAQNQNQVR_			0	0	0	Q15942	Q15942	Q15942	ZYX	Zyxin	MULTI-MSMS	DP1141_8	3	570.966552734375	3	570.632526	1708.87575	-0.28875	-0.00016477	0.34917	0.00019925	0.060413	3.4473E-05	570.6328043619759	13.526	0.48456	13.526	13.103	13.587	0					8	5	2	0	0	0	0.0070251	2	3852	3623;3852		73.219	34.82	1	489790			2066	408	1206	1269	2777;2778	2778		9606
QIDATFVR	8	Unmodified	_QIDATFVR_			0	0	0	Q15435	Q15435	Q15435	PPP1R7	Protein phosphatase 1 regulatory subunit 7	MULTI-MSMS	DP1141_9	4	475.224853515625	2	475.258717	948.50288	0.37984	0.00018052	-1.181	-0.00056129	-0.80117	-0.00038076	475.2587477739689	17.248	0.59036	17.248	17.047	17.638	0					6	5	2	0	0	0	0.0067334	1	9454	9454		113.7	59.171	1	19718000			2067	404	1207	1270	2779	2779		9606
QITVNDLPVGR	11	Unmodified	_QITVNDLPVGR_			0	0	0	Q06830;P32119	Q06830	Q06830	PRDX1;PRDX2	Peroxiredoxin-1;Peroxiredoxin-2	MULTI-MSMS	DP1141_10	5	606.3123168945312	2	606.340769	1210.66699	0.0049503	3.0016E-06	1.1811	0.00071614	1.186	0.00071914	606.3413841513074	18.337	0.39954	18.337	17.987	18.387	0					5	3	2	0	0	0	1.7912E-05	1	11887	11887		152.11	89.453	1	83405000			2068	348	1208	1271	2780	2780		9606
QKADEAYLIGR	11	Unmodified	_QKADEAYLIGR_			0	0	1	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_10	5	631.8872680664062	2	632.338227	1262.6619	-0.35645	-0.0002254	0.40341	0.00025509	0.046962	2.9696E-05	632.3381553742703	16.411	0.29431	16.411	16.166	16.46	0					4	2	2	0	0	0	0.032247	1	8589	8589		122.28	77.886	1	8652100			2069	142	1209	1272	2781	2781		9606
QKADEAYLIGR	11	Unmodified	_QKADEAYLIGR_			0	0	1	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-SECPEP	DP1141_6	1	632.6162719726562	2	632.338227	1262.6619	0.54542	0.00034489	-0.36535	-0.00023102	0.18007	0.00011386	632.338145944431	16.455	0.29959	16.455	16.205	16.505	0					4	2	2	0	0	0	0.011535	1	7586	7586		93.649	67.533	1	10630000			2070	142	1209	1272	2782	2782		9606
QKNTNEEDDEVREAMTR	17	Oxidation (M)	_QKNTNEEDDEVREAM(Oxidation (M))TR_	QKNTNEEDDEVREAM(1)TR	QKNTNEEDDEVREAM(54)TR	0	1	2	P49959	P49959	P49959	MRE11A	Double-strand break repair protein MRE11A	MULTI-SECPEP	DP1141_8	3	521.4299926757812	4	520.985458	2079.91272	-0.02735	-1.4249E-05	0.26999	0.00014066	0.24264	0.00012641	521.2362591237868	14.013	0.59615	14.013	13.453	14.05	0					9	7	2	0	0	0	0.030455	1	4237	4237		53.946	38.692	1	7330600			2071	254	1210	1273	2783	2783	204	9606
QLASGLLLVTGPLVLNR	17	Unmodified	_QLASGLLLVTGPLVLNR_			0	0	0	Q02878	Q02878	Q02878	RPL6	60S ribosomal protein L6	MULTI-MSMS	DP1141_9	4	883.0433349609375	2	882.540729	1763.0669	0.95958	0.00084686	-0.47284	-0.0004173	0.48674	0.00042957	883.0420186510999	23.106	0.24763	23.106	22.939	23.186	0					8	3	3	0	0	0	1.2508E-09	2	18539	18539;18628		155.88	128.02	1	3394200			2072	343	1211	1274	2784;2785	2784		9606
QLDNIVGER	9	Unmodified	_QLDNIVGER_			0	0	0	P04259	P04259	P04259	KRT6B	Keratin, type II cytoskeletal 6B	MULTI-MSMS	DP1141_9	4	522.7921142578125	2	522.277638	1042.54072	0.19122	9.9869E-05	1.0604	0.00055385	1.2517	0.00065372	522.2776819112072	16.732	0.42369	16.732	16.358	16.782	0					10	4	4	0	0	0	0.0066678	1	8626	8626		116.73	41.616	1	17232000			2073	101	1212	1275	2786	2786		9606
QLDSIVGER	9	Unmodified	_QLDSIVGER_			0	0	0	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;CON__P13647;P13647	CON__P02538;CON__P13647	CON__P02538	KRT6A;KRT6C;KRT5	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 5	MULTI-MSMS	DP1141_9	4	509.2919921875	2	508.772188	1015.52982	-0.13898	-7.071E-05	0.529	0.00026914	0.39002	0.00019843	508.7723718417556	16.821	0.64509	16.821	16.693	17.338	0					9	7	2	0	0	0	0.00058868	2	8774	8774;8930		132.08	45.612	1	158300000		+	2074	10;18	1213	1276	2787;2788	2787		9606
QLFHPEQLITGK	12	Unmodified	_QLFHPEQLITGK_			0	0	0	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_8	3	470.92974853515625	3	470.92951	1409.7667	0.53787	0.0002533	-0.076628	-3.6086E-05	0.46124	0.00021721	470.9294199124235	18.926	0.59996	18.926	18.675	19.275	0					15	5	5	0	0	0	0.0027143	1	12288	12288		101.56	0	1	138730000			2075	321;442;322	1214	1277	2789	2789		9606
QLFHPEQLITGK	12	Unmodified	_QLFHPEQLITGK_			0	0	0	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_9	4	471.2274475097656	3	470.92951	1409.7667	0.22356	0.00010528	-0.10613	-4.9977E-05	0.11744	5.5305E-05	470.9296014001063	18.987	0.7009	18.987	18.637	19.338	0					8	6	2	0	0	0	0.01213	1	12330	12330		66.326	0	1	58258000			2076	321;442;322	1214	1277	2790	2790		9606
QLFHPEQLITGKEDAANNYAR	21	Unmodified	_QLFHPEQLITGKEDAANNYAR_			0	0	1	P68363;P68366;Q71U36;P0DPH8;P0DPH7	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain	MULTI-MSMS	DP1141_8	3	604.807861328125	4	604.556744	2414.19787	0.60322	0.00036468	-0.5061	-0.00030597	0.097113	5.871E-05	604.8074642825169	18.625	0.6008	18.625	18.275	18.876	0					20	5	6	0	0	0	0.00035091	2	11796	11744;11796		120.79	88.585	1	391650000			2077	321;442;322	1215	1278	2791;2792	2792		9606
QLFHPEQLITGKEDAANNYAR	21	Unmodified	_QLFHPEQLITGKEDAANNYAR_			0	0	1	P68363;P68366;Q71U36;P0DPH8;P0DPH7	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain	MULTI-MSMS	DP1141_8	3	805.7408447265625	3	805.7399	2414.19787	0.9087	0.00073217	-0.74462	-0.00059997	0.16408	0.0001322	806.0735478272001	18.625	0.80064	18.625	18.175	18.976	0					12	7	3	0	0	0	6.7726E-175	1	11813	11813		247.3	207.95	1	290160000			2078	321;442;322	1215	1278	2793	2793		9606
QLFHPEQLITGKEDAANNYAR	21	Unmodified	_QLFHPEQLITGKEDAANNYAR_			0	0	1	P68363;P68366;Q71U36;P0DPH8;P0DPH7	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain	MULTI-MSMS	DP1141_9	4	805.9227905273438	3	805.7399	2414.19787	-0.0014363	-1.1573E-06	0.57726	0.00046512	0.57582	0.00046396	806.074783713959	18.587	0.49986	18.587	18.337	18.837	0					10	4	4	0	0	0	9.8385E-05	1	11632	11632		145.52	123.28	1	23397000			2079	321;442;322	1215	1278	2794	2794		9606
QLFHPEQLITGKEDAANNYAR	21	Unmodified	_QLFHPEQLITGKEDAANNYAR_			0	0	1	P68363;P68366;Q71U36;P0DPH8;P0DPH7	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain	MULTI-MSMS	DP1141_9	4	604.8081665039062	4	604.556744	2414.19787	-0.18828	-0.00011383	-0.32303	-0.00019529	-0.51131	-0.00030912	604.8071572007866	18.618	0.80025	18.618	18.137	18.937	0					20	7	5	0	0	0	0.0053943	1	11853	11853		90.442	70.53	1	50609000			2080	321;442;322	1215	1278	2795	2795		9606
QLQAAAAHWQQHQQHR	16	Unmodified	_QLQAAAAHWQQHQQHR_			0	0	0	P49750	P49750	P49750	YLPM1	YLP motif-containing protein 1	MULTI-MSMS	DP1141_7	2	485.238037109375	4	485.245204	1936.95171	0.48532	0.0002355	-0.25357	-0.00012304	0.23175	0.00011245	485.24515028902596	14.259	0.28779	14.259	14.121	14.408	0					6	2	3	0	0	0	0.0062828	1	5014	5014		108.32	75.794	1	4110900			2081	250	1216	1279	2796	2796		9606
QLTEEDGVHSVIEENIK	17	Unmodified	_QLTEEDGVHSVIEENIK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_10	5	647.8250732421875	3	647.325093	1938.95345	-0.80628	-0.00052192	1.1412	0.00073874	0.33494	0.00021682	647.3258311842045	18.306	0.59936	18.306	17.788	18.387	0					13	5	5	0	0	0	0.00016075	2	11722	11722;11880		115.09	85.369	1	54153000			2082	367	1217	1280	2797;2798	2797		9606
QLTEEDGVHSVIEENIK	17	Unmodified	_QLTEEDGVHSVIEENIK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	647.6593017578125	3	647.325093	1938.95345	0.84377	0.00054619	-0.61043	-0.00039514	0.23334	0.00015105	647.3246051585186	18.352	0.69953	18.352	18.005	18.705	0					15	6	5	0	0	0	0.00019859	2	10849	10750;10849		113.01	85.881	1	120840000			2083	367	1217	1280	2799;2800	2800		9606
QLTEEDGVHSVIEENIK	17	Unmodified	_QLTEEDGVHSVIEENIK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	970.484375	2	970.484002	1938.95345	0.52675	0.00051121	-0.022366	-2.1706E-05	0.50439	0.0004895	970.9854124445842	18.313	0.29953	18.313	18.105	18.405	0					10	2	5	0	0	0	4.9136999999999995E-124	2	10872	10872;10890		228.7	186.99	1	26831000			2084	367	1217	1280	2801;2802	2801		9606
QNLEPLFEQYINNLR	15	Unmodified	_QNLEPLFEQYINNLR_			0	0	0	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;CON__P13647;P13647;P04259	CON__P02538;CON__P13647;P04259	CON__P02538	KRT6A;KRT6C;KRT5;KRT6B	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B	MULTI-MSMS	DP1141_7	2	946.4908447265625	2	945.989057	1889.96356	0.42022	0.00039753	0.3734	0.00035324	0.79363	0.00075076	946.4912239143812	23.408	0.34918	23.408	23.132	23.481	0					11	4	4	0	0	0	4.1258E-22	2	19168	19092;19168		193.28	136.92	1	8555500		+	2085	10;101;18	1218	1281	2803;2804	2804		9606
QNLEPLFEQYINNLR	15	Unmodified	_QNLEPLFEQYINNLR_			0	0	0	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;CON__P13647;P13647;P04259	CON__P02538;CON__P13647;P04259	CON__P02538	KRT6A;KRT6C;KRT5;KRT6B	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B	MULTI-MSMS	DP1141_9	4	945.989501953125	2	945.989057	1889.96356	1.0056	0.00095125	-0.8201	-0.00077581	0.18546	0.00017545	945.9881024042628	23.437	0.25891	23.437	23.259	23.518	0					7	3	3	0	0	0	5.2605E-69	1	19046	19046		233.54	158.7	1	6184900		+	2086	10;101;18	1218	1281	2805	2805		9606
QNLEPLFEQYINNLRR	16	Unmodified	_QNLEPLFEQYINNLRR_			0	0	1	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;CON__P13647;P13647;P04259	CON__P02538;CON__P13647;P04259	CON__P02538	KRT6A;KRT6C;KRT5;KRT6B	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B	MULTI-MSMS	DP1141_7	2	683.036865234375	3	683.028834	2046.06467	0.71035	0.00048519	-0.073153	-4.9966E-05	0.6372	0.00043523	683.0288522581643	22.288	0.42609	22.288	22.146	22.572	0					5	4	2	0	0	0	0.018402	1	17407	17407		129.76	108.82	1	20612000		+	2087	10;101;18	1219	1282	2806	2806		9606
QNLEPLFEQYINNLRR	16	Unmodified	_QNLEPLFEQYINNLRR_			0	0	1	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;CON__P13647;P13647;P04259	CON__P02538;CON__P13647;P04259	CON__P02538	KRT6A;KRT6C;KRT5;KRT6B	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B	MULTI-MSMS	DP1141_9	4	683.0292358398438	3	683.028834	2046.06467	-0.13961	-9.5359E-05	0.76308	0.0005212	0.62347	0.00042584	683.363677927272	22.314	0.49985	22.314	21.93	22.43	0					12	5	4	0	0	0	0.0071722	1	17346	17346		129.54	96.835	1	30416000		+	2088	10;101;18	1219	1282	2807	2807		9606
QPTIFQNK	8	Unmodified	_QPTIFQNK_			0	0	0	P62280	P62280	P62280	RPS11	40S ribosomal protein S11	MULTI-MSMS	DP1141_10	5	488.2846984863281	2	488.266542	974.51853	0.50041	0.00024433	0.76082	0.00037148	1.2612	0.00061582	488.26678040509296	16.339	0.39442	16.339	16.066	16.46	0					9	3	3	0	0	0	0.0076964	1	8361	8361		111.65	53.044	1	20405000			2089	295	1220	1283	2808	2808		9606
QQVPSGESAILDR	13	Unmodified	_QQVPSGESAILDR_			0	0	0	P09874	P09874	P09874	PARP1	Poly [ADP-ribose] polymerase 1	MSMS	DP1141_7	2	700.3592529296875	2	700.36243	1398.71031	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.276	1	17.276	16.776	17.776	0								0	0	0	0.019311	1	9730	9730		116.77	57.416	1				2090	131	1221	1284	2809	2809		9606
QRPSEIKDYSPYFK	14	Unmodified	_QRPSEIKDYSPYFK_			0	0	2	CON__P08779;P08779	CON__P08779	CON__P08779	KRT16	Keratin, type I cytoskeletal 16	MULTI-MSMS	DP1141_9	4	440.22332763671875	4	440.226885	1756.87843	-0.043606	-1.9197E-05	-2.8078	-0.0012361	-2.8514	-0.0012553	440.4777222118233	17.188	0.58086	17.188	16.957	17.537	0					10	5	3	0	0	0	0.020261	1	9459	9459		62.298	43.011	1	67177000		+	2091	16	1222	1285	2810	2810		9606
QRQEEPPPGPQRPDQSAAAAGPGDPK	26	Unmodified	_QRQEEPPPGPQRPDQSAAAAGPGDPK_			0	0	2	Q9BQ61	Q9BQ61	Q9BQ61	C19orf43	Uncharacterized protein C19orf43	MULTI-MSMS	DP1141_10	5	671.3326416015625	4	671.081115	2680.29535	-0.071198	-4.778E-05	1.2184	0.00081766	1.1472	0.00076988	671.333280521849	14.509	0.58255	14.509	14.153	14.736	0					24	8	6	0	0	0	1.0577E-05	1	5565	5565		78.531	43.494	1	35367000			2092	535	1223	1286	2811	2811		9606
QSNVAAPGDATPPAEK	16	Unmodified	_QSNVAAPGDATPPAEK_			0	0	0	Q96QC0	Q96QC0	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	MULTI-MSMS	DP1141_7	2	777.3860473632812	2	776.883726	1551.7529	0.45244	0.00035149	-0.096093	-7.4653E-05	0.35635	0.00027684	776.8835776826597	14.759	0.40066	14.759	14.508	14.909	0					5	3	2	0	0	0	0.025371	1	5739	5739		101.56	73.784	1	25700000			2093	520	1224	1287	2812	2812		9606
QSNVAAPGDATPPAEKK	17	Unmodified	_QSNVAAPGDATPPAEKK_			0	0	1	Q96QC0	Q96QC0	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	MULTI-MSMS	DP1141_7	2	561.2908325195312	3	560.956564	1679.84786	0.46856	0.00026284	-0.14107	-7.9132E-05	0.32749	0.00018371	560.9565551152793	13.74	0.80918	13.74	13.226	14.035	0					20	8	3	0	0	0	7.432E-88	2	4171	3965;4171		182.7	162.42	1	33297000			2094	520	1225	1288	2813;2814	2814		9606
QSNVAAPGDATPPAEKK	17	Unmodified	_QSNVAAPGDATPPAEKK_			0	0	1	Q96QC0	Q96QC0	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	MULTI-MSMS	DP1141_8	3	560.9564208984375	3	560.956564	1679.84786	-0.24272	-0.00013615	0.49141	0.00027566	0.24869	0.0001395	560.956806095233	13.845	0.44778	13.845	13.52	13.968	0					15	5	4	0	0	0	8.4721E-105	2	4124	4031;4124		178.47	148.3	1	12253000			2095	520	1225	1288	2815;2816	2816		9606
QSNVAAPGDATPPAEKK	17	Unmodified	_QSNVAAPGDATPPAEKK_			0	0	1	Q96QC0	Q96QC0	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	MULTI-MSMS	DP1141_9	4	560.9569091796875	3	560.956564	1679.84786	0.2803	0.00015723	0.14229	7.9821E-05	0.42259	0.00023705	561.290800789537	13.779	0.51958	13.779	13.474	13.994	0					9	7	2	0	0	0	4.4347E-10	1	4010	4010		140.77	119.52	1	5654600			2096	520	1225	1288	2817	2817		9606
QSVEADINGLRR	12	Unmodified	_QSVEADINGLRR_			0	0	1	CON__P13645;P13645;CON__P02535-1	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_10	5	679.3630981445312	2	679.362764	1356.71098	-0.11412	-7.7531E-05	0.58472	0.00039724	0.47059	0.0003197	679.3633047147422	16.999	0.20912	16.999	16.878	17.087	0					6	2	3	0	0	0	0.028855	1	9748	9748		120.45	44.225	1	17705000		+	2097	17	1226	1289	2818	2818		9606
QSVEADINGLRR	12	Unmodified	_QSVEADINGLRR_			0	0	1	CON__P13645;P13645;CON__P02535-1	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-SECPEP	DP1141_6	1	452.73443603515625	3	453.244268	1356.71098	0.40277	0.00018255	0.1811	8.2085E-05	0.58388	0.00026464	453.2444097206031	17.053	0.37987	17.053	16.824	17.204	0					6	4	2	0	0	0	0.0081009	1	8664	8664		83.081	46.017	1	82292000		+	2098	17	1226	1289	2819	2819		9606
QSVEADINGLRR	12	Unmodified	_QSVEADINGLRR_			0	0	1	CON__P13645;P13645;CON__P02535-1	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-SECPEP	DP1141_7	2	453.59466552734375	3	453.244268	1356.71098	0.69073	0.00031307	-0.14542	-6.5912E-05	0.54531	0.00024716	453.2442365563163	17.003	0.31761	17.003	16.831	17.149	0					5	3	2	0	0	0	0.0082552	1	9269	9269		81.625	50.439	1	269180000		+	2099	17	1226	1289	2820	2820		9606
QTFEAAILTQLHPR	14	Unmodified	_QTFEAAILTQLHPR_			0	0	0	Q9NPD3	Q9NPD3	Q9NPD3	EXOSC4	Exosome complex component RRP41	MULTI-MSMS	DP1141_10	5	542.633056640625	3	542.298373	1623.87329	0.43053	0.00023347	0.12579	6.8213E-05	0.55631	0.00030169	542.2984653854917	20.626	0.4994	20.626	20.176	20.676	0					7	4	3	0	0	0	0.014135	1	15429	15429		70.373	49.946	1	40351000			2100	570	1227	1290	2821	2821		9606
QTLMWSATWPK	11	Unmodified	_QTLMWSATWPK_			0	0	0	Q92841;P17844	Q92841;P17844	P17844	DDX17;DDX5	Probable ATP-dependent RNA helicase DDX17;Probable ATP-dependent RNA helicase DDX5	MSMS	DP1141_8	3	674.8634033203125	2	674.839548	1347.66454	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.958	1	20.958	20.458	21.458	0								0	0	0	0.027555	1	15251	15251		112.71	69.429	1				2101	163;496	1228	1291	2822	2822		9606
QTLPVAPR	8	Unmodified	_QTLPVAPR_			0	0	0	Q6PJT7	Q6PJT7	Q6PJT7	ZC3H14	Zinc finger CCCH domain-containing protein 14	MULTI-SECPEP	DP1141_7	2	441.20086669921875	2	441.263802	880.513051	0.27878	0.00012301	0.37509	0.00016551	0.65387	0.00028853	441.2638920367052	15.596	0.30504	15.596	15.409	15.714	0					4	2	2	0	0	0	0.035858	1	7055	7055		95.741	40.211	1	4480700			2102	433	1229	1292	2823	2823		9606
QTLPVAPR	8	Unmodified	_QTLPVAPR_			0	0	0	Q6PJT7	Q6PJT7	Q6PJT7	ZC3H14	Zinc finger CCCH domain-containing protein 14	MULTI-SECPEP	DP1141_8	3	440.8934326171875	2	441.263802	880.513051	0.16985	7.4948E-05	-0.0068461	-3.0209E-06	0.163	7.1927E-05	441.2637675321711	15.625	0.30495	15.625	15.37	15.675	0					4	2	2	0	0	0	0.001002	1	6960	6960		127.46	81.51	1	27473000			2103	433	1229	1292	2824	2824		9606
QTTTGSAVPIR	11	Unmodified	_QTTTGSAVPIR_			0	0	0	O00763	O00763	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	MSMS	DP1141_6	1	565.8253784179688	2	565.811845	1129.60914	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.916	1	14.916	14.416	15.416	0								0	0	0	7.6606E-11	1	5295	5295		149.82	92.639	1				2104	40	1230	1293	2825	2825		9606
QTVMFSATFPR	11	Oxidation (M)	_QTVM(Oxidation (M))FSATFPR_	QTVM(1)FSATFPR	QTVM(130)FSATFPR	0	1	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-MSMS	DP1141_6	1	651.3434448242188	2	650.821355	1299.62816	0.34308	0.00022328	1.0048	0.00065394	1.3479	0.00087722	651.3236179173704	18.903	0.30059	18.903	18.705	19.005	0					4	2	2	0	0	0	0.015322	1	11762	11762		125.97	88.625	1	3287500			2105	445	1231	1294	2826	2826	328	9606
QVGYENAGTVEFLVDR	16	Unmodified	_QVGYENAGTVEFLVDR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	898.9055786132812	2	898.944315	1795.87408	0.69856	0.00062797	-0.18872	-0.00016965	0.50984	0.00045832	898.9442253920505	20.601	0.49962	20.601	20.351	20.85	0					11	4	4	0	0	0	6.7068E-240	2	14956	14956;15245		256.47	207.52	1	263450000			2106	142	1232	1295	2827;2828	2827		9606
QVGYENAGTVEFLVDR	16	Unmodified	_QVGYENAGTVEFLVDR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	899.4837036132812	2	898.944315	1795.87408	0.37472	0.00033685	0.50118	0.00045053	0.87589	0.00078738	899.446348228233	20.527	0.50068	20.527	20.377	20.878	0					8	4	3	0	0	0	3.3857E-139	1	14762	14762		225.63	177.35	1	14406000			2107	142	1232	1295	2829	2829		9606
QVIGTGSFFPK	11	Unmodified	_QVIGTGSFFPK_			0	0	0	Q13642	Q13642	Q13642	FHL1	Four and a half LIM domains protein 1	MULTI-MSMS	DP1141_9	4	590.8219604492188	2	590.821681	1179.62881	0.45224	0.00026719	-0.52626	-0.00031092	-0.074021	-4.3733E-05	591.3224718470092	19.489	0.50109	19.489	19.138	19.639	0					7	4	2	0	0	0	0.0045549	1	13231	13231		104.42	53.078	1	6369300			2108	379	1233	1296	2830	2830		9606
QVLDNLTMEK	10	Oxidation (M)	_QVLDNLTM(Oxidation (M))EK_	QVLDNLTM(1)EK	QVLDNLTM(95)EK	0	1	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MSMS	DP1141_9	4	603.8057250976562	2	603.805371	1205.59619	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.094	1	17.094	16.594	17.594	0								0	0	0	0.018648	1	9268	9268		95.358	42.955	1			+	2109	19	1234	1297	2831	2831	20	9606
QVLIASHLPSYELR	14	Unmodified	_QVLIASHLPSYELR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	542.97265625	3	542.638507	1624.89369	0.46784	0.00025387	-0.51236	-0.00027803	-0.044523	-2.416E-05	542.638391260117	18.955	0.60101	18.955	18.604	19.205	0					15	5	5	0	0	0	0.0025156	3	11865	11865;11938;11953		101.43	49.359	1	490170000			2110	367	1235	1298	2832;2833;2834	2832		9606
QVLIASHLPSYELR	14	Unmodified	_QVLIASHLPSYELR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	813.4542236328125	2	813.454122	1624.89369	0.49947	0.0004063	-0.33116	-0.00026938	0.16831	0.00013692	813.4538223848823	18.955	0.40066	18.955	18.705	19.105	0					7	3	3	0	0	0	0.0019869	2	11955	11955;11960		122.69	62.568	1	130570000			2111	367	1235	1298	2835;2836	2835		9606
QVQAEVPGSPIFVMR	15	Oxidation (M)	_QVQAEVPGSPIFVM(Oxidation (M))R_	QVQAEVPGSPIFVM(1)R	QVQAEVPGSPIFVM(160)R	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	837.3900756835938	2	837.437615	1672.86068	1.1262	0.00094311	-1.1874	-0.00099439	-0.061234	-5.128E-05	837.4367803018904	19.155	0.60048	19.155	18.905	19.506	0					12	5	4	0	0	0	3.7101E-08	2	12009	11976;12009		158.08	98.172	1	333310000			2112	367	1236	1299	2837;2838	2838	283	9606
QVQAEVPGSPIFVMR	15	Unmodified	_QVQAEVPGSPIFVMR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	829.4404296875	2	829.440157	1656.86576	1.0135	0.00084061	-0.62213	-0.00051602	0.39133	0.00032459	829.4396707129102	20.341	0.39136	20.341	20.19	20.582	0					14	3	6	0	0	0	0	5	14091	13908;13999;14071;14091;14093		275.84	245.83	1	134610000			2113	367	1236	1300	2839;2840;2841;2842;2843	2842		9606
QVQAEVPGSPIFVMR	15	Unmodified	_QVQAEVPGSPIFVMR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	829.4411010742188	2	829.440157	1656.86576	1.2331	0.0010228	-0.79711	-0.00066115	0.43599	0.00036162	829.4397546034021	22.762	0.1448	22.762	22.685	22.83	0					6	2	3	0	0	0	0.022321	1	17679	17679		70.728	42.02	1	4887600			2114	367	1236	1300	2844	2844		9606
QVQAEVPGSPIFVMR	15	Unmodified	_QVQAEVPGSPIFVMR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	552.6665649414062	3	553.295864	1656.86576	0.24462	0.00013535	0.10239	5.6651E-05	0.34701	0.000192	553.6301911002645	20.341	0.29469	20.341	20.19	20.485	0					4	2	2	0	0	0	0.011565	1	13969	13969		79.875	56.033	1	2324600			2115	367	1236	1300	2845	2845		9606
QVQPQVQPQAHSQGPR	16	Unmodified	_QVQPQVQPQAHSQGPR_			0	0	0	Q9ULV3	Q9ULV3	Q9ULV3	CIZ1	Cip1-interacting zinc finger protein	MULTI-SECPEP	DP1141_7	2	596.2862548828125	3	595.643202	1783.90778	0.89205	0.00053134	-0.38869	-0.00023152	0.50337	0.00029983	595.9773474407773	13.819	0.24156	13.819	13.62	13.861	0					4	2	2	0	0	0	0.0050866	1	4214	4214		83.856	64.018	1	4366100			2116	601	1237	1301	2846	2846		9606
QVSDLISVLR	10	Unmodified	_QVSDLISVLR_			0	0	0	P17844	P17844	P17844	DDX5	Probable ATP-dependent RNA helicase DDX5	MSMS	DP1141_9	4	565.3038940429688	2	565.332413	1128.65027	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.573	1	20.573	20.073	21.073	0								0	0	0	0.024515	1	14731	14731		103.55	32.167	1				2117	163	1238	1302	2847	2847		9606
QVVNIPSFIVR	11	Unmodified	_QVVNIPSFIVR_			0	0	0	P46781	P46781	P46781	RPS9	40S ribosomal protein S9	MULTI-MSMS	DP1141_10	5	636.377685546875	2	636.377155	1270.73976	-0.096936	-6.1688E-05	0.80103	0.00050976	0.7041	0.00044807	636.3775861154478	20.892	0.39971	20.892	20.576	20.975	0					9	3	3	0	0	0	4.3522E-14	1	15841	15841		164.46	115.04	1	31428000			2118	236	1239	1303	2848	2848		9606
QVVQTPNTVLSTPFR	15	Unmodified	_QVVQTPNTVLSTPFR_			0	0	0	Q99459	Q99459	Q99459	CDC5L	Cell division cycle 5-like protein	MSMS	DP1141_7	2	843.9577026367188	2	843.962311	1685.91007	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.538	1	19.538	19.038	20.038	0								0	0	0	3.1945E-05	1	13319	13319		136.81	90.898	1				2119	526	1240	1304	2849	2849		9606
RAGELTEDEVER	12	Unmodified	_RAGELTEDEVER_			0	0	1	P62269	P62269	P62269	RPS18	40S ribosomal protein S18	MSMS	DP1141_10	5	702.3418579101562	2	702.341694	1402.66884	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.914	1	14.914	14.414	15.414	0								0	0	0	9.037399999999999E-32	1	6203	6203		167.18	112.64	1				2120	293	1241	1305	2850	2850		9606
RATVNTFGYIAK	12	Unmodified	_RATVNTFGYIAK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	447.5823059082031	3	447.582221	1339.72483	0.70527	0.00031567	-0.24822	-0.0001111	0.45705	0.00020457	447.5819839585464	16.881	0.47138	16.881	16.58	17.051	0					12	5	5	0	0	0	0.0031147	1	9137	9137		97.779	74.068	1	121760000			2121	78	1242	1306	2851	2851		9606
RATVNTFGYIAK	12	Unmodified	_RATVNTFGYIAK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-SECPEP	DP1141_7	2	670.6731567382812	2	670.869694	1339.72483	0.56322	0.00037785	0.17827	0.0001196	0.74149	0.00049744	670.8697477360581	16.884	0.313	16.884	16.738	17.051	0					11	3	5	0	0	0	0.0050423	1	9098	9098		77.533	23.777	1	269980000			2122	78	1242	1306	2852	2852		9606
RATVNTFGYIAK	12	Unmodified	_RATVNTFGYIAK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-SECPEP	DP1141_8	3	447.2115783691406	3	447.582221	1339.72483	-0.11426	-5.114E-05	0.055024	2.4628E-05	-0.059234	-2.6512E-05	447.5822091543632	16.878	0.34167	16.878	16.731	17.073	0					5	3	2	0	0	0	0.0024144	1	8990	8990		94.402	70.653	1	20609000			2123	78	1242	1306	2853	2853		9606
RAYIAYELNSVQHR	14	Unmodified	_RAYIAYELNSVQHR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	574.3046875	3	573.969027	1718.88525	0.61204	0.00035129	-0.23154	-0.0001329	0.38049	0.00021839	573.9689746922752	17.153	0.3693	17.153	16.935	17.304	0					8	3	3	0	0	0	1.2221E-81	1	9004	9004		206.66	150.68	1	315530000			2124	367	1243	1307	2854	2854		9606
REEEEFNTGPLSVLTQSVK	19	Unmodified	_REEEEFNTGPLSVLTQSVK_			0	0	1	P62316	P62316	P62316	SNRPD2	Small nuclear ribonucleoprotein Sm D2	MULTI-MSMS	DP1141_10	5	721.68115234375	3	721.702452	2162.08553	1.5003	0.0010828	-1.003	-0.00072388	0.49726	0.00035888	722.0359484804324	20.58	0.59924	20.58	20.176	20.775	0					12	5	3	0	0	0	0.030467	1	15370	15370		58.835	34.11	1	11598000			2125	298	1244	1308	2855	2855		9606
RELHGQNPVVTPCNK	15	Unmodified	_RELHGQNPVVTPCNK_			0	0	1	Q16630	Q16630	Q16630	CPSF6	Cleavage and polyadenylation specificity factor subunit 6	MULTI-SECPEP	DP1141_10	5	583.2859497070312	3	583.633538	1747.87879	0.54869	0.00032024	0.07964	4.6481E-05	0.62833	0.00036672	583.6346480778583	13.959	0.31796	13.959	13.772	14.09	0					18	5	6	0	0	0	0.00844	1	4776	4776		75.764	46.078	1	3418400			2126	413	1245	1309	2856	2856		9606
RELHGQNPVVTPCNK	15	Unmodified	_RELHGQNPVVTPCNK_			0	0	1	Q16630	Q16630	Q16630	CPSF6	Cleavage and polyadenylation specificity factor subunit 6	MULTI-MSMS	DP1141_9	4	583.6348266601562	3	583.633538	1747.87879	0.38682	0.00022576	0.21813	0.00012731	0.60495	0.00035307	583.9677111520839	14.02	0.43628	14.02	13.81	14.247	0					13	6	4	0	0	0	0.004873	2	4273	4273;4335		113.53	80.223	1	7237700			2127	413	1245	1309	2857;2858	2857		9606
RFEDFTR	7	Unmodified	_RFEDFTR_			0	0	1	O00763	O00763	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	MSMS	DP1141_6	1	485.9004211425781	2	485.740691	969.466829	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.076	1	16.076	15.576	16.576	0								0	0	0	0.020891	1	7087	7087		125.31	53.6	1				2128	40	1246	1310	2859	2859		9606
RFVTPSEPVAHSR	13	Unmodified	_RFVTPSEPVAHSR_			0	0	1	O14654	O14654	O14654	IRS4	Insulin receptor substrate 4	MULTI-MSMS	DP1141_6	1	494.93206787109375	3	494.931913	1481.77391	-0.30924	-0.00015305	0.16216	8.0259E-05	-0.14707	-7.2791E-05	494.93199304399894	14.758	0.59301	14.758	14.215	14.808	0					8	5	2	0	0	0	0.0002961	1	5092	5092		127.79	107.41	1	12463000			2129	44	1247	1311	2860	2860		9606
RGIEKPPFELPDFIK	15	Unmodified	_RGIEKPPFELPDFIK_			0	0	2	Q13435	Q13435	Q13435	SF3B2	Splicing factor 3B subunit 2	MULTI-MSMS	DP1141_7	2	596.0015869140625	3	596.001445	1784.98251	0.76687	0.00045706	-0.29845	-0.00017788	0.46842	0.00027918	596.3355294733773	20.045	0.50071	20.045	19.85	20.351	0					11	4	4	0	0	0	0.015655	1	14379	14379		77.051	46.477	1	10375000			2130	374	1248	1312	2861	2861		9606
RHEAAVPPLAIPSARPEK	18	Unmodified	_RHEAAVPPLAIPSARPEK_			0	0	2	Q6PJT7	Q6PJT7	Q6PJT7	ZC3H14	Zinc finger CCCH domain-containing protein 14	MULTI-MSMS	DP1141_7	2	485.5905456542969	4	485.527259	1938.07993	0.58775	0.00028537	-0.51571	-0.00025039	0.072048	3.4981E-05	485.52696869733484	16.165	0.30042	16.165	16.014	16.315	0					4	2	2	0	0	0	0.033012	1	8016	8016		54.292	44.712	1	16955000			2131	433	1249	1313	2862	2862		9606
RHEAAVPPLAIPSARPEK	18	Unmodified	_RHEAAVPPLAIPSARPEK_			0	0	2	Q6PJT7	Q6PJT7	Q6PJT7	ZC3H14	Zinc finger CCCH domain-containing protein 14	MULTI-MSMS	DP1141_8	3	485.9125061035156	4	485.527259	1938.07993	0.19599	9.5161E-05	0.1348	6.5451E-05	0.3308	0.00016061	485.77806188907283	16.204	0.5006	16.204	15.776	16.276	0					9	4	4	0	0	0	0.0024491	1	7936	7936		93.738	77.748	1	35218000			2132	433	1249	1313	2863	2863		9606
RHPDYSVVLLLR	12	Unmodified	_RHPDYSVVLLLR_			0	0	1	CON__P02768-1;P02768	CON__P02768-1	CON__P02768-1	ALB	Serum albumin	MULTI-MSMS	DP1141_7	2	489.9548645019531	3	489.952537	1466.83578	0.078078	3.8255E-05	-0.9246	-0.00045301	-0.84652	-0.00041476	490.2859707145484	19.453	0.60082	19.453	18.95	19.551	0					7	5	2	0	0	0	0.0031305	1	13030	13030		96.756	74.896	1	75749000		+	2133	14	1250	1314	2864	2864		9606
RHPEYAVSVLLR	12	Unmodified	_RHPEYAVSVLLR_			0	0	1	CON__P02769	CON__P02769	CON__P02769			MULTI-SECPEP	DP1141_8	3	480.7849426269531	3	480.60877	1438.80448	0.60422	0.00029039	-0.25761	-0.00012381	0.34661	0.00016658	480.60866229074514	17.925	0.30109	17.925	17.774	18.075	0					4	2	2	0	0	0	0.011448	1	10780	10780		73.927	52.681	1	39892000		+	2134	15	1251	1315	2865	2865		
RHPEYAVSVLLR	12	Unmodified	_RHPEYAVSVLLR_			0	0	1	CON__P02769	CON__P02769	CON__P02769			MULTI-MSMS	DP1141_9	4	480.6221618652344	3	480.60877	1438.80448	0.30845	0.00014824	0.12168	5.8482E-05	0.43013	0.00020673	480.6088364451587	17.987	0.49959	17.987	17.738	18.237	0					9	4	3	0	0	0	0.0031353	2	10765	10708;10765		105.95	74.295	1	28132000		+	2135	15	1251	1315	2866;2867	2867		
RHPYFYAPELLYYANK	16	Unmodified	_RHPYFYAPELLYYANK_			0	0	1	CON__P02769	CON__P02769	CON__P02769			MULTI-MSMS	DP1141_10	5	682.682861328125	3	682.347504	2044.02068	0.93884	0.00064062	0.52712	0.00035968	1.466	0.0010003	682.6820851992876	20.257	0.69945	20.257	19.976	20.676	0					10	6	3	0	0	0	0.029672	1	14972	14972		59.634	41.096	1	17735000		+	2136	15	1252	1316	2868	2868		
RIDISPSTFR	10	Unmodified	_RIDISPSTFR_			0	0	1	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-SECPEP	DP1141_7	2	596.3154907226562	2	596.327662	1190.64077	0.76078	0.00045367	0.13783	8.2193E-05	0.89861	0.00053587	596.3277459442445	17.499	0.30014	17.499	17.249	17.549	0					4	2	2	0	0	0	0.0017159	1	10053	10053		109.44	65.062	1	25547000			2137	612	1253	1317	2869	2869		9606
RIGYPVMIK	9	Oxidation (M)	_RIGYPVM(Oxidation (M))IK_	RIGYPVM(1)IK	RIGYPVM(90)IK	0	1	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-SECPEP	DP1141_6	1	546.8154296875	2	546.815344	1091.61614	-0.27316	-0.00014937	0.44323	0.00024237	0.17008	9.3E-05	546.8155892052333	16.455	0.5239	16.455	16.205	16.729	0					10	5	3	0	0	0	0.0043374	1	7909	7909		89.752	52.593	1	46726000			2138	521	1254	1318	2870	2870	376	9606
RIGYPVMIK	9	Oxidation (M)	_RIGYPVM(Oxidation (M))IK_	RIGYPVM(1)IK	RIGYPVM(100)IK	0	1	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	546.8154907226562	2	546.815344	1091.61614	0.36967	0.00020214	-0.31642	-0.00017303	0.053251	2.9118E-05	546.8151798833809	16.426	0.55505	16.426	16.176	16.731	0					13	5	3	0	0	0	0.014578	1	8237	8237		104.75	71.906	1	191740000			2139	521	1254	1318	2871	2871	376	9606
RIPSIVSSPLNSPLDR	16	Unmodified	_RIPSIVSSPLNSPLDR_			0	0	1	P49790	P49790	P49790	NUP153	Nuclear pore complex protein Nup153	MULTI-MSMS	DP1141_8	3	584.6665649414062	3	584.331854	1749.97373	0.44171	0.00025811	-0.19877	-0.00011615	0.24294	0.00014196	584.6661697105885	19.225	0.39922	19.225	18.876	19.275	0					8	3	3	0	0	0	0.0013949	1	12644	12644		123.08	94.001	1	24716000			2140	252	1255	1319	2872	2872		9606
RIPSIVSSPLNSPLDR	16	Unmodified	_RIPSIVSSPLNSPLDR_			0	0	1	P49790	P49790	P49790	NUP153	Nuclear pore complex protein Nup153	MULTI-SECPEP	DP1141_9	4	584.33154296875	3	584.331854	1749.97373	0.45812	0.00026769	-0.67763	-0.00039596	-0.21951	-0.00012827	584.6657293524746	19.152	0.40094	19.152	18.937	19.338	0					5	3	2	0	0	0	0.0088875	1	12739	12739		72.489	33.541	1	5602100			2141	252	1255	1319	2873	2873		9606
RIPVMYQHHTDLNPIEVAIDEMSKK	25	Oxidation (M)	_RIPVMYQHHTDLNPIEVAIDEM(Oxidation (M))SKK_	RIPVMYQHHTDLNPIEVAIDEM(1)SKK	RIPVM(-46)YQHHTDLNPIEVAIDEM(46)SKK	0	1	2	Q9BZ29	Q9BZ29	Q9BZ29	DOCK9	Dedicator of cytokinesis protein 9	MULTI-MSMS	DP1141_7	2	746.3834228515625	4	745.880938	2979.49465	0.89319	0.00066621	1.1672	0.0008706	2.0604	0.0015368	746.3833888106617	20.901	0.4994	20.901	20.551	21.05	0					6	4	2	0	0	0	0.0023069	1	15521	15521		52.03	21.446	2	31511000			2142	546	1256	1320	2874	2874	391	9606
RIPVQAVWAGWGHASENPK	19	Unmodified	_RIPVQAVWAGWGHASENPK_			0	0	1	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	702.0353393554688	3	701.70094	2102.08099	1.0264	0.00072023	-0.34583	-0.00024267	0.68058	0.00047756	702.0350575864956	19.055	0.60078	19.055	18.705	19.305	0					14	5	4	0	0	0	2.3092E-89	1	11965	11965		206.81	178.65	1	160680000			2143	367;40	1257	1321	2875	2875		9606
RIPVQAVWAGWGHASENPK	19	Unmodified	_RIPVQAVWAGWGHASENPK_			0	0	1	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	702.0357055664062	3	701.70094	2102.08099	0.62015	0.00043516	0.1543	0.00010827	0.77445	0.00054343	702.0352370493235	18.9	0.40021	18.9	18.65	19.05	0					5	3	2	0	0	0	0.0066313	1	12527	12527		77.505	54.538	1	34549000			2144	367;40	1257	1321	2876	2876		9606
RIPVQAVWAGWGHASENPK	19	Unmodified	_RIPVQAVWAGWGHASENPK_			0	0	1	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-SECPEP	DP1141_9	4	701.8423461914062	3	701.70094	2102.08099	0.63759	0.0004474	-0.34495	-0.00024205	0.29264	0.00020535	702.0348770900738	18.987	0.40026	18.987	18.637	19.037	0					5	3	2	0	0	0	1.1875E-06	1	12247	12247		101.08	76.052	1	28253000			2145	367;40	1257	1321	2877	2877		9606
RISTLTIEEGNLDIQRPK	18	Unmodified	_RISTLTIEEGNLDIQRPK_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	695.39013671875	3	695.055049	2082.14332	0.86761	0.00060304	-0.052413	-3.643E-05	0.81519	0.0005666	695.3893235912404	18.025	0.40087	18.025	17.674	18.075	0					9	3	4	0	0	0	6.2030000000000006E-24	2	10913	10792;10913		172.95	153.63	1	518910000			2146	365	1258	1322	2878;2879	2879		9606
RISTLTIEEGNLDIQRPK	18	Unmodified	_RISTLTIEEGNLDIQRPK_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-SECPEP	DP1141_8	3	520.923583984375	4	521.543106	2082.14332	0.33752	0.00017603	0.19027	9.9233E-05	0.52779	0.00027526	521.793878115574	18.025	0.30109	18.025	17.774	18.075	0					6	2	3	0	0	0	2.4233E-05	1	10801	10801		101.08	84.276	1	32437000			2147	365	1258	1322	2880	2880		9606
RISTLTIEEGNLDIQRPK	18	Unmodified	_RISTLTIEEGNLDIQRPK_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	695.3897094726562	3	695.055049	2082.14332	0.31971	0.00022222	0.18638	0.00012955	0.50609	0.00035176	695.3894335404175	17.987	0.2994	17.987	17.837	18.137	0					8	2	4	0	0	0	0.0019716	1	10884	10884		128.1	101.75	1	54311000			2148	365	1258	1322	2881	2881		9606
RKGDEVDGVDEVAK	14	Unmodified	_RKGDEVDGVDEVAK_			0	0	2	P09874	P09874	P09874	PARP1	Poly [ADP-ribose] polymerase 1	MULTI-MSMS	DP1141_7	2	506.2730712890625	3	506.258243	1515.7529	0.24747	0.00012528	1.4097	0.00071366	1.6572	0.00083895	506.25917062255735	14.259	0.56132	14.259	13.947	14.508	0					9	5	3	0	0	0	0.0081978	2	4891	4891;4934		88.311	52.373	1	15445000			2149	131	1259	1323	2882;2883	2882		9606
RKPPAMGQAPPATNEQK	17	Unmodified	_RKPPAMGQAPPATNEQK_			0	0	2	Q86UE8	Q86UE8	Q86UE8	TLK2	Serine/threonine-protein kinase tousled-like 2	MULTI-SECPEP	DP1141_8	3	608.0360107421875	3	607.65271	1819.9363	0.36847	0.0002239	-0.19866	-0.00012072	0.16981	0.00010319	607.9869329779735	12.756	0.68227	12.756	12.606	13.288	0					8	6	2	0	0	0	0.004297	1	2837	2837		81.992	81.992	1	1471800			2150	457	1260	1324	2884	2884		9606
RKTMQPHLLTK	11	Oxidation (M)	_RKTM(Oxidation (M))QPHLLTK_	RKTM(1)QPHLLTK	RKTM(76)QPHLLTK	0	1	2	Q92817	Q92817	Q92817	EVPL	Envoplakin	MULTI-SECPEP	DP1141_9	4	685.3889770507812	2	684.892646	1367.77074	0.036481	2.4986E-05	-4.1574	-0.0028474	-4.1209	-0.0028224	684.8903519330365	17.277	0.75568	17.277	16.782	17.537	0					11	8	2	0	0	0	0.0095688	1	9577	9577		76.282	36.345	1	11036000			2151	495	1261	1325	2885	2885	360	9606
RLDLASLMSAPK	12	Acetyl (Protein N-term),Oxidation (M)	_(Acetyl (Protein N-term))RLDLASLM(Oxidation (M))SAPK_	RLDLASLM(1)SAPK	RLDLASLM(48)SAPK	1	1	1	Q8NG04	Q8NG04	Q8NG04	SLC26A10	Solute carrier family 26 member 10	MSMS	DP1141_9	4	680.339599609375	2	680.368669	1358.72279	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.244	1	21.244	20.744	21.744	0								0	0	0	0.033409	1	15733	15733		47.706	8.159	1				2152	475	1262	1326	2886	2886	352	9606
RLLLMELQMWSGQDSAR	17	Oxidation (M)	_RLLLM(Oxidation (M))ELQMWSGQDSAR_	RLLLM(0.999)ELQM(0.001)WSGQDSAR	RLLLM(33)ELQM(-33)WSGQDSAR	0	1	1		REV__Q96LM9	REV__Q96LM9			MULTI-MSMS	DP1141_10	5	1026.013916015625	2	1025.51406	2049.01356	0.62435	0.00064028	0.99783	0.0010233	1.6222	0.0016636	1026.0164449637339	20.825	1.2832	20.825	20.176	21.459	0					30	12	5	0	0	0	0.035947	1	15784	15784		89.356	22.693	2	144230000	+		2153	630	1263	1327	2887	2887	432	9606
RLNISYTR	8	Unmodified	_RLNISYTR_			0	0	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-SECPEP	DP1141_10	5	511.2884521484375	2	511.790715	1021.56688	0.3374	0.00017268	-0.37692	-0.0001929	-0.03952	-2.0226E-05	511.7905460040893	15.506	0.50565	15.506	15.368	15.873	0					10	5	3	0	0	0	0.026345	1	7138	7138		153.04	96.315	1	50370000			2154	521	1264	1328	2888	2888		9606
RLNISYTR	8	Unmodified	_RLNISYTR_			0	0	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-SECPEP	DP1141_6	1	512.282958984375	2	511.790715	1021.56688	-0.14646	-7.4954E-05	0.31237	0.00015987	0.16591	8.4913E-05	511.7908159451956	15.563	0.59636	15.563	15.408	16.005	0					10	5	3	0	0	0	0.00017061	1	6264	6264		120.15	82.343	1	162110000			2155	521	1264	1328	2889	2889		9606
RLNISYTR	8	Unmodified	_RLNISYTR_			0	0	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-SECPEP	DP1141_7	2	511.5281066894531	2	511.790715	1021.56688	-0.078688	-4.0272E-05	-0.53504	-0.00027383	-0.61373	-0.0003141	511.7903752201062	15.564	0.70511	15.564	15.409	16.114	0					8	6	2	0	0	0	0.00026512	1	6892	6892		150.36	79.066	1	93676000			2156	521	1264	1328	2890	2890		9606
RLNISYTR	8	Unmodified	_RLNISYTR_			0	0	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-SECPEP	DP1141_8	3	511.2745361328125	2	511.790715	1021.56688	0.56108	0.00028715	-0.30313	-0.00015514	0.25795	0.00013202	511.7906646163506	15.524	0.50561	15.524	15.37	15.876	0					9	4	3	0	0	0	0.010815	1	6905	6905		98.629	51.635	1	958860000			2157	521	1264	1328	2891	2891		9606
RLPGPDELFR	10	Unmodified	_RLPGPDELFR_			0	0	1	Q8N6N3	Q8N6N3	Q8N6N3	C1orf52	UPF0690 protein C1orf52	MULTI-SECPEP	DP1141_10	5	600.6596069335938	2	600.330205	1198.64586	0.94251	0.00056582	-0.96873	-0.00058156	-0.026219	-1.574E-05	600.3296700189309	19.027	0.58997	19.027	18.587	19.177	0					9	5	2	0	0	0	0.0022405	1	13020	13020		95.775	21.336	1	15240000			2158	471	1265	1329	2892	2892		9606
RLQIEESSKPVR	12	Unmodified	_RLQIEESSKPVR_			0	0	2	P13984	P13984	P13984	GTF2F2	General transcription factor IIF subunit 2	MSMS	DP1141_10	5	481.2757568359375	3	481.275568	1440.80488	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.33	1	14.33	13.83	14.83	0								0	0	0	5.8374E-16	1	5284	5284		145.81	99.013	1				2159	150	1266	1330	2893	2893		9606
RLTFLVAQK	9	Unmodified	_RLTFLVAQK_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	537.6083374023438	2	538.334759	1074.65496	0.93834	0.00050514	-0.81764	-0.00044016	0.1207	6.4977E-05	538.3345130211763	17.555	0.50063	17.555	17.404	17.905	0					8	4	3	0	0	0	0.0073873	1	9587	9587		127.46	28.087	1	625780000			2160	367	1267	1331	2894	2894		9606
RNLDIERPTYTNLNR	15	Unmodified	_RNLDIERPTYTNLNR_			0	0	2	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-SECPEP	DP1141_8	3	626.3507690429688	3	625.665896	1873.97586	0.11756	7.3551E-05	0.24604	0.00015394	0.36359	0.00022749	626.0001628280926	16.612	0.35479	16.612	16.376	16.731	0					5	3	2	0	0	0	0.034844	1	8596	8596		83.877	55.098	1	63565000			2161	321;442;322	1268	1332	2895	2895		9606
RPAEDMEEEQAFKR	14	Oxidation (M)	_RPAEDM(Oxidation (M))EEEQAFKR_	RPAEDM(1)EEEQAFKR	RPAEDM(150)EEEQAFKR	0	1	2	P61978	P61978	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	MSMS	DP1141_10	5	584.6055297851562	3	584.605426	1750.79445	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.448	1	14.448	13.948	14.948	0								0	0	0	2.2031E-15	1	5464	5464		151.22	125.8	1				2162	284	1269	1333	2896	2896	230	9606
RPAEDMEEEQAFKR	14	Oxidation (M)	_RPAEDM(Oxidation (M))EEEQAFKR_	RPAEDM(1)EEEQAFKR	RPAEDM(150)EEEQAFKR	0	1	2	P61978	P61978	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	MULTI-MSMS	DP1141_8	3	584.4954223632812	3	584.605426	1750.79445	0.10524	6.1524E-05	-0.08278	-4.8393E-05	0.02246	1.313E-05	584.6055476730568	14.397	0.76426	14.397	14.109	14.873	0					17	8	4	0	0	0	9.7981E-06	1	5163	5163		153	122.69	1	78811000			2163	284	1269	1333	2897	2897	230	9606
RPAEDMEEEQAFKR	14	Unmodified	_RPAEDMEEEQAFKR_			0	0	2	P61978	P61978	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	MULTI-MSMS	DP1141_8	3	579.2698364257812	3	579.273787	1734.79953	0.40232	0.00023305	-0.14042	-8.1344E-05	0.26189	0.00015171	579.6079968799548	15.284	0.60211	15.284	14.972	15.575	0					11	5	4	0	0	0	5.0826E-116	2	6423	6423;6452		212.03	160.42	1	19837000			2164	284	1269	1334	2898;2899	2898		9606
RPAPAVSPGSWKPGPPGSPR	20	Unmodified	_RPAPAVSPGSWKPGPPGSPR_			0	0	2	Q96JM3	Q96JM3	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	MULTI-MSMS	DP1141_7	2	666.9871826171875	3	666.693786	1997.05953	0.46304	0.00030871	-0.17407	-0.00011605	0.28897	0.00019266	666.6937496838563	16.265	0.30042	16.265	16.014	16.315	0					8	2	4	0	0	0	3.0687E-13	2	8001	8001;8111		166.3	152.6	1	37426000			2165	514	1270	1335	2900;2901	2900		9606
RPELLTHSTTEVTQPR	16	Unmodified	_RPELLTHSTTEVTQPR_			0	0	1	P78347	P78347	P78347	GTF2I	General transcription factor II-I	MULTI-MSMS	DP1141_7	2	622.3345947265625	3	622.334035	1863.98027	0.19628	0.00012215	0.23539	0.00014649	0.43167	0.00026864	622.6684573906942	15.664	0.40527	15.664	15.409	15.815	0					5	3	2	0	0	0	0.024116	1	6978	6978		61.649	46.72	1	87179000			2166	327	1271	1336	2902	2902		9606
RPELLTHSTTEVTQPR	16	Unmodified	_RPELLTHSTTEVTQPR_			0	0	1	P78347	P78347	P78347	GTF2I	General transcription factor II-I	MULTI-SECPEP	DP1141_7	2	466.5867919921875	4	467.002345	1863.98027	0.37687	0.000176	-0.067542	-3.1542E-05	0.30933	0.00014446	467.2530614663955	15.664	0.40527	15.664	15.409	15.815	0					5	3	2	0	0	0	0.0052071	1	7086	7086		71.316	33.175	1	62470000			2167	327	1271	1336	2903	2903		9606
RPETWESPEKPK	12	Unmodified	_RPETWESPEKPK_			0	0	2	Q5VUA4	Q5VUA4	Q5VUA4	ZNF318	Zinc finger protein 318	MULTI-SECPEP	DP1141_7	2	495.78375244140625	3	495.256174	1482.74669	0.28878	0.00014302	0.29268	0.00014495	0.58146	0.00028797	495.5906488863428	14.162	0.66129	14.162	13.947	14.608	0					11	6	3	0	0	0	0.0071528	1	4799	4799		95.183	53.153	1	4425400			2168	425	1272	1337	2904	2904		9606
RPETWESPEKPK	12	Unmodified	_RPETWESPEKPK_			0	0	2	Q5VUA4	Q5VUA4	Q5VUA4	ZNF318	Zinc finger protein 318	MULTI-MSMS	DP1141_8	3	495.7839050292969	3	495.256174	1482.74669	0.26112	0.00012932	1.4917	0.00073876	1.7528	0.00086808	495.2567815464275	14.226	0.29972	14.226	13.968	14.268	0					5	3	2	0	0	0	0.0054018	2	4798	4699;4798		80.318	49.755	1	2977800			2169	425	1272	1337	2905;2906	2906		9606
RPGAALDPGCVLAK	14	Unmodified	_RPGAALDPGCVLAK_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	475.59381103515625	3	475.594133	1423.76057	0.055603	2.6445E-05	-0.12267	-5.8343E-05	-0.067071	-3.1899E-05	475.594486637181	17.053	0.80968	17.053	16.595	17.404	0					24	7	5	0	0	0	0.0038877	2	8537	8537;8576		96.371	44.672	1	753160000			2170	367	1273	1338	2907;2908	2907		9606
RPGAALDPGCVLAK	14	Unmodified	_RPGAALDPGCVLAK_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	712.8861083984375	2	712.887561	1423.76057	0.50796	0.00036212	-0.29387	-0.0002095	0.21409	0.00015262	712.8874984156687	17.053	0.47434	17.053	16.729	17.204	0					18	5	5	0	0	0	0.014085	2	8541	8541;8601		136.49	106.75	1	320740000			2171	367	1273	1338	2909;2910	2909		9606
RPGAALDPGCVLAK	14	Unmodified	_RPGAALDPGCVLAK_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_7	2	475.25921630859375	3	475.594133	1423.76057	0.80052	0.00038072	-0.18424	-8.7623E-05	0.61628	0.0002931	475.5940739208998	17.003	0.313	17.003	16.738	17.051	0					6	3	2	0	0	0	0.010321	1	9341	9341		79.885	46.658	1	94336000			2172	367	1273	1338	2911	2911		9606
RPISADSAIMNPASK	15	Oxidation (M)	_RPISADSAIM(Oxidation (M))NPASK_	RPISADSAIM(1)NPASK	RPISADSAIM(110)NPASK	0	1	1	Q00610	Q00610	Q00610	CLTC	Clathrin heavy chain 1	MULTI-MSMS	DP1141_6	1	525.2854614257812	3	525.271607	1572.79299	-0.02613	-1.3725E-05	0.7277	0.00038224	0.70157	0.00036851	525.2720499875967	15.259	1.0017	15.259	14.509	15.51	0					10	9	2	0	0	0	0.00178	1	5727	5727		105.17	64.696	1	5803400			2173	336	1274	1339	2912	2912	256	9606
RPKEEEWDPEYTPK	14	Unmodified	_RPKEEEWDPEYTPK_			0	0	2	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_7	2	601.8348999023438	3	601.956453	1802.84753	0.83633	0.00050344	-0.31559	-0.00018997	0.52074	0.00031346	602.2906286348714	16.165	0.5	16.165	15.815	16.315	0					9	4	4	0	0	0	0.0018388	2	7984	7984;8081		150.9	141.34	1	63138000			2174	580	1275	1340	2913;2914	2913		9606
RPLEMEQQQAYRPEMK	16	2 Oxidation (M)	_RPLEM(Oxidation (M))EQQQAYRPEM(Oxidation (M))K_	RPLEM(1)EQQQAYRPEM(1)K	RPLEM(110)EQQQAYRPEM(110)K	0	2	2	Q9BUJ2	Q9BUJ2	Q9BUJ2	HNRNPUL1	Heterogeneous nuclear ribonucleoprotein U-like protein 1	MULTI-MSMS	DP1141_7	2	689.5770874023438	3	689.331308	2064.97209	0.86323	0.00059505	-0.61906	-0.00042674	0.24417	0.00016831	689.3306050745957	14.259	0.37363	14.259	14.035	14.408	0					9	3	4	0	0	0	0.00080099	1	4980	4980		110.56	82.01	1	13660000			2175	540	1276	1341	2915	2915	386;387	9606
RPLLLNSVLLR	11	Unmodified	_RPLLLNSVLLR_			0	0	1	Q9HCS7	Q9HCS7	Q9HCS7	XAB2	Pre-mRNA-splicing factor SYF1	MULTI-SECPEP	DP1141_7	2	646.8961791992188	2	647.421897	1292.82924	0.072553	4.6972E-05	0.54696	0.00035411	0.61951	0.00040108	647.4222762954896	19.968	0.40025	19.968	19.75	20.15	0					5	3	2	0	0	0	0.009103	1	13925	13925		79.07	33.069	1	5463900			2176	569	1277	1342	2916	2916		9606
RPLPTQQQPQPSQK	14	Unmodified	_RPLPTQQQPQPSQK_			0	0	1	Q9P0U4	Q9P0U4	Q9P0U4	CXXC1	CXXC-type zinc finger protein 1	MULTI-MSMS	DP1141_8	3	545.0064697265625	3	544.965394	1631.87435	0.68796	0.00037491	-0.5302	-0.00028894	0.15776	8.5974E-05	544.9651325375889	12.857	1.0231	12.857	12.706	13.729	0					21	11	3	0	0	0	0.0043825	2	2933	2933;3090		113.54	82.578	1	1678600			2177	583	1278	1343	2917;2918	2917		9606
RPNPDILDHER	11	Unmodified	_RPNPDILDHER_			0	0	1	Q9UQ35	Q9UQ35	Q9UQ35	SRRM2	Serine/arginine repetitive matrix protein 2	MULTI-SECPEP	DP1141_10	5	454.2199401855469	3	454.568863	1360.68476	-0.33702	-0.0001532	1.3001	0.00059098	0.96306	0.00043778	454.56946061874055	14.924	0.31391	14.924	14.806	15.12	0					5	3	2	0	0	0	0.0022205	1	6272	6272		93.766	70.848	1	8958200			2178	607	1279	1344	2919	2919		9606
RPQGESYDQAIR	12	Unmodified	_RPQGESYDQAIR_			0	0	1	Q7KZ85	Q7KZ85	Q7KZ85	SUPT6H	Transcription elongation factor SPT6	MULTI-SECPEP	DP1141_6	1	474.25347900390625	3	473.904023	1418.69024	-0.35663	-0.00016901	0.40464	0.00019176	0.048016	2.2755E-05	473.9038483670871	14.758	0.69942	14.758	14.409	15.108	0					13	6	3	0	0	0	0.0035757	1	5098	5098		90.861	31.443	1	7036100			2179	444	1280	1345	2920	2920		9606
RPQYSNPPVQGEVMEGADNQGAGEQGRPVR	30	Unmodified	_RPQYSNPPVQGEVMEGADNQGAGEQGRPVR_			0	0	2	P67809	P67809	P67809	YBX1	Nuclease-sensitive element-binding protein 1	MULTI-SECPEP	DP1141_9	4	806.0224609375	4	806.637894	3222.52247	-0.16408	-0.00013235	0.89922	0.00072534	0.73513	0.00059299	807.139987690532	16.408	0.30008	16.408	16.158	16.458	0					4	2	2	0	0	0	2.3092E-24	1	8110	8110		99.064	77.612	1	13496000			2180	319	1281	1346	2921	2921		9606
RQAVDVSPLR	10	Unmodified	_RQAVDVSPLR_			0	0	1	P46782	P46782	P46782	RPS5	40S ribosomal protein S5;40S ribosomal protein S5, N-terminally processed	MULTI-SECPEP	DP1141_10	5	570.8280639648438	2	570.827829	1139.64111	0.58791	0.00033559	0.026192	1.4951E-05	0.6141	0.00035054	570.8278015689622	15.32	0.41007	15.32	15.199	15.609	0					5	4	2	0	0	0	0.020055	1	7024	7024		82.287	36.569	1	17999000			2181	237	1282	1347	2922	2922		9606
RSAEEEAADLPTKPTK	16	Unmodified	_RSAEEEAADLPTKPTK_			0	0	2	Q8WW12	Q8WW12	Q8WW12	PCNP	PEST proteolytic signal-containing nuclear protein	MULTI-MSMS	DP1141_10	5	581.6356811523438	3	581.635491	1741.88464	0.29154	0.00016957	0.03522	2.0485E-05	0.32676	0.00019005	581.6355092593202	14.832	0.28388	14.832	14.6	14.884	0					7	3	3	0	0	0	0.021843	1	6126	6126		72.428	2.5494	1	11448000			2182	486	1283	1348	2923	2923		9606
RTEEGPTLSYGR	12	Unmodified	_RTEEGPTLSYGR_			0	0	1	P43243	P43243	P43243	MATR3	Matrin-3	MSMS	DP1141_7	2	455.9003601074219	3	455.896757	1364.66844	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.398	1	15.398	14.898	15.898	0								0	0	0	0.0046723	1	6653	6653		89.44	66.72	1				2183	229	1284	1349	2924	2924		9606
RTEITIVKPQESAHR	15	Unmodified	_RTEITIVKPQESAHR_			0	0	2	Q9UHD8	Q9UHD8	Q9UHD8	SEPT9	Septin-9	MULTI-MSMS	DP1141_8	3	441.7454833984375	4	441.998334	1763.96423	-0.00033483	-1.48E-07	-0.36719	-0.0001623	-0.36752	-0.00016244	441.9983868639466	14.497	0.39788	14.497	14.179	14.577	0					8	4	3	0	0	0	0.0054605	1	5112	5112		75.02	46.474	1	3925500			2184	592	1285	1350	2925	2925		9606
RVCLIQEPK	9	Unmodified	_RVCLIQEPK_			0	0	1	Q8IX01	Q8IX01	Q8IX01	SUGP2	SURP and G-patch domain-containing protein 2	MULTI-MSMS	DP1141_10	5	571.7785034179688	2	571.821158	1141.62776	0.63615	0.00036376	-0.27229	-0.0001557	0.36385	0.00020806	571.8210900524408	15.701	0.2485	15.701	15.533	15.781	0					6	2	3	0	0	0	0.0001329	1	7476	7476		150.4	79.019	1	7531900			2185	464	1286	1351	2926	2926		9606
RVDPVYIHLAER	12	Unmodified	_RVDPVYIHLAER_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MSMS	DP1141_6	1	489.9405517578125	3	489.940409	1466.7994	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.257	1	17.257	16.757	17.757	0								0	0	0	3.9534E-56	1	9058	9058		169.58	134.08	1				2186	367	1287	1352	2927	2927		9606
RVDPVYIHLAER	12	Unmodified	_RVDPVYIHLAER_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	489.94061279296875	3	489.940409	1466.7994	0.43237	0.00021184	-0.2161	-0.00010587	0.21627	0.00010596	489.9402990928961	17.199	0.35683	17.199	16.892	17.249	0					10	3	4	0	0	0	0.010812	1	9629	9629		73.877	41.438	1	64158000			2187	367	1287	1352	2928	2928		9606
RVDPVYIHLAER	12	Unmodified	_RVDPVYIHLAER_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_8	3	489.2681579589844	3	489.940409	1466.7994	0.42456	0.00020801	-0.17661	-8.6527E-05	0.24795	0.00012148	489.9403211513375	17.123	0.30043	17.123	16.973	17.273	0					6	2	3	0	0	0	0.023227	1	9295	9295		58.32	30.037	1	212400000			2188	367	1287	1352	2929	2929		9606
RVDPVYIHLAER	12	Unmodified	_RVDPVYIHLAER_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_9	4	489.906494140625	3	489.940409	1466.7994	0.15216	7.4549E-05	0.23049	0.00011293	0.38265	0.00018748	489.9406235702516	17.188	0.48081	17.188	16.957	17.437	0					11	4	4	0	0	0	1.1417999999999999E-21	2	9380	9380;9447		165.51	142.73	1	408020000			2189	367	1287	1352	2930;2931	2930		9606
RVEGPGSLGLEESGSR	16	Unmodified	_RVEGPGSLGLEESGSR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_10	5	543.94482421875	3	543.944547	1628.81181	0.23452	0.00012757	0.041004	2.2304E-05	0.27553	0.00014987	543.9445834160607	16.41	0.39442	16.41	16.066	16.46	0					13	3	5	0	0	0	2.5939E-09	4	8680	8458;8529;8621;8680		154.51	131.91	1	281260000			2190	365	1288	1353	2932;2933;2934;2935	2935		9606
RVEGPGSLGLEESGSR	16	Unmodified	_RVEGPGSLGLEESGSR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_10	5	815.4138793945312	2	815.413182	1628.81181	0.54605	0.00044526	-0.33175	-0.00027051	0.2143	0.00017475	815.4128219043757	16.411	0.39442	16.411	16.066	16.46	0					10	3	4	0	0	0	3.2495000000000005E-211	3	8698	8614;8698;8736		251.91	195.36	1	101860000			2191	365	1288	1353	2936;2937;2938	2937		9606
RVEGPGSLGLEESGSR	16	Unmodified	_RVEGPGSLGLEESGSR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_6	1	544.9517211914062	3	543.944547	1628.81181	-0.073742	-4.0112E-05	0.28292	0.00015389	0.20918	0.00011378	543.9447139433709	16.455	0.39983	16.455	16.105	16.505	0					14	3	5	0	0	0	0.0011932	3	7722	7386;7587;7722		142.4	113.85	1	140210000			2192	365	1288	1353	2939;2940;2941	2941		9606
RVEGPGSLGLEESGSR	16	Unmodified	_RVEGPGSLGLEESGSR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_6	1	815.413818359375	2	815.413182	1628.81181	0.088893	7.2484E-05	0.072397	5.9034E-05	0.16129	0.00013152	815.9147221004067	16.455	0.39983	16.455	16.105	16.505	0					10	3	4	0	0	0	0	2	7696	7696;7754		296.49	259.81	1	31739000			2193	365	1288	1353	2942;2943	2942		9606
RVEGPGSLGLEESGSR	16	Unmodified	_RVEGPGSLGLEESGSR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MSMS	DP1141_7	2	543.9446411132812	3	543.944547	1628.81181	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.396	1	16.396	15.896	16.896	0								0	0	0	0.011751	1	8279	8279		81.854	56.732	1				2194	365	1288	1353	2944	2944		9606
RVEGPGSLGLEESGSR	16	Unmodified	_RVEGPGSLGLEESGSR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	544.2785034179688	3	543.944547	1628.81181	0.33905	0.00018442	0.01606	8.7357E-06	0.35511	0.00019316	543.9447712940884	16.426	0.75523	16.426	15.976	16.731	0					22	7	4	0	0	0	0.0010384	2	8028	8028;8067		90.872	3.3614	1	1386300000			2195	365	1288	1353	2945;2946	2945		9606
RVEGPGSLGLEESGSR	16	Unmodified	_RVEGPGSLGLEESGSR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	815.9155883789062	2	815.413182	1628.81181	-0.44817	-0.00036545	0.86015	0.00070138	0.41198	0.00033593	815.4139874009514	16.408	0.49492	16.408	16.058	16.553	0					9	4	3	0	0	0	6.1555E-211	1	8150	8150		250.05	215.28	1	86229000			2196	365	1288	1353	2947	2947		9606
RVEGPGSLGLEESGSR	16	Unmodified	_RVEGPGSLGLEESGSR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-SECPEP	DP1141_9	4	543.59912109375	3	543.944547	1628.81181	0.48412	0.00026333	-0.07755	-4.2183E-05	0.40657	0.00022115	543.9444748957898	16.408	0.72362	16.408	16.058	16.782	0					11	7	2	0	0	0	1.356E-06	1	8125	8125		111.73	97.069	1	306340000			2197	365	1288	1353	2948	2948		9606
RVEGPGSLGLEESGSRR	17	Unmodified	_RVEGPGSLGLEESGSRR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-SECPEP	DP1141_10	5	595.323974609375	3	595.978251	1784.91292	0.71452	0.00042584	-0.0082479	-4.9156E-06	0.70627	0.00042092	595.9782897301423	15.56	0.41678	15.56	15.28	15.697	0					15	4	5	0	0	0	1.9329E-10	1	7233	7233		135.61	108.72	1	188460000			2198	365	1289	1354	2949	2949		9606
RVEGPGSLGLEESGSRR	17	Unmodified	_RVEGPGSLGLEESGSRR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_6	1	595.9786987304688	3	595.978251	1784.91292	0.1613	9.6133E-05	0.42538	0.00025352	0.58668	0.00034965	595.9785445871148	15.661	0.5961	15.661	15.309	15.905	0					19	5	5	0	0	0	1.1675E-57	2	6437	6312;6437		191.15	156.72	1	40986000			2199	365	1289	1354	2950;2951	2951		9606
RVEGPGSLGLEESGSRR	17	Unmodified	_RVEGPGSLGLEESGSRR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_7	2	595.978271484375	3	595.978251	1784.91292	0.39602	0.00023602	-0.021641	-1.2897E-05	0.37437	0.00022312	596.3125011586634	15.564	0.40501	15.564	15.309	15.714	0					5	3	2	0	0	0	1.0851E-15	1	6980	6980		164.63	136.91	1	56349000			2200	365	1289	1354	2952	2952		9606
RVEGPGSLGLEESGSRR	17	Unmodified	_RVEGPGSLGLEESGSRR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	596.3114013671875	3	595.978251	1784.91292	0.44729	0.00026658	0.16319	9.7255E-05	0.61048	0.00036383	595.9783749582259	15.625	0.80398	15.625	15.072	15.876	0					12	7	2	0	0	0	1.7446E-44	2	6725	6725;6760		185.86	150.05	1	437090000			2201	365	1289	1354	2953;2954	2953		9606
RVEGPGSLGLEESGSRR	17	Unmodified	_RVEGPGSLGLEESGSRR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	893.4344482421875	2	893.463738	1784.91292	0.50195	0.00044848	0.34715	0.00031016	0.8491	0.00075864	893.4641167655211	15.625	0.40536	15.625	15.37	15.776	0					5	3	2	0	0	0	1.0028E-14	1	6847	6847		172.58	113.88	1	6924800			2202	365	1289	1354	2955	2955		9606
RVEGPGSLGLEESGSRR	17	Unmodified	_RVEGPGSLGLEESGSRR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	447.48577880859375	4	447.235507	1784.91292	0.14648	6.551E-05	-0.48877	-0.0002186	-0.34229	-0.00015309	447.23533400051934	15.635	0.50482	15.635	15.271	15.776	0					13	4	4	0	0	0	0.0051786	1	6866	6866		85.976	63.485	1	22054000			2203	365	1289	1354	2956	2956		9606
RVEGPGSLGLEESGSRR	17	Unmodified	_RVEGPGSLGLEESGSRR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	595.9784545898438	3	595.978251	1784.91292	0.31662	0.0001887	0.014232	8.482E-06	0.33085	0.00019718	595.978306731719	15.623	0.69826	15.623	15.174	15.872	0					20	6	5	0	0	0	1.1189E-104	2	6672	6672;6790		213	169.24	1	118070000			2204	365	1289	1354	2957;2958	2957		9606
RVFLIDLNSTHGTFLGHIR	19	Unmodified	_RVFLIDLNSTHGTFLGHIR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	550.0574951171875	4	549.806365	2195.19636	0.62521	0.00034374	0.010712	5.8894E-06	0.63592	0.00034963	550.0571261572563	20.026	0.60055	20.026	19.777	20.377	0					15	5	5	0	0	0	0.00020964	3	14032	13886;13977;14032		132.51	119.97	1	416960000			2205	365	1290	1355	2959;2960;2961	2961		9606
RVFLIDLNSTHGTFLGHIR	19	Unmodified	_RVFLIDLNSTHGTFLGHIR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	734.0201416015625	3	732.739395	2195.19636	0.46214	0.00033863	-0.0069958	-5.1261E-06	0.45514	0.0003335	733.0738582192016	20.086	0.29793	20.086	19.838	20.136	0					10	2	5	0	0	0	0.00016636	1	13958	13958		122.97	106.74	1	16720000			2206	365	1290	1355	2962	2962		9606
RVFLIDLNSTHGTFLGHIR	19	Unmodified	_RVFLIDLNSTHGTFLGHIR_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	550.0573120117188	4	549.806365	2195.19636	0.60716	0.00033382	-0.36437	-0.00020033	0.24279	0.00013349	550.0569429551048	20.086	0.59805	20.086	19.739	20.337	0					18	5	6	0	0	0	1.4495E-07	2	14003	14003;14144		150.9	139.33	1	200780000			2207	365	1290	1355	2963;2964	2963		9606
RVPSNASWEQAMK	13	Oxidation (M)	_RVPSNASWEQAM(Oxidation (M))K_	RVPSNASWEQAM(1)K	RVPSNASWEQAM(64)K	0	1	1	O75400	O75400	O75400	PRPF40A	Pre-mRNA-processing factor 40 homolog A	MULTI-MSMS	DP1141_7	2	507.2490539550781	3	507.248914	1518.72491	-0.40058	-0.00020319	0.69124	0.00035063	0.29066	0.00014743	507.2494998423396	15.059	0.60275	15.059	14.909	15.512	0					8	5	2	0	0	0	0.020178	1	6315	6315		64.104	33.214	1	14569000			2208	74	1291	1356	2965	2965	58	9606
RVSALNSVHCEHVEDEGESR	20	Unmodified	_RVSALNSVHCEHVEDEGESR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	771.023681640625	3	770.6891	2309.04547	-0.80002	-0.00061657	0.40268	0.00031034	-0.39735	-0.00030623	770.6899885364891	14.858	0.39969	14.858	14.609	15.008	0					11	3	4	0	0	0	3.9105E-28	2	5284	5284;5381		249.49	235.87	1	5528600			2209	367	1292	1357	2966;2967	2966		9606
RWDQTADQTPGATPK	15	Unmodified	_RWDQTADQTPGATPK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	558.3190307617188	3	557.941026	1670.80125	0.42971	0.00023975	-0.22261	-0.0001242	0.2071	0.00011555	557.9408919215263	15.32	0.4975	15.32	14.873	15.37	0					7	4	3	0	0	0	0.0010922	1	6332	6332		121.13	93.453	1	43363000			2210	78	1293	1358	2968	2968		9606
RWDQTADQTPGATPK	15	Unmodified	_RWDQTADQTPGATPK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_9	4	558.3191528320312	3	557.941026	1670.80125	0.62871	0.00035078	-0.12029	-6.7113E-05	0.50843	0.00028367	557.940958268036	15.324	0.49784	15.324	15.075	15.573	0					10	4	4	0	0	0	1.4667E-54	1	6265	6265		159.41	111.3	1	22466000			2211	78	1293	1358	2969	2969		9606
SAEEEAADLPTKPTK	15	Unmodified	_SAEEEAADLPTKPTK_			0	0	1	Q8WW12	Q8WW12	Q8WW12	PCNP	PEST proteolytic signal-containing nuclear protein	MULTI-MSMS	DP1141_10	5	529.5939331054688	3	529.601787	1585.78353	0.043771	2.3181E-05	0.045167	2.3921E-05	0.088938	4.7102E-05	529.6017830802192	15.158	0.40814	15.158	14.96	15.368	0					19	4	6	0	0	0	1.7257E-83	5	6595	6560;6595;6669;6724;6735		269.14	247.06	1	179470000			2212	486	1294	1359	2970;2971;2972;2973;2974	2971		9606
SAEEEAADLPTKPTK	15	Unmodified	_SAEEEAADLPTKPTK_			0	0	1	Q8WW12	Q8WW12	Q8WW12	PCNP	PEST proteolytic signal-containing nuclear protein	MULTI-MSMS	DP1141_10	5	794.40087890625	2	793.899042	1585.78353	0.37398	0.0002969	-0.15962	-0.00012672	0.21436	0.00017018	793.8989097000663	15.157	0.32052	15.157	14.96	15.28	0					13	3	5	0	0	0	0	2	6633	6633;6726		288.61	254.52	1	144950000			2213	486	1294	1359	2975;2976	2975		9606
SAEFLLHMLK	10	Oxidation (M)	_SAEFLLHM(Oxidation (M))LK_	SAEFLLHM(1)LK	SAEFLLHM(140)LK	0	1	0	P18621	P18621	P18621	RPL17	60S ribosomal protein L17	MULTI-MSMS	DP1141_10	5	603.3123779296875	2	602.823366	1203.63218	0.33024	0.00019908	0.45834	0.0002763	0.78859	0.00047538	602.8235576973149	18.537	0.58923	18.537	18.187	18.777	0					8	5	2	0	0	0	0.014935	1	12138	12138		139.97	102.91	1	20943000			2214	169	1295	1360	2977	2977	154	9606
SAHLQWMVVR	10	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))SAHLQWMVVR_			1	0	0	P46779	P46779	P46779	RPL28	60S ribosomal protein L28	MULTI-MSMS	DP1141_10	5	635.3519287109375	2	634.832057	1267.64956	-0.02221	-1.41E-05	-0.24292	-0.00015421	-0.26513	-0.00016831	634.8321713414614	20.383	0.29972	20.383	20.176	20.476	0					4	2	2	0	0	0	0.00066844	1	15042	15042		131.62	82.08	1	7407000			2215	235	1296	1361	2978	2978		9606
SAINEVVTR	9	Unmodified	_SAINEVVTR_			0	0	0	P62899	P62899	P62899	RPL31	60S ribosomal protein L31	MULTI-SECPEP	DP1141_10	5	495.2385559082031	2	494.774731	987.534909	0.37351	0.0001848	-0.26222	-0.00012974	0.11129	5.5065E-05	494.7745695883033	16.016	0.38471	16.016	15.781	16.166	0					5	3	2	0	0	0	0.019616	1	7982	7982		96.034	39.6	1	24571000			2216	310	1297	1362	2979	2979		9606
SANVNEFPVLK	11	Unmodified	_SANVNEFPVLK_			0	0	0	P55060	P55060	P55060	CSE1L	Exportin-2	MULTI-MSMS	DP1141_7	2	609.8436889648438	2	609.32987	1216.64519	0.314	0.00019133	-0.015096	-9.1985E-06	0.29891	0.00018213	609.3293786749842	18.64	0.50026	18.64	18.449	18.95	0					6	4	2	0	0	0	0.022956	1	11977	11977		78.655	35.791	1	5190600			2217	270	1298	1363	2980	2980		9606
SAPASPTHPGLMSPR	15	Oxidation (M)	_SAPASPTHPGLM(Oxidation (M))SPR_	SAPASPTHPGLM(1)SPR	SAPASPTHPGLM(84)SPR	0	1	0	P85037	P85037	P85037	FOXK1	Forkhead box protein K1	MULTI-SECPEP	DP1141_8	3	507.9090881347656	3	507.920797	1520.74056	0.44328	0.00022515	-0.45039	-0.00022876	-0.0071171	-3.6149E-06	507.9206621347219	14.527	0.5043	14.527	14.268	14.772	0					12	5	4	0	0	0	0.005346	1	5244	5244		84.173	64.962	1	11568000			2218	333	1299	1364	2981	2981	253	9606
SDLEMQYETLQEELMALK	18	2 Oxidation (M)	_SDLEM(Oxidation (M))QYETLQEELM(Oxidation (M))ALK_	SDLEM(1)QYETLQEELM(1)ALK	SDLEM(240)QYETLQEELM(240)ALK	0	2	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_7	2	1102.1568603515625	2	1102.01088	2202.0072	0.40026	0.00044109	-0.55506	-0.00061168	-0.15479	-0.00017058	1102.5120031204513	23.393	0.36078	23.393	23.198	23.559	0					9	4	3	0	0	0	2.6958E-192	2	19047	19047;19119		242.4	194.29	1	4678700		+	2219	19	1300	1365	2982;2983	2982	21;22	9606
SDLEMQYETLQEELMALKK	19	2 Oxidation (M)	_SDLEM(Oxidation (M))QYETLQEELM(Oxidation (M))ALKK_	SDLEM(1)QYETLQEELM(1)ALKK	SDLEM(130)QYETLQEELM(130)ALKK	0	2	1	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_7	2	778.0429077148438	3	777.707998	2330.10216	0.83314	0.00064794	-0.35455	-0.00027574	0.47859	0.0003722	778.0423532058353	21.904	0.39619	21.904	21.75	22.146	0					16	3	7	0	0	0	0.00012496	1	16975	16975		133.78	110.45	1	70909000		+	2220	19	1301	1366	2984	2984	21;22	9606
SDLEMQYETLQEELMALKK	19	2 Oxidation (M)	_SDLEM(Oxidation (M))QYETLQEELM(Oxidation (M))ALKK_	SDLEM(1)QYETLQEELM(1)ALKK	SDLEM(110)QYETLQEELM(110)ALKK	0	2	1	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-SECPEP	DP1141_8	3	777.9354248046875	3	777.707998	2330.10216	0.4197	0.00032641	0.028538	2.2194E-05	0.44824	0.0003486	778.0422835553325	21.929	0.29944	21.929	21.779	22.079	0					4	2	2	0	0	0	1.0563E-07	1	16743	16743		109.67	73.898	1	22571000		+	2221	19	1301	1366	2985	2985	21;22	9606
SDNGELEDKPPAPPVR	16	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))SDNGELEDKPPAPPVR_			1	0	1	Q13177	Q13177	Q13177	PAK2	Serine/threonine-protein kinase PAK 2;PAK-2p27;PAK-2p34	MULTI-SECPEP	DP1141_8	3	881.4373168945312	2	881.933948	1761.85334	0.31993	0.00028216	0.17511	0.00015443	0.49504	0.00043659	882.4357612506382	17.023	0.34167	17.023	16.731	17.073	0					6	3	2	0	0	0	0.021706	1	8965	8965		51.841	13.873	1	9868000			2222	371	1302	1367	2986	2986		9606
SDQDHSMDEMTAVVK	15	Acetyl (Protein N-term),2 Oxidation (M)	_(Acetyl (Protein N-term))SDQDHSM(Oxidation (M))DEM(Oxidation (M))TAVVK_	SDQDHSM(1)DEM(1)TAVVK	SDQDHSM(53)DEM(53)TAVVK	1	2	0	P08047	P08047	P08047	SP1	Transcription factor Sp1	MULTI-MSMS	DP1141_10	5	589.5792236328125	3	589.578436	1765.71348	1.1684	0.00068884	0.34406	0.00020285	1.5124	0.00089169	589.9130855313052	20.126	0.50011	20.126	19.676	20.176	0					8	4	3	0	0	0	0.014528	1	14670	14670		53.377	29.781	1	49543000			2223	125	1303	1368	2987	2987	117;118	9606
SDSEKLNLDSIIGR	14	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))SDSEKLNLDSIIGR_			1	0	1	P62136	P62136	P62136	PPP1CA	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit	MULTI-MSMS	DP1141_9	4	794.9475708007812	2	794.912484	1587.81041	0.33275	0.00026451	0.2333	0.00018545	0.56605	0.00044996	794.9126975650328	20.787	0.60059	20.787	20.337	20.937	0					10	5	3	0	0	0	0	1	15044	15044		388.54	321.62	1	310890000			2224	286	1304	1369	2988	2988		9606
SDVFPGPSFR	10	Unmodified	_SDVFPGPSFR_			0	0	0	Q8IX01	Q8IX01	Q8IX01	SUGP2	SURP and G-patch domain-containing protein 2	MULTI-MSMS	DP1141_7	2	555.3186645507812	2	554.774731	1107.53491	-0.093259	-5.1738E-05	0.63712	0.00035346	0.54386	0.00030172	554.7752653353565	19.1	0.50083	19.1	18.85	19.35	0					8	4	3	0	0	0	0.03471	1	12630	12630		74.92	29.839	1	18672000			2225	464	1305	1370	2989	2989		9606
SDYSPHISCHDELLR	15	Unmodified	_SDYSPHISCHDELLR_			0	0	0	Q5VUA4	Q5VUA4	Q5VUA4	ZNF318	Zinc finger protein 318	MULTI-MSMS	DP1141_7	2	610.8041381835938	3	610.280942	1827.821	0.74743	0.00045614	-0.26727	-0.00016311	0.48016	0.00029303	610.2806283360575	16.881	0.21517	16.881	16.738	16.953	0					4	2	2	0	0	0	0.015777	1	9103	9103		63.292	46.223	1	15661000			2226	425	1306	1371	2990	2990		9606
SEGALELADVSNELPGLK	18	Unmodified	_SEGALELADVSNELPGLK_			0	0	0	Q08J23	Q08J23	Q08J23	NSUN2	tRNA (cytosine(34)-C(5))-methyltransferase	MULTI-MSMS	DP1141_7	2	921.4512329101562	2	921.478188	1840.94182	0.62064	0.00057191	0.48998	0.0004515	1.1106	0.0010234	921.4783638286779	21.5	0.49978	21.5	21.25	21.75	0					5	4	2	0	0	0	0.00020076	2	16185	16185;16211		110.92	67.947	1	3959200			2227	359	1307	1372	2991;2992	2991		9606
SELDTIDSQHR	11	Unmodified	_SELDTIDSQHR_			0	0	0	P43004	P43004	P43004	SLC1A2	Excitatory amino acid transporter 2	MULTI-SECPEP	DP1141_9	4	434.7801818847656	3	434.209112	1299.60551	0.32067	0.00013924	0.37532	0.00016297	0.69599	0.0003022	434.2092157637671	15.419	0.29865	15.419	15.274	15.573	0					4	2	2	0	0	0	0.0075521	1	6513	6513		89.171	57.986	1	5802400			2228	228	1308	1373	2993	2993		9606
SELLVEQGR	9	Unmodified	_SELLVEQGR_			0	0	0	Q92878	Q92878	Q92878	RAD50	DNA repair protein RAD50	MULTI-SECPEP	DP1141_7	2	515.7916259765625	2	515.780013	1029.54547	0.3337	0.00017212	-0.24533	-0.00012654	0.088371	4.558E-05	515.779785159118	16.544	0.42965	16.544	16.215	16.644	0					12	4	4	0	0	0	0.0084812	1	8320	8320		131.06	81.021	1	23970000			2229	497	1309	1374	2994	2994		9606
SELLVPGSQLILGPHESK	18	Unmodified	_SELLVPGSQLILGPHESK_			0	0	0	Q99575	Q99575	Q99575	POP1	Ribonucleases P/MRP protein subunit POP1	MULTI-MSMS	DP1141_7	2	635.8593139648438	3	635.354436	1903.04148	0.33184	0.00021084	-0.93787	-0.00059588	-0.60603	-0.00038504	635.3532182689547	20.165	0.30053	20.165	19.95	20.251	0					4	2	2	0	0	0	0.0046171	1	14251	14251		87.088	55.388	1	4954400			2230	528	1310	1375	2995	2995		9606
SELVANNVTLPAGEQR	16	Unmodified	_SELVANNVTLPAGEQR_			0	0	0	P42166	P42166	P42166	TMPO	Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin	MULTI-MSMS	DP1141_9	4	849.4446411132812	2	849.444483	1696.87441	0.028696	2.4375E-05	0.65849	0.00055935	0.68718	0.00058372	849.4449495686632	17.887	0.29962	17.887	17.638	17.937	0					4	2	2	0	0	0	0.033451	1	10631	10631		65.234	42.316	1	16565000			2231	225	1311	1376	2996	2996		9606
SEQEFQEQLESAR	13	Unmodified	_SEQEFQEQLESAR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_7	2	790.8627319335938	2	790.862991	1579.71143	0.60079	0.00047514	-0.47586	-0.00037634	0.12493	9.8803E-05	790.8624068913099	18.099	0.30035	18.099	17.849	18.149	0					6	2	3	0	0	0	0.021776	1	11113	11113		77.64	35.305	1	22286000			2232	521	1312	1377	2997	2997		9606
SEQEFQEQLESAR	13	Unmodified	_SEQEFQEQLESAR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	790.863525390625	2	790.862991	1579.71143	0.61293	0.00048474	0.032233	2.5492E-05	0.64516	0.00051023	790.8630205003891	18.025	0.30099	18.025	17.874	18.175	0					4	2	2	0	0	0	0.0032622	1	10998	10998		120.77	84.346	1	1228500000			2233	521	1312	1377	2998	2998		9606
SEQEFQEQLESAR	13	Unmodified	_SEQEFQEQLESAR_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_9	4	790.863525390625	2	790.862991	1579.71143	0.43471	0.0003438	-0.28856	-0.00022821	0.14615	0.00011558	790.8629522933948	18.087	0.59954	18.087	17.638	18.237	0					11	5	4	0	0	0	2.8888E-14	1	10908	10908		164.81	107.03	1	41138000			2234	521	1312	1377	2999	2999		9606
SESPKEPEQLR	11	Unmodified	_SESPKEPEQLR_			0	0	1	P09651	P09651	P09651	HNRNPA1	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed	MULTI-MSMS	DP1141_10	5	433.8897399902344	3	433.889491	1298.64664	0.089861	3.899E-05	0.81472	0.0003535	0.90458	0.00039249	433.8898077441626	14.052	0.33955	14.052	13.875	14.215	0					9	5	3	0	0	0	0.01833	1	4855	4855		103.21	61.971	1	3781700			2235	130	1313	1378	3000	3000		9606
SESPKEPEQLR	11	Unmodified	_SESPKEPEQLR_			0	0	1	P09651	P09651	P09651	HNRNPA1	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed	MULTI-MSMS	DP1141_9	4	434.2241516113281	3	433.889491	1298.64664	0.13934	6.046E-05	0.28725	0.00012463	0.42659	0.00018509	433.88943807434197	14.022	0.30087	14.022	13.877	14.178	0					16	4	5	0	0	0	0.0080367	2	4351	4351;4428		164.33	135.64	1	14024000			2236	130	1313	1378	3001;3002	3001		9606
SETAPAAPAAAPPAEK	16	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))SETAPAAPAAAPPAEK_			1	0	0	P16403	P16403	P16403	HIST1H1C	Histone H1.2	MULTI-MSMS	DP1141_10	5	760.88330078125	2	760.883195	1519.75184	0.75208	0.00057224	-0.24971	-0.00019	0.50237	0.00038224	760.8827120668841	16.316	0.29431	16.316	16.166	16.46	0					6	2	3	0	0	0	0.00071124	1	8707	8707		103.75	9.7918	1	21654000			2237	157	1314	1379	3003	3003		9606
SETAPAAPAAAPPAEK	16	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))SETAPAAPAAAPPAEK_			1	0	0	P16403	P16403	P16403	HIST1H1C	Histone H1.2	MULTI-MSMS	DP1141_9	4	761.8862915039062	2	760.883195	1519.75184	0.57766	0.00043953	-0.13541	-0.00010303	0.44224	0.0003365	760.8829817553293	16.408	0.30008	16.408	16.158	16.458	0					8	2	4	0	0	0	0.0030232	1	8158	8158		90.793	6.441	1	63242000			2238	157	1314	1379	3004	3004		9606
SFGLPSIGR	9	Unmodified	_SFGLPSIGR_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_6	1	467.26141357421875	2	467.261259	932.507966	0.46339	0.00021653	-0.098109	-4.5843E-05	0.36528	0.00017068	467.26120765083596	19.556	0.70044	19.556	18.905	19.606	0					13	6	3	0	0	0	0.0012266	1	12659	12659		127.46	55.584	1	39780000			2239	110	1315	1380	3005	3005		9606
SFTQSSHLVQHQR	13	Unmodified	_SFTQSSHLVQHQR_			0	0	0	Q9UEG4	Q9UEG4	Q9UEG4	ZNF629	Zinc finger protein 629	MULTI-SECPEP	DP1141_7	2	519.6104125976562	3	518.930572	1553.76989	0.36992	0.00019196	0.2599	0.00013487	0.62982	0.00032683	518.9308372669838	14.079	0.26339	14.079	13.947	14.21	0					4	2	2	0	0	0	0.011832	1	4682	4682		76.522	54.447	1	8247500			2240	590	1316	1381	3006	3006		9606
SGASEANLIVAK	12	Unmodified	_SGASEANLIVAK_			0	0	0	P46013	P46013	P46013	MKI67	Antigen KI-67	MSMS	DP1141_7	2	580.3193969726562	2	580.319502	1158.62445	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.536	1	16.536	16.036	17.036	0								0	0	0	0.029228	1	8521	8521		121.5	42.013	1				2241	232	1317	1382	3007	3007		9606
SGEGEVSGLMR	11	Oxidation (M)	_SGEGEVSGLM(Oxidation (M))R_	SGEGEVSGLM(1)R	SGEGEVSGLM(94)R	0	1	0	Q13263	Q13263	Q13263	TRIM28	Transcription intermediary factor 1-beta	MULTI-SECPEP	DP1141_7	2	568.792236328125	2	569.26387	1136.51319	-0.12426	-7.0739E-05	0.43624	0.00024833	0.31197	0.0001776	569.2642281414516	15.164	0.50049	15.164	14.909	15.409	0					11	4	4	0	0	0	0.0021489	1	6285	6285		94.409	54.862	1	48635000			2242	372	1318	1383	3008	3008	294	9606
SGFSSVSVSR	10	Unmodified	_SGFSSVSVSR_			0	0	0	CON__P02538;P02538	CON__P02538	CON__P02538	KRT6A	Keratin, type II cytoskeletal 6A	MSMS	DP1141_9	4	506.272705078125	2	506.756538	1011.49852	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.122	1	16.122	15.622	16.622	0								0	0	0	8.0844E-16	1	7642	7642		155.58	69.909	1			+	2243	10	1319	1384	3009	3009		9606
SGGASHSELIHNLR	14	Unmodified	_SGGASHSELIHNLR_			0	0	0	P22061	P22061	P22061	PCMT1	Protein-L-isoaspartate(D-aspartate) O-methyltransferase	MULTI-SECPEP	DP1141_10	5	493.6163635253906	3	493.255056	1476.74334	0.18161	8.958E-05	0.11486	5.6657E-05	0.29647	0.00014624	493.2551493437272	14.995	0.47395	14.995	14.806	15.28	0					13	5	4	0	0	0	1.9847E-104	1	6317	6317		225.63	165.47	1	81286000			2244	175	1320	1385	3010	3010		9606
SGGASHSELIHNLRK	15	Unmodified	_SGGASHSELIHNLRK_			0	0	1	P22061	P22061	P22061	PCMT1	Protein-L-isoaspartate(D-aspartate) O-methyltransferase	MULTI-MSMS	DP1141_10	5	402.46746826171875	4	402.216852	1604.8383	0.47686	0.0001918	-0.35699	-0.00014359	0.11988	4.8217E-05	402.21670588560676	14.229	0.18656	14.229	14.09	14.276	0					6	2	3	0	0	0	0.0024585	1	5169	5169		85.536	70.971	1	7770800			2245	175	1321	1386	3011	3011		9606
SGGGFSSGSAGIINYQR	17	Unmodified	_SGGGFSSGSAGIINYQR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_9	4	829.9122924804688	2	829.400075	1656.7856	-0.33	-0.0002737	-0.17199	-0.00014265	-0.50198	-0.00041634	829.39996226745	18.287	0.30032	18.287	18.037	18.337	0					4	2	2	0	0	0	0	1	11104	11104		295.26	264.2	1	8770600		+	2246	102	1322	1387	3012	3012		9606
SGNSDVYENEIPGGQYTNLHFQAHSMGLGSK	31	Unmodified	_SGNSDVYENEIPGGQYTNLHFQAHSMGLGSK_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-SECPEP	DP1141_8	3	835.8919677734375	4	835.134918	3336.51057	0.94121	0.00078604	-1.4526	-0.0012131	-0.51136	-0.00042706	835.383873616195	19.271	0.29982	19.271	19.075	19.375	0					4	2	2	0	0	0	0.00051058	1	12819	12819		58.168	47.656	1	8613000			2247	142	1323	1388	3013	3013		9606
SGPFGQIFRPDNFVFGQSGAGNNWAK	26	Unmodified	_SGPFGQIFRPDNFVFGQSGAGNNWAK_			0	0	1	P07437;P68371;P04350;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_10	5	933.4529418945312	3	933.452642	2797.3361	0.50298	0.00046951	-0.32416	-0.00030259	0.17882	0.00016692	934.120997928389	22.278	0.55936	22.278	21.959	22.518	0					14	5	4	0	0	0	1.545E-92	3	17758	17758;17830;17868		202.73	171.95	1	19965000			2248	122;323;381	1324	1389	3014;3015;3016	3014		9606
SGPFGQIFRPDNFVFGQSGAGNNWAK	26	Unmodified	_SGPFGQIFRPDNFVFGQSGAGNNWAK_			0	0	1	P07437;P68371;P04350;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_8	3	933.7874755859375	3	933.452642	2797.3361	0.30003	0.00028006	-0.45923	-0.00042867	-0.1592	-0.00014861	933.7866789929235	22.229	0.84085	22.229	21.879	22.72	0					13	8	2	0	0	0	1.1642E-38	2	17137	17137;17592		169.88	141.41	1	86786000			2249	122;323;381	1324	1389	3017;3018	3017		9606
SGPFGQIFRPDNFVFGQSGAGNNWAK	26	Unmodified	_SGPFGQIFRPDNFVFGQSGAGNNWAK_			0	0	1	P07437;P68371;P04350;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MSMS	DP1141_8	3	933.452880859375	3	933.452642	2797.3361	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.183	1	22.183	21.683	22.683	0								0	0	0	1.1615E-73	1	17063	17063		176.86	153.58	1				2250	122;323;381	1324	1389	3019	3019		9606
SGPFGQIFRPDNFVFGQSGAGNNWAK	26	Unmodified	_SGPFGQIFRPDNFVFGQSGAGNNWAK_			0	0	1	P07437;P68371;P04350;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_9	4	933.7872924804688	3	933.452642	2797.3361	0.6445	0.00060161	-0.52131	-0.00048662	0.12319	0.000115	933.7868093502323	22.292	0.69439	22.292	21.736	22.43	0					22	7	5	0	0	0	5.0425E-50	3	17345	16962;17263;17345		180.68	151.21	1	15310000			2251	122;323;381	1324	1389	3020;3021;3022	3022		9606
SGSMDPSGAHPSVR	14	Unmodified	_SGSMDPSGAHPSVR_			0	0	0	Q07666	Q07666	Q07666	KHDRBS1	KH domain-containing, RNA-binding, signal transduction-associated protein 1	MULTI-MSMS	DP1141_8	3	462.54827880859375	3	462.21398	1383.62011	-0.15106	-6.9822E-05	0.35731	0.00016515	0.20625	9.5332E-05	462.2141872412866	14.131	0.29972	14.131	13.968	14.268	0					6	3	2	0	0	0	0.0076287	1	4723	4723		83.087	63.816	1	2070700			2252	353	1325	1390	3023	3023		9606
SGTTPKPVINSTPGR	15	Unmodified	_SGTTPKPVINSTPGR_			0	0	1	Q99459	Q99459	Q99459	CDC5L	Cell division cycle 5-like protein	MULTI-MSMS	DP1141_7	2	504.7729797363281	3	504.610728	1510.81036	0.10727	5.4132E-05	0.34659	0.0001749	0.45387	0.00022903	504.6109716561446	14.358	0.3979	14.358	14.21	14.608	0					5	3	2	0	0	0	0.011408	1	5111	5111		135.86	108.91	1	11725000			2253	526	1326	1391	3024	3024		9606
SGVSDHWALDDHHALHLTR	19	Unmodified	_SGVSDHWALDDHHALHLTR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-SECPEP	DP1141_7	2	434.03216552734375	5	434.214376	2166.0355	0.63465	0.00027557	-0.2308	-0.00010022	0.40385	0.00017536	434.21434127560156	17.299	0.59813	17.299	17.051	17.649	0					6	5	2	0	0	0	0.024185	1	9845	9845		57.708	35.082	1	43032000			2254	567	1327	1392	3025	3025		9606
SGVSDHWALDDHHALHLTR	19	Unmodified	_SGVSDHWALDDHHALHLTR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	542.7670288085938	4	542.516151	2166.0355	0.64432	0.00034955	-0.22618	-0.00012271	0.41814	0.00022685	542.7668299730367	17.324	0.97383	17.324	16.9	17.874	0					34	9	6	0	0	0	3.0283E-06	4	9721	9538;9618;9702;9721		132.87	97.524	1	1892199999.9999998			2255	567	1327	1392	3026;3027;3028;3029	3029		9606
SGVSDHWALDDHHALHLTR	19	Unmodified	_SGVSDHWALDDHHALHLTR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	434.4149169921875	5	434.214376	2166.0355	0.10367	4.5014E-05	0.047868	2.0785E-05	0.15154	6.5799E-05	434.4150221917518	17.323	0.77381	17.323	16.9	17.674	0					24	7	5	0	0	0	0.00010984	3	9724	9593;9724;9875		134.82	98.006	1	933150000			2256	567	1327	1392	3030;3031;3032	3031		9606
SGVSDHWALDDHHALHLTR	19	Unmodified	_SGVSDHWALDDHHALHLTR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	434.4150085449219	5	434.214376	2166.0355	0.13214	5.7378E-05	0.057558	2.4992E-05	0.1897	8.237E-05	434.41494935472514	17.288	0.69031	17.288	17.047	17.738	0					9	6	2	0	0	0	0.0067815	2	9757	9757;9923		87.419	87.419	1	63214000			2257	567	1327	1392	3033;3034	3033		9606
SGVSDHWALDDHHALHLTR	19	Unmodified	_SGVSDHWALDDHHALHLTR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-SECPEP	DP1141_9	4	722.8682250976562	3	723.019109	2166.0355	0.5475	0.00039585	0.51129	0.00036968	1.0588	0.00076553	723.3538278084435	17.335	0.39012	17.335	17.047	17.437	0					7	3	3	0	0	0	5.8866E-32	1	9692	9692		161.91	131.49	1	9260700			2258	567	1327	1392	3035	3035		9606
SGVSLAALKK	10	Unmodified	_SGVSLAALKK_			0	0	1	P16403;P10412;P16402	P16403	P16403	HIST1H1C;HIST1H1E;HIST1H1D	Histone H1.2;Histone H1.4;Histone H1.3	MULTI-SECPEP	DP1141_9	4	486.89178466796875	2	487.305667	972.596781	0.24198	0.00011792	-0.13813	-6.7312E-05	0.10384	5.0603E-05	487.3055926308179	15.822	0.29255	15.822	15.673	15.965	0					4	2	2	0	0	0	1.5344E-07	1	7191	7191		145.72	103.33	1	104070000			2259	157	1328	1393	3036	3036		9606
SIATLAITTLLK	12	Unmodified	_SIATLAITTLLK_			0	0	0	Q9UBF2;Q9Y678	Q9UBF2	Q9UBF2	COPG2;COPG1	Coatomer subunit gamma-2;Coatomer subunit gamma-1	MSMS	DP1141_7	2	622.8455810546875	2	622.894846	1243.77514	NaN	NaN	NaN	NaN	NaN	NaN	NaN	23.275	1	23.275	22.775	23.775	0								0	0	0	0.023094	1	18899	18899		99.568	65.646	1				2260	588	1329	1394	3037	3037		9606
SIFQHIQSAQSQR	13	Unmodified	_SIFQHIQSAQSQR_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-SECPEP	DP1141_10	5	511.2605895996094	3	510.598823	1528.77464	0.048263	2.4643E-05	-0.27793	-0.00014191	-0.22966	-0.00011727	510.59896078411333	16.876	0.2782	16.876	16.727	17.005	0					7	4	2	0	0	0	0.01359	1	9408	9408		82.705	50.275	1	14496000			2261	612	1330	1395	3038	3038		9606
SIFQHIQSAQSQR	13	Unmodified	_SIFQHIQSAQSQR_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_6	1	510.5989685058594	3	510.598823	1528.77464	-0.28252	-0.00014425	0.92879	0.00047424	0.64628	0.00032999	510.5993302668154	16.956	0.27498	16.956	16.729	17.004	0					5	3	2	0	0	0	0.011059	1	8581	8581		78.486	42.723	1	42117000			2262	612	1330	1395	3039	3039		9606
SIFQHIQSAQSQR	13	Unmodified	_SIFQHIQSAQSQR_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_6	1	765.3949584960938	2	765.394596	1528.77464	-0.53576	-0.00041007	1.4014	0.0010727	0.86568	0.00066259	765.3956536166612	16.951	0.18051	16.951	16.824	17.004	0					6	2	3	0	0	0	0.0059702	1	8609	8609		101.39	66.633	1	12508000			2263	612	1330	1395	3040	3040		9606
SIFQHIQSAQSQR	13	Unmodified	_SIFQHIQSAQSQR_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_7	2	510.5989685058594	3	510.598823	1528.77464	0.31978	0.00016328	-0.0079627	-4.0658E-06	0.31181	0.00015921	510.5988174110985	16.881	0.313	16.881	16.738	17.051	0					5	3	2	0	0	0	0.0026192	1	9130	9130		112.08	76.32	1	444520000			2264	612	1330	1395	3041	3041		9606
SIFQHIQSAQSQR	13	Unmodified	_SIFQHIQSAQSQR_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_8	3	511.2696228027344	3	510.598823	1528.77464	0.26165	0.0001336	0.11151	5.6937E-05	0.37316	0.00019054	510.59888195268036	16.878	0.41046	16.878	16.562	16.973	0					10	4	4	0	0	0	0.030846	1	8902	8902		64.945	37.615	1	112910000			2265	612	1330	1395	3042	3042		9606
SIFQHIQSAQSQR	13	Unmodified	_SIFQHIQSAQSQR_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_9	4	510.59906005859375	3	510.598823	1528.77464	-0.062102	-3.1709E-05	1.2596	0.00064317	1.1975	0.00061147	510.59912810509616	16.918	0.35613	16.918	16.782	17.138	0					14	4	5	0	0	0	0.0079199	1	8974	8974		83.204	45.41	1	44379000			2266	612	1330	1395	3043	3043		9606
SIFQHIQSAQSQR	13	Unmodified	_SIFQHIQSAQSQR_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_9	4	765.3952026367188	2	765.394596	1528.77464	0.80525	0.00061634	-0.062102	-4.7533E-05	0.74315	0.0005688	765.3945026686143	16.891	0.17482	16.891	16.782	16.957	0					6	2	3	0	0	0	0.028976	1	8999	8999		67.456	19.518	1	13758000			2267	612	1330	1395	3044	3044		9606
SIGVPIK	7	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))SIGVPIK_			1	0	0	P62318	P62318	P62318	SNRPD3	Small nuclear ribonucleoprotein Sm D3	MULTI-MSMS	DP1141_10	5	755.4274291992188	1	755.466167	754.45889	1.0187	0.00076961	-0.12495	-9.4399E-05	0.89377	0.00067521	755.4659973224948	19.027	0.39997	19.027	18.877	19.277	0					8	3	3	0	0	0	0.005921	1	12830	12830		88.643	36.412	1	59597000			2268	299	1331	1396	3045	3045		9606
SILSPGGSCGPIK	13	Unmodified	_SILSPGGSCGPIK_			0	0	0	P78347	P78347	P78347	GTF2I	General transcription factor II-I	MULTI-MSMS	DP1141_7	2	636.834716796875	2	636.834462	1271.65437	0.25621	0.00016317	0.078419	4.994E-05	0.33463	0.00021311	636.8343160985283	17.599	0.2996	17.599	17.349	17.649	0					8	2	4	0	0	0	0.019292	1	10332	10332		72.848	47.722	1	29357000			2269	327	1332	1397	3046	3046		9606
SILVSPTGPSR	11	Unmodified	_SILVSPTGPSR_			0	0	0	Q14684	Q14684	Q14684	RRP1B	Ribosomal RNA processing protein 1 homolog B	MSMS	DP1141_10	5	557.31689453125	2	557.316763	1112.61897	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.866	1	16.866	16.366	17.366	0								0	0	0	5.8053E-06	1	9444	9444		140.11	79.43	1				2270	390	1333	1398	3047	3047		9606
SIMAAAGVPVVEGYHGEDQSDQCLK	25	Oxidation (M)	_SIM(Oxidation (M))AAAGVPVVEGYHGEDQSDQCLK_	SIM(1)AAAGVPVVEGYHGEDQSDQCLK	SIM(43)AAAGVPVVEGYHGEDQSDQCLK	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	893.4139404296875	3	893.079265	2676.21597	0.9704	0.00086665	-0.57495	-0.00051348	0.39545	0.00035317	893.4130903820555	18.055	0.4	18.055	17.805	18.205	0					10	3	4	0	0	0	0.0073494	1	10529	10529		43.176	23.483	1	72849000			2271	521	1334	1399	3048	3048	377	9606
SIMAAAGVPVVEGYHGEDQSDQCLK	25	Oxidation (M)	_SIM(Oxidation (M))AAAGVPVVEGYHGEDQSDQCLK_	SIM(1)AAAGVPVVEGYHGEDQSDQCLK	SIM(77)AAAGVPVVEGYHGEDQSDQCLK	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	893.414306640625	3	893.079265	2676.21597	0.54052	0.00048272	0.1569	0.00014013	0.69742	0.00062285	893.413828426842	18.025	0.50101	18.025	17.674	18.175	0					10	4	4	0	0	0	1.2284E-05	1	11011	11011		76.693	63.298	1	173420000			2272	521	1334	1399	3049	3049	377	9606
SIMAAAGVPVVEGYHGEDQSDQCLK	25	Oxidation (M)	_SIM(Oxidation (M))AAAGVPVVEGYHGEDQSDQCLK_	SIM(1)AAAGVPVVEGYHGEDQSDQCLK	SIM(82)AAAGVPVVEGYHGEDQSDQCLK	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MSMS	DP1141_8	3	1339.115234375	2	1339.11526	2676.21597	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.164	1	18.164	17.664	18.664	0								0	0	0	8.0009E-05	1	11057	11057		82.349	72.658	1				2273	521	1334	1399	3050	3050	377	9606
SIMAAAGVPVVEGYHGEDQSDQCLK	25	Oxidation (M)	_SIM(Oxidation (M))AAAGVPVVEGYHGEDQSDQCLK_	SIM(1)AAAGVPVVEGYHGEDQSDQCLK	SIM(42)AAAGVPVVEGYHGEDQSDQCLK	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_9	4	894.463623046875	3	893.079265	2676.21597	0.90824	0.00081113	-0.92238	-0.00082376	-0.014135	-1.2624E-05	893.412718071311	18.087	0.49959	18.087	17.738	18.237	0					13	4	5	0	0	0	0.0091038	1	10670	10670		41.597	27.725	1	45730000			2274	521	1334	1399	3051	3051	377	9606
SIMAAAGVPVVEGYHGEDQSDQCLK	25	Unmodified	_SIMAAAGVPVVEGYHGEDQSDQCLK_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MSMS	DP1141_6	1	887.7702026367188	3	887.747627	2660.22105	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.929	1	18.929	18.429	19.429	0								0	0	0	1.4273E-164	1	11749	11749		210.71	183.17	1				2275	521	1334	1400	3052	3052		9606
SIMAAAGVPVVEGYHGEDQSDQCLKEHAR	29	Oxidation (M)	_SIM(Oxidation (M))AAAGVPVVEGYHGEDQSDQCLKEHAR_	SIM(1)AAAGVPVVEGYHGEDQSDQCLKEHAR	SIM(150)AAAGVPVVEGYHGEDQSDQCLKEHAR	0	1	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	793.62255859375	4	793.3712	3169.4557	-0.47938	-0.00038033	0.83612	0.00066335	0.35674	0.00028302	793.6228378766527	16.956	0.27927	16.956	16.824	17.103	0					13	3	5	0	0	0	2.6039E-25	1	8610	8610		152.88	141.88	1	46612000			2276	521	1335	1401	3053	3053	377	9606
SIMAAAGVPVVEGYHGEDQSDQCLKEHAR	29	Oxidation (M)	_SIM(Oxidation (M))AAAGVPVVEGYHGEDQSDQCLKEHAR_	SIM(1)AAAGVPVVEGYHGEDQSDQCLKEHAR	SIM(150)AAAGVPVVEGYHGEDQSDQCLKEHAR	0	1	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	635.300048828125	5	634.898416	3169.4557	0.41477	0.00026334	0.055814	3.5436E-05	0.47059	0.00029878	635.0990157711883	16.955	0.27498	16.955	16.729	17.004	0					13	3	6	0	0	0	4.2369E-21	1	8615	8615		146.04	130.29	1	31359000			2277	521	1335	1401	3054	3054	377	9606
SIMAAAGVPVVEGYHGEDQSDQCLKEHAR	29	Oxidation (M)	_SIM(Oxidation (M))AAAGVPVVEGYHGEDQSDQCLKEHAR_	SIM(1)AAAGVPVVEGYHGEDQSDQCLKEHAR	SIM(160)AAAGVPVVEGYHGEDQSDQCLKEHAR	0	1	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	793.6224365234375	4	793.3712	3169.4557	0.34857	0.00027655	-0.20592	-0.00016337	0.14266	0.00011318	793.8725293778675	16.923	0.4419	16.923	16.731	17.173	0					16	4	7	0	0	0	4.7542E-31	1	9082	9082		158.12	138.3	1	211950000			2278	521	1335	1401	3055	3055	377	9606
SIMAAAGVPVVEGYHGEDQSDQCLKEHAR	29	Oxidation (M)	_SIM(Oxidation (M))AAAGVPVVEGYHGEDQSDQCLKEHAR_	SIM(1)AAAGVPVVEGYHGEDQSDQCLKEHAR	SIM(140)AAAGVPVVEGYHGEDQSDQCLKEHAR	0	1	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	635.099365234375	5	634.898416	3169.4557	0.40234	0.00025544	-0.044322	-2.814E-05	0.35801	0.0002273	635.0989048707411	16.923	0.52473	16.923	16.648	17.173	0					16	5	5	0	0	0	3.1891999999999996E-19	1	9088	9088		140.04	125.11	1	176090000			2279	521	1335	1401	3056	3056	377	9606
SIMAAAGVPVVEGYHGEDQSDQCLKEHAR	29	Oxidation (M)	_SIM(Oxidation (M))AAAGVPVVEGYHGEDQSDQCLKEHAR_	SIM(1)AAAGVPVVEGYHGEDQSDQCLKEHAR	SIM(150)AAAGVPVVEGYHGEDQSDQCLKEHAR	0	1	1	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_9	4	793.6224975585938	4	793.3712	3169.4557	0.44806	0.00035548	0.023083	1.8313E-05	0.47114	0.00037379	793.371366463497	16.907	0.26552	16.907	16.782	17.047	0					11	3	4	0	0	0	1.8930000000000002E-25	1	9011	9011		153.34	136.03	1	31785000			2280	521	1335	1401	3057	3057	377	9606
SINPDEAVAYGAAVQAAILMGDK	23	Oxidation (M)	_SINPDEAVAYGAAVQAAILM(Oxidation (M))GDK_	SINPDEAVAYGAAVQAAILM(1)GDK	SINPDEAVAYGAAVQAAILM(70)GDK	0	1	0	P0DMV8;P0DMV9;P34931	P0DMV8	P0DMV8	HSPA1A;HSPA1B;HSPA1L	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like	MULTI-MSMS	DP1141_8	3	774.3897094726562	3	774.054497	2319.14166	0.46397	0.00035914	0.49596	0.0003839	0.95994	0.00074304	774.3893622892244	23.199	0.53757	23.199	22.788	23.325	0					17	6	5	0	0	0	0.00087663	1	18496	18496		69.71	50.312	1	29704000			2281	135	1336	1402	3058	3058	131	9606
SINPDEAVAYGAAVQAAILMGDK	23	Oxidation (M)	_SINPDEAVAYGAAVQAAILM(Oxidation (M))GDK_	SINPDEAVAYGAAVQAAILM(1)GDK	SINPDEAVAYGAAVQAAILM(140)GDK	0	1	0	P0DMV8;P0DMV9;P34931	P0DMV8	P0DMV8	HSPA1A;HSPA1B;HSPA1L	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like	MULTI-MSMS	DP1141_8	3	1161.080322265625	2	1160.57811	2319.14166	1.3114	0.0015219	-0.4411	-0.00051193	0.87027	0.00101	1161.079373333874	23.199	0.28448	23.199	22.953	23.238	0					14	3	5	0	0	0	1.7389E-07	1	18504	18504		142.72	111.85	1	26555000			2282	135	1336	1402	3059	3059	131	9606
SIQFVDWCPTGFK	13	Unmodified	_SIQFVDWCPTGFK_			0	0	0	P68363;P68366	P68363;P68366	P68363	TUBA1B;TUBA4A	Tubulin alpha-1B chain;Tubulin alpha-4A chain	MULTI-MSMS	DP1141_8	3	792.8795166015625	2	792.879401	1583.74425	0.59015	0.00046792	0.42386	0.00033607	1.014	0.00080399	792.8797417129791	21.729	0.80006	21.729	21.379	22.179	0					12	7	2	0	0	0	0.00083594	1	16479	16479		133.42	93.795	1	400470000			2283	321;322	1337	1403	3060	3060		9606
SIQFVDWCPTGFK	13	Unmodified	_SIQFVDWCPTGFK_			0	0	0	P68363;P68366	P68363;P68366	P68363	TUBA1B;TUBA4A	Tubulin alpha-1B chain;Tubulin alpha-4A chain	MULTI-MSMS	DP1141_9	4	793.432861328125	2	792.879401	1583.74425	0.32637	0.00025877	0.10132	8.0337E-05	0.42769	0.00033911	792.8795117606287	21.689	0.68107	21.689	21.438	22.119	0					9	6	2	0	0	0	0.024669	1	16611	16611		75.819	44.326	1	27150000			2284	321;322	1337	1403	3061	3061		9606
SISISVAGGGGGFGAAGGFGGR	22	Unmodified	_SISISVAGGGGGFGAAGGFGGR_			0	0	0	CON__P35908v2;CON__P35908;P35908	CON__P35908v2	CON__P35908v2	KRT2	Keratin, type II cytoskeletal 2 epidermal	MULTI-MSMS	DP1141_7	2	920.4633178710938	2	919.960831	1837.90711	0.5811	0.00053459	1.7913	0.0016479	2.3724	0.0021825	920.4639325897122	20.1	0.50077	20.1	19.95	20.451	0					8	4	3	0	0	0	0.0031755	1	14352	14352		76.868	32.325	1	23713000		+	2285	20	1338	1404	3062	3062		9606
SISISVAR	8	Unmodified	_SISISVAR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_10	5	416.7481994628906	2	416.747985	831.481417	0.34818	0.0001451	0.23279	9.7017E-05	0.58097	0.00024212	416.7480480522256	16.576	0.26657	16.576	16.46	16.727	0					7	3	3	0	0	0	0.014138	1	9004	9004		91.626	14.78	1	152400000		+	2286	102	1339	1405	3063	3063		9606
SISISVAR	8	Unmodified	_SISISVAR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_6	1	416.7485046386719	2	416.747985	831.481417	-0.061566	-2.5658E-05	0.75588	0.00031501	0.69432	0.00028936	416.74831648311624	16.635	0.42397	16.635	16.305	16.729	0					9	4	3	0	0	0	1.5934E-39	2	8044	7885;8044		186.67	43.306	1	262270000		+	2287	102	1339	1405	3064;3065	3065		9606
SISISVAR	8	Unmodified	_SISISVAR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_7	2	416.7482604980469	2	416.747985	831.481417	0.54348	0.00022649	0.034008	1.4173E-05	0.57749	0.00024067	416.7479865309087	16.565	0.32318	16.565	16.415	16.738	0					12	3	5	0	0	0	1.0643E-20	3	8615	8599;8615;8627		169.37	44.92	1	565620000		+	2288	102	1339	1405	3066;3067;3068	3067		9606
SISISVAR	8	Unmodified	_SISISVAR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-SECPEP	DP1141_8	3	416.2505798339844	2	416.747985	831.481417	-0.021793	-9.0823E-06	0.37681	0.00015703	0.35501	0.00014795	416.748118034265	16.612	0.26166	16.612	16.469	16.731	0					4	2	2	0	0	0	0.00014941	1	8555	8555		116.54	16.623	1	106750000		+	2289	102	1339	1405	3069	3069		9606
SISISVAR	8	Unmodified	_SISISVAR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_9	4	417.2521667480469	2	416.747985	831.481417	0.14634	6.0985E-05	0.17274	7.1989E-05	0.31908	0.00013297	416.74806515750424	16.598	0.32355	16.598	16.458	16.782	0					9	3	4	0	0	0	1.0237E-05	2	8513	8513;8516		143.11	45.634	1	473440000		+	2290	102	1339	1405	3070;3071	3070		9606
SIYYITGESK	10	Unmodified	_SIYYITGESK_			0	0	0	P08238;Q58FF8	P08238	P08238	HSP90AB1;HSP90AB2P	Heat shock protein HSP 90-beta;Putative heat shock protein HSP 90-beta 2	MULTI-MSMS	DP1141_8	3	580.7959594726562	2	580.795329	1159.5761	0.21673	0.00012587	0.75173	0.0004366	0.96846	0.00056248	580.7956876314618	17.724	0.40012	17.724	17.374	17.774	0					6	3	2	0	0	0	7.382E-05	1	10308	10308		148.52	97.457	1	15977000			2291	126	1340	1406	3072	3072		9606
SKGSYSCEVTHEGSTVTK	18	Unmodified	_SKGSYSCEVTHEGSTVTK_			0	0	1	CON__Q1RMN8	CON__Q1RMN8	CON__Q1RMN8			MULTI-MSMS	DP1141_10	5	652.9708862304688	3	652.970433	1955.88947	-0.53126	-0.0003469	1.177	0.00076853	0.64572	0.00042164	652.9712245969033	14.183	0.37631	14.183	14.028	14.404	0					15	5	5	0	0	0	4.1363E-23	2	5065	5065;5074		170.79	136.53	1	79193000		+	2292	23	1341	1407	3073;3074	3073		
SKPVFSESLSD	11	Unmodified	_SKPVFSESLSD_			0	0	1	O60220	O60220	O60220	TIMM8A	Mitochondrial import inner membrane translocase subunit Tim8 A	MULTI-MSMS	DP1141_10	5	598.2958984375	2	598.295693	1194.57683	0.20677	0.00012371	0.49516	0.00029625	0.70193	0.00041996	598.2960526514786	17.538	0.70041	17.538	17.187	17.887	0					8	6	2	0	0	0	0.02938	1	10495	10495		123.35	81.479	1	35059000			2293	62	1342	1408	3075	3075		9606
SKTPEIYLAYR	11	Unmodified	_SKTPEIYLAYR_			0	0	1	Q8TAQ2;Q92922	Q8TAQ2;Q92922	Q8TAQ2	SMARCC2;SMARCC1	SWI/SNF complex subunit SMARCC2;SWI/SNF complex subunit SMARCC1	MULTI-MSMS	DP1141_7	2	447.5362243652344	3	447.578477	1339.7136	0.54195	0.00024257	0.079974	3.5795E-05	0.62193	0.00027836	447.57840297791614	17.799	0.2996	17.799	17.549	17.849	0					4	2	2	0	0	0	1.0423E-13	1	10514	10514		165.63	102.56	1	13914000			2294	480;499	1343	1409	3076	3076		9606
SLDLDSIIAEVK	12	Unmodified	_SLDLDSIIAEVK_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_6	1	651.8618774414062	2	651.8612	1301.70785	0.62384	0.00040665	-0.32423	-0.00021135	0.2996	0.0001953	651.8608897529037	22.588	0.30195	22.588	22.426	22.728	0					9	5	2	0	0	0	5.6349E-96	1	17381	17381		211.86	126.7	1	92485000		+	2295	102	1344	1410	3077	3077		9606
SLDLDSIIAEVK	12	Unmodified	_SLDLDSIIAEVK_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_7	2	651.861572265625	2	651.8612	1301.70785	-0.010608	-6.9147E-06	1.0861	0.00070796	1.0754	0.00070104	651.8615086284684	22.609	0.50538	22.609	22.4	22.906	0					10	6	3	0	0	0	4.878E-81	2	17921	17921;17935		210.08	111.49	1	54806000		+	2296	102	1344	1410	3078;3079	3078		9606
SLDLDSIIAEVK	12	Unmodified	_SLDLDSIIAEVK_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_8	3	652.3655395507812	2	651.8612	1301.70785	1.137	0.00074116	-0.23272	-0.0001517	0.90427	0.00058946	651.8607416541321	22.61	0.40857	22.61	22.379	22.788	0					5	4	2	0	0	0	8.9842E-15	1	17712	17712		166.66	98.434	1	67401000		+	2297	102	1344	1410	3080	3080		9606
SLDLDSIIAEVK	12	Unmodified	_SLDLDSIIAEVK_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MSMS	DP1141_9	4	651.861328125	2	651.8612	1301.70785	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.622	1	22.622	22.122	23.122	0								0	0	0	4.654199999999999E-187	1	17800	17800		232.41	137.05	1			+	2298	102	1344	1410	3081	3081		9606
SLEEGEGPIAVIMTPTR	17	Unmodified	_SLEEGEGPIAVIMTPTR_			0	0	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-MSMS	DP1141_6	1	901.1199340820312	2	900.464026	1798.9135	0.5822	0.00052425	-0.0063501	-5.718E-06	0.57585	0.00051853	900.4640539874977	21.096	0.25197	21.096	20.954	21.206	0					4	2	2	0	0	0	1.2074E-09	2	15157	15157;15237		156.08	123.93	1	2901000			2299	445	1345	1411	3082;3083	3082		9606
SLEEGEGPIAVIMTPTR	17	Unmodified	_SLEEGEGPIAVIMTPTR_			0	0	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-MSMS	DP1141_7	2	900.46435546875	2	900.464026	1798.9135	0.65613	0.00059082	0.41111	0.00037019	1.0672	0.00096102	900.9660465481936	21.1	0.49973	21.1	20.75	21.25	0					9	4	3	0	0	0	0.00021204	2	15707	15707;15764		117.7	85.715	1	8899300			2300	445	1345	1411	3084;3085	3084		9606
SLEEGEGPIAVIMTPTR	17	Oxidation (M)	_SLEEGEGPIAVIM(Oxidation (M))TPTR_	SLEEGEGPIAVIM(1)TPTR	SLEEGEGPIAVIM(79)TPTR	0	1	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-SECPEP	DP1141_7	2	908.4622192382812	2	908.461484	1814.90841	0.29461	0.00026764	-0.012614	-1.1459E-05	0.282	0.00025618	908.4616893992915	19.411	0.6002	19.411	19.05	19.65	0					10	5	4	0	0	0	0.012265	1	13303	13303		79.466	38.85	1	20623000			2301	445	1345	1412	3086	3086	329	9606
SLFSPQNTLAAPTGHPPTSGVEK	23	Unmodified	_SLFSPQNTLAAPTGHPPTSGVEK_			0	0	0	Q5VT52	Q5VT52	Q5VT52	RPRD2	Regulation of nuclear pre-mRNA domain-containing protein 2	MULTI-MSMS	DP1141_7	2	779.353515625	3	779.400885	2335.18082	0.54456	0.00042443	-0.068517	-5.3402E-05	0.47605	0.00037103	779.400796541029	18.399	0.30033	18.399	18.149	18.449	0					6	2	3	0	0	0	3.877E-08	1	11523	11523		104.82	83.151	1	49491000			2302	424	1346	1413	3087	3087		9606
SLGNILQAKPTSSPAK	16	Unmodified	_SLGNILQAKPTSSPAK_			0	0	1	Q13428	Q13428	Q13428	TCOF1	Treacle protein	MULTI-MSMS	DP1141_7	2	537.9738159179688	3	537.973667	1610.89917	0.45537	0.00024498	-0.27667	-0.00014884	0.1787	9.6135E-05	537.9736358105911	16.903	0.313	16.903	16.738	17.051	0					12	3	5	0	0	0	0.0078962	1	9162	9162		123.72	74.57	1	81390000			2303	373	1347	1414	3088	3088		9606
SLGNILQAKPTSSPAK	16	Unmodified	_SLGNILQAKPTSSPAK_			0	0	1	Q13428	Q13428	Q13428	TCOF1	Treacle protein	MULTI-SECPEP	DP1141_8	3	537.6298217773438	3	537.973667	1610.89917	0.25715	0.00013834	-0.20018	-0.00010769	0.056974	3.065E-05	537.9735151059733	16.923	0.24172	16.923	16.731	16.973	0					6	2	3	0	0	0	0.020169	1	9028	9028		87.824	59.715	1	27709000			2304	373	1347	1414	3089	3089		9606
SLGPPQGEEDSVPR	14	Unmodified	_SLGPPQGEEDSVPR_			0	0	0	P78527	P78527	P78527	PRKDC	DNA-dependent protein kinase catalytic subunit	MULTI-MSMS	DP1141_6	1	735.3290405273438	2	734.357345	1466.70014	-0.24221	-0.00017787	0.35092	0.0002577	0.10871	7.9831E-05	734.357631397611	16.555	0.48958	16.555	16.105	16.595	0					8	4	3	0	0	0	0.013247	1	7930	7930		84.188	43.194	1	27545000			2305	329	1348	1415	3090	3090		9606
SLLEGEGSSGGGGR	14	Unmodified	_SLLEGEGSSGGGGR_			0	0	0	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_6	1	631.8025512695312	2	631.802205	1261.58986	0.69095	0.00043654	-0.32854	-0.00020757	0.36241	0.00022897	631.8020388002061	15.663	0.39421	15.663	15.51	15.905	0					8	3	3	0	0	0	0.008659	1	6567	6567		89.266	56.656	1	222930000		+	2306	17	1349	1416	3091	3091		9606
SLLEGEGSSGGGGR	14	Unmodified	_SLLEGEGSSGGGGR_			0	0	0	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-SECPEP	DP1141_7	2	631.9686889648438	2	631.802205	1261.58986	0.060477	3.8209E-05	0.44574	0.00028162	0.50621	0.00031983	631.8025283802199	15.664	0.40527	15.664	15.409	15.815	0					5	3	2	0	0	0	6.1656E-12	1	7173	7173		152.54	118.37	1	306590000		+	2307	17	1349	1416	3092	3092		9606
SLLEGEGSSGGGGR	14	Unmodified	_SLLEGEGSSGGGGR_			0	0	0	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MSMS	DP1141_8	3	631.8111572265625	2	631.802205	1261.58986	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.671	1	15.671	15.171	16.171	0								0	0	0	4.5259999999999996E-104	1	6988	6988		201.84	145.41	1			+	2308	17	1349	1416	3093	3093		9606
SLLEGEGSSGGGGR	14	Unmodified	_SLLEGEGSSGGGGR_			0	0	0	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_9	4	631.8025512695312	2	631.802205	1261.58986	0.57638	0.00036416	0.099734	6.3012E-05	0.67611	0.00042717	631.802240896586	15.623	0.5983	15.623	15.274	15.872	0					12	5	4	0	0	0	6.8637E-14	3	6983	6852;6983;7000		161.67	131.5	1	88678000		+	2309	17	1349	1416	3094;3095;3096	3095		9606
SLLNPQDTPVK	11	Unmodified	_SLLNPQDTPVK_			0	0	0	Q5VUA4	Q5VUA4	Q5VUA4	ZNF318	Zinc finger protein 318	MULTI-MSMS	DP1141_7	2	606.3195190429688	2	606.335153	1210.65575	0.6872	0.00041668	-0.42238	-0.00025611	0.26482	0.00016057	606.3348144302577	17.599	0.49938	17.599	17.349	17.849	0					5	4	2	0	0	0	0.0036303	1	10244	10244		128.86	44.975	1	20790000			2310	425	1350	1417	3097	3097		9606
SLNNQFASFIDK	12	Unmodified	_SLNNQFASFIDK_			0	0	0	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_6	1	692.8890991210938	2	692.348791	1382.68303	1.2155	0.00084152	-0.6716	-0.00046498	0.54385	0.00037653	692.3483441582672	20.341	0.29469	20.341	20.19	20.485	0					4	2	2	0	0	0	0.0052004	1	14015	14015		115.29	75.219	1	272610000		+	2311	102	1351	1418	3098	3098		9606
SLNNQFASFIDK	12	Unmodified	_SLNNQFASFIDK_			0	0	0	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_7	2	692.3814697265625	2	692.348791	1382.68303	1.037	0.000718	-0.32743	-0.00022669	0.70962	0.00049131	692.3486060882785	20.301	0.40039	20.301	20.15	20.551	0					7	3	3	0	0	0	6.1066E-30	2	14464	14464;14559		204.56	162.49	1	455150000		+	2312	102	1351	1418	3099;3100	3099		9606
SLNNQFASFIDK	12	Unmodified	_SLNNQFASFIDK_			0	0	0	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MSMS	DP1141_8	3	692.324951171875	2	692.348791	1382.68303	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.312	1	20.312	19.812	20.812	0								0	0	0	0.0045879	1	14305	14305		155.48	41.079	1			+	2313	102	1351	1418	3101	3101		9606
SLNNQFASFIDK	12	Unmodified	_SLNNQFASFIDK_			0	0	0	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_9	4	692.833984375	2	692.348791	1382.68303	0.28755	0.00019909	0.13565	9.3916E-05	0.4232	0.000293	692.3488315320109	20.287	0.40014	20.287	20.136	20.536	0					7	3	3	0	0	0	1.9313E-05	2	14372	14372;14448		169.21	134.03	1	129790000		+	2314	102	1351	1418	3102;3103	3102		9606
SLPDLGLR	8	Unmodified	_SLPDLGLR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	435.75592041015625	2	435.75581	869.497067	0.19642	8.5592E-05	0.20518	8.9409E-05	0.4016	0.000175	435.7559888285955	18.9	0.60044	18.9	18.65	19.25	0					12	5	3	0	0	0	0.00096247	1	12439	12439		124.89	78.224	1	747790000			2315	142	1352	1419	3104	3104		9606
SLPDLGLR	8	Unmodified	_SLPDLGLR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	435.7560729980469	2	435.75581	869.497067	0.33715	0.00014691	0.13225	5.7628E-05	0.4694	0.00020454	435.75583515577745	18.926	1.0011	18.926	18.675	19.676	0					13	9	3	0	0	0	0.013623	1	12246	12246		90.986	56.161	1	66391000			2316	142	1352	1419	3105	3105		9606
SLQQVDEHSKPPHLR	15	Unmodified	_SLQQVDEHSKPPHLR_			0	0	1	O94913	O94913	O94913	PCF11	Pre-mRNA cleavage complex 2 protein Pcf11	MULTI-SECPEP	DP1141_7	2	443.56768798828125	4	443.486596	1769.91728	0.30939	0.00013721	0.22594	0.0001002	0.53532	0.00023741	443.48667985701417	14.651	0.70056	14.651	14.309	15.009	0					7	5	2	0	0	0	0.0075695	1	5606	5606		76.759	59.681	1	22302000			2317	87	1353	1420	3106	3106		9606
SLVEIIEHGLVDEQQK	16	Unmodified	_SLVEIIEHGLVDEQQK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	919.4021606445312	2	918.988723	1835.96289	0.57469	0.00052814	-0.32781	-0.00030126	0.24688	0.00022688	918.9884584496584	21.996	0.29593	21.996	21.85	22.146	0					8	2	4	0	0	0	0	2	17078	17075;17078		276.41	221.37	1	458850000			2318	78	1354	1421	3107;3108	3108		9606
SLVEIIEHGLVDEQQK	16	Unmodified	_SLVEIIEHGLVDEQQK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	919.4022827148438	2	918.988723	1835.96289	0.35909	0.00033	0.68097	0.0006258	1.0401	0.0009558	918.9892183464796	22.029	0.29959	22.029	21.879	22.179	0					4	2	2	0	0	0	0	2	16898	16776;16898		299.2	237.38	1	77398000			2319	78	1354	1421	3109;3110	3110		9606
SLVNLGGSK	9	Unmodified	_SLVNLGGSK_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_8	3	437.7299499511719	2	437.753267	873.491981	-0.16657	-7.2916E-05	-0.19325	-8.4598E-05	-0.35982	-0.00015751	437.7531080240345	16.684	0.35826	16.684	16.469	16.828	0					8	3	3	0	0	0	0.010083	2	8631	8631;8687		98.582	53.601	1	191700000		+	2320	102	1355	1422	3111;3112	3111		9606
SLVNLGGSK	9	Unmodified	_SLVNLGGSK_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_9	4	437.7529602050781	2	437.753267	873.491981	-0.012587	-5.51E-06	-0.45928	-0.00020105	-0.47187	-0.00020656	437.75303332415433	16.643	0.32355	16.643	16.458	16.782	0					8	3	3	0	0	0	0.0044004	2	8562	8479;8562		107.69	51.572	1	231490000		+	2321	102	1355	1422	3113;3114	3114		9606
SLVQANPEVAMDSIIHMTQHISPTQR	26	2 Oxidation (M)	_SLVQANPEVAM(Oxidation (M))DSIIHM(Oxidation (M))TQHISPTQR_	SLVQANPEVAM(1)DSIIHM(1)TQHISPTQR	SLVQANPEVAM(97)DSIIHM(97)TQHISPTQR	0	2	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_10	5	734.86669921875	4	734.61547	2934.43278	0.43422	0.00031898	-0.10119	-7.4336E-05	0.33303	0.00024465	734.8663036724463	18.335	0.99417	18.335	17.688	18.682	0					29	9	7	0	0	0	4.945E-08	2	11873	11648;11873		97.152	68.514	1	98667000			2322	367	1356	1423	3115;3116	3116	284;285	9606
SLVQANPEVAMDSIIHMTQHISPTQR	26	2 Oxidation (M)	_SLVQANPEVAM(Oxidation (M))DSIIHM(Oxidation (M))TQHISPTQR_	SLVQANPEVAM(1)DSIIHM(1)TQHISPTQR	SLVQANPEVAM(53)DSIIHM(53)TQHISPTQR	0	2	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_10	5	980.1533813476562	3	979.151535	2934.43278	-0.065179	-6.382E-05	0.41343	0.00040481	0.34825	0.00034099	979.4864196856291	18.348	0.49945	18.348	17.987	18.487	0					12	4	4	0	0	0	0.00043457	1	12018	12018		52.849	29.854	1	19739000			2323	367	1356	1423	3117	3117	284;285	9606
SLVQANPEVAMDSIIHMTQHISPTQR	26	2 Oxidation (M)	_SLVQANPEVAM(Oxidation (M))DSIIHM(Oxidation (M))TQHISPTQR_	SLVQANPEVAM(1)DSIIHM(1)TQHISPTQR	SLVQANPEVAM(100)DSIIHM(100)TQHISPTQR	0	2	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	734.8666381835938	4	734.61547	2934.43278	0.61402	0.00045107	-0.22304	-0.00016385	0.39098	0.00028722	734.866234768328	18.355	1.2001	18.355	17.505	18.705	0					41	11	8	0	0	0	1.6261E-09	3	10846	10655;10701;10846		100.39	83.68	1	232670000			2324	367	1356	1423	3118;3119;3120	3120	284;285	9606
SLVQANPEVAMDSIIHMTQHISPTQR	26	2 Oxidation (M)	_SLVQANPEVAM(Oxidation (M))DSIIHM(Oxidation (M))TQHISPTQR_	SLVQANPEVAM(1)DSIIHM(1)TQHISPTQR	SLVQANPEVAM(120)DSIIHM(120)TQHISPTQR	0	2	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	979.4866943359375	3	979.151535	2934.43278	0.51171	0.00050104	-0.29	-0.00028395	0.22171	0.00021708	979.485705685325	18.336	0.59947	18.336	17.905	18.504	0					18	5	4	0	0	0	4.9755E-12	3	10865	10662;10766;10865		120.8	104	1	43663000			2325	367	1356	1423	3121;3122;3123	3123	284;285	9606
SLVQANPEVAMDSIIHMTQHISPTQR	26	2 Oxidation (M)	_SLVQANPEVAM(Oxidation (M))DSIIHM(Oxidation (M))TQHISPTQR_	SLVQANPEVAM(1)DSIIHM(1)TQHISPTQR	SLVQANPEVAM(48)DSIIHM(48)TQHISPTQR	0	2	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	735.3685913085938	4	734.61547	2934.43278	0.273	0.00020055	0.17127	0.00012582	0.44427	0.00032637	735.1172766676211	18.218	0.80046	18.218	17.649	18.449	0					21	7	5	0	0	0	0.00114	1	11289	11289		47.796	30.335	1	29633000			2326	367	1356	1423	3124	3124	284;285	9606
SLVQANPEVAMDSIIHMTQHISPTQR	26	2 Oxidation (M)	_SLVQANPEVAM(Oxidation (M))DSIIHM(Oxidation (M))TQHISPTQR_	SLVQANPEVAM(1)DSIIHM(1)TQHISPTQR	SLVQANPEVAM(71)DSIIHM(71)TQHISPTQR	0	2	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_9	4	734.8668823242188	4	734.61547	2934.43278	0.40469	0.00029729	0.082685	6.0742E-05	0.48738	0.00035804	734.8664589088577	18.285	0.89961	18.285	17.738	18.637	0					25	8	6	0	0	0	1.6533E-05	2	11216	11216;11346		71.002	53.286	1	92825000			2327	367	1356	1423	3125;3126	3125	284;285	9606
SLVQANPEVAMDSIIHMTQHISPTQR	26	2 Oxidation (M)	_SLVQANPEVAM(Oxidation (M))DSIIHM(Oxidation (M))TQHISPTQR_	SLVQANPEVAM(1)DSIIHM(1)TQHISPTQR	SLVQANPEVAM(72)DSIIHM(72)TQHISPTQR	0	2	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_9	4	979.4859008789062	3	979.151535	2934.43278	0.38104	0.00037309	-0.18532	-0.00018146	0.19572	0.00019164	979.8196112625769	18.336	0.40031	18.336	18.037	18.437	0					11	3	4	0	0	0	1.6499E-05	1	11408	11408		72.302	47.401	1	12761000			2328	367	1356	1423	3127	3127	284;285	9606
SLVQANPEVAMDSIIHMTQHISPTQR	26	Oxidation (M)	_SLVQANPEVAMDSIIHM(Oxidation (M))TQHISPTQR_	SLVQANPEVAMDSIIHM(1)TQHISPTQR	SLVQANPEVAM(-37)DSIIHM(37)TQHISPTQR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_10	5	731.3718872070312	4	730.616742	2918.43786	1.2995	0.00094946	-0.6088	-0.0004448	0.69073	0.00050466	730.8673311811186	20.499	0.49957	20.499	20.076	20.576	0					19	4	6	0	0	0	4.643E-06	1	15218	15218		80.082	61.202	2	31117000			2329	367	1356	1424	3128	3128	284;285	9606
SLVQANPEVAMDSIIHMTQHISPTQR	26	Oxidation (M)	_SLVQANPEVAM(Oxidation (M))DSIIHMTQHISPTQR_	SLVQANPEVAM(1)DSIIHMTQHISPTQR	SLVQANPEVAM(85)DSIIHM(-85)TQHISPTQR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	730.8682250976562	4	730.616742	2918.43786	0.37572	0.00027451	0.11733	8.5726E-05	0.49306	0.00036023	730.8678702509402	19.699	0.60055	19.699	19.305	19.906	0					20	5	6	0	0	0	3.8991E-31	2	12921	12921;13039		167.88	150.13	2	45915000			2330	367	1356	1424	3129;3130	3129	284;285	9606
SLVQANPEVAMDSIIHMTQHISPTQR	26	Oxidation (M)	_SLVQANPEVAMDSIIHM(Oxidation (M))TQHISPTQR_	SLVQANPEVAMDSIIHM(1)TQHISPTQR	SLVQANPEVAM(-45)DSIIHM(45)TQHISPTQR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	730.3740844726562	4	730.616742	2918.43786	0.50623	0.00036986	0.3059	0.0002235	0.81213	0.00059335	730.8678436590867	20.476	0.68343	20.476	19.998	20.682	0					17	6	4	0	0	0	3.6756E-24	1	14149	14149		115.77	99.659	2	23953000			2331	367	1356	1424	3131	3131	284;285	9606
SLVQANPEVAMDSIIHMTQHISPTQR	26	Oxidation (M)	_SLVQANPEVAM(Oxidation (M))DSIIHMTQHISPTQR_	SLVQANPEVAM(0.893)DSIIHM(0.107)TQHISPTQR	SLVQANPEVAM(9.2)DSIIHM(-9.2)TQHISPTQR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_8	3	730.9375	4	730.616742	2918.43786	0.51692	0.00037767	0.51392	0.00037548	1.0308	0.00075314	730.8676961708564	19.673	0.50144	19.673	19.275	19.777	0					8	4	3	0	0	0	0.0098795	1	13425	13425		52.465	35.124	2	13141000			2332	367	1356	1424	3132	3132	284;285	9606
SLVQANPEVAMDSIIHMTQHISPTQR	26	Oxidation (M)	_SLVQANPEVAM(Oxidation (M))DSIIHMTQHISPTQR_	SLVQANPEVAM(1)DSIIHMTQHISPTQR	SLVQANPEVAM(84)DSIIHM(-84)TQHISPTQR	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_9	4	731.1184692382812	4	730.616742	2918.43786	0.50252	0.00036715	0.12329	9.0077E-05	0.62581	0.00045723	731.118159977237	19.689	0.50031	19.689	19.338	19.838	0					11	4	3	0	0	0	3.1041E-13	1	13438	13438		140.2	121.98	2	25289000			2333	367	1356	1424	3133	3133	284;285	9606
SLVQANPEVAMDSIIHMTQHISPTQR	26	Unmodified	_SLVQANPEVAMDSIIHMTQHISPTQR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_10	5	727.6650390625	4	726.618013	2902.44295	1.2364	0.00089836	-0.67896	-0.00049334	0.55741	0.00040502	726.8678477374558	21.809	0.39969	21.809	21.559	21.959	0					12	3	5	0	0	0	5.3401E-12	1	17121	17121		120.44	98.936	1	18439000			2334	367	1356	1425	3134	3134		9606
SLYESFVSSSDR	12	Unmodified	_SLYESFVSSSDR_			0	0	0	P18615	P18615	P18615	NELFE	Negative elongation factor E	MULTI-MSMS	DP1141_9	4	689.8470458984375	2	688.820064	1375.62557	0.20573	0.00014171	-1.0705	-0.00073736	-0.86473	-0.00059564	688.8195870282466	19.589	0.50109	19.589	19.138	19.639	0					12	4	4	0	0	0	0.020112	1	12747	12747		89.827	66.507	1	44935000			2335	168	1357	1426	3135	3135		9606
SLYGLGGSK	9	Unmodified	_SLYGLGGSK_			0	0	0	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;P04259	CON__P02538;P04259	CON__P02538	KRT6A;KRT6C;KRT6B	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 6B	MULTI-MSMS	DP1141_9	4	441.2401123046875	2	441.239993	880.465432	-0.062414	-2.754E-05	0.1627	7.1789E-05	0.10028	4.4249E-05	441.2399696993844	17.088	0.54091	17.088	16.896	17.437	0					10	5	4	0	0	0	0.0098046	1	9273	9273		90.709	25.037	1	84159000		+	2336	10;101	1358	1427	3136	3136		9606
SMFFFLAQTEQGDIFK	16	Oxidation (M)	_SM(Oxidation (M))FFFLAQTEQGDIFK_	SM(1)FFFLAQTEQGDIFK	SM(300)FFFLAQTEQGDIFK	0	1	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_7	2	963.1336669921875	2	962.96112	1923.90769	0.43818	0.00042195	0.058757	5.658E-05	0.49694	0.00047853	963.463284658682	22.953	0.3306	22.953	22.801	23.132	0					10	4	4	0	0	0	0	1	18485	18485		299.29	262.85	1	26980000			2337	402	1359	1428	3137	3137	309	9606
SMGGAAIAPPTSLVEKDKELPR	22	Unmodified	_SMGGAAIAPPTSLVEKDKELPR_			0	0	2	Q96I25	Q96I25	Q96I25	RBM17	Splicing factor 45	MULTI-SECPEP	DP1141_8	3	755.8673095703125	3	756.406982	2266.19912	0.74372	0.00056255	0.32847	0.00024846	1.0722	0.00081101	756.7413664084982	17.925	0.30052	17.925	17.674	17.975	0					4	2	2	0	0	0	1.7376E-05	1	10630	10630		87.352	68.862	1	8845700			2338	513	1360	1429	3138	3138		9606
SNSNTTQETLEIMK	14	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))SNSNTTQETLEIMK_			1	0	0	Q9Y2K5	Q9Y2K5	Q9Y2K5	R3HDM2	R3H domain-containing protein 2	MULTI-MSMS	DP1141_8	3	546.595947265625	3	546.594415	1636.76142	0.59027	0.00032264	2.0103	0.0010988	2.6006	0.0014214	546.5957074551862	13.538	0.35744	13.538	13.372	13.729	0					6	4	2	0	0	0	0.022081	1	3914	3914		45.28	25.001	1	1375000			2339	609	1361	1430	3139	3139		9606
SNVSDAVAQSTR	12	Unmodified	_SNVSDAVAQSTR_			0	0	0	P60174	P60174	P60174	TPI1	Triosephosphate isomerase	MULTI-MSMS	DP1141_10	5	618.335693359375	2	617.804748	1233.59494	-0.43985	-0.00027174	3.0545	0.0018871	2.6147	0.0016153	617.8063311616046	15.32	0.64907	15.32	14.96	15.609	0					9	7	2	0	0	0	0.021384	1	6820	6820		88.056	52.788	1	3256000			2340	275	1362	1431	3140	3140		9606
SPAGPAATPAQAQAASTPR	19	Unmodified	_SPAGPAATPAQAQAASTPR_			0	0	0	Q13428	Q13428	Q13428	TCOF1	Treacle protein	MULTI-MSMS	DP1141_7	2	874.9950561523438	2	875.447557	1748.88056	-0.1085	-9.499E-05	0.87914	0.00076964	0.77064	0.00067465	875.4482300503244	15.16	0.40052	15.16	14.909	15.309	0					10	3	4	0	0	0	0	3	6268	6268;6327;6446		281.54	256.47	1	37948000			2341	373	1363	1432	3141;3142;3143	3141		9606
SPAGPAATPAQAQAASTPR	19	Unmodified	_SPAGPAATPAQAQAASTPR_			0	0	0	Q13428	Q13428	Q13428	TCOF1	Treacle protein	MULTI-MSMS	DP1141_8	3	875.447998046875	2	875.447557	1748.88056	0.84231	0.0007374	0.43234	0.00037849	1.2747	0.0011159	875.4478102769053	15.221	0.29834	15.221	14.972	15.271	0					6	2	3	0	0	0	1.492E-11	1	6343	6343		159.41	134.56	1	15731000			2342	373	1363	1432	3144	3144		9606
SPISVPGGSALISNLGK	17	Unmodified	_SPISVPGGSALISNLGK_			0	0	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-MSMS	DP1141_6	1	800.3988037109375	2	798.951412	1595.88827	0.20723	0.00016556	0.39374	0.00031458	0.60097	0.00048014	798.9516003837929	20.341	0.29469	20.341	20.19	20.485	0					6	2	3	0	0	0	0.011592	1	14073	14073		84.605	28.562	1	4325900			2343	259	1364	1433	3145	3145		9606
SPISVPGGSALISNLGK	17	Unmodified	_SPISVPGGSALISNLGK_			0	0	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-MSMS	DP1141_7	2	798.8834838867188	2	798.951412	1595.88827	0.8542	0.00068247	-0.3399	-0.00027156	0.5143	0.0004109	798.9507102888241	20.401	0.40057	20.401	20.05	20.451	0					5	3	2	0	0	0	0.0040969	1	14630	14630		138.89	76.071	1	66335000			2344	259	1364	1433	3146	3146		9606
SPISVPGGSALISNLGK	17	Unmodified	_SPISVPGGSALISNLGK_			0	0	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-MSMS	DP1141_8	3	799.885498046875	2	798.951412	1595.88827	0.59048	0.00047176	0.21883	0.00017484	0.80931	0.0006466	798.9515734327304	20.427	0.3009	20.427	20.176	20.477	0					4	2	2	0	0	0	0.00065444	3	14500	14370;14485;14500		132.86	92.366	1	33162000			2345	259	1364	1433	3147;3148;3149	3149		9606
SPLQSVVVR	9	Unmodified	_SPLQSVVVR_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-SECPEP	DP1141_6	1	492.7486267089844	2	492.795466	983.57638	0.18837	9.2827E-05	0.00057096	2.8137E-07	0.18894	9.3108E-05	492.7956634126901	17.053	0.46956	17.053	16.935	17.404	0					10	4	4	0	0	0	0.010417	1	8895	8895		106.36	42.149	1	14109000			2346	612	1365	1434	3150	3150		9606
SPLQSVVVR	9	Unmodified	_SPLQSVVVR_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_7	2	492.7956848144531	2	492.795466	983.57638	0.3732	0.00018391	0.0020395	1.0051E-06	0.37523	0.00018491	492.79543585592654	17.099	0.51811	17.099	16.831	17.349	0					9	5	3	0	0	0	1.3916E-20	1	9453	9453		171.53	102.33	1	239380000			2347	612	1365	1434	3151	3151		9606
SPLQSVVVR	9	Unmodified	_SPLQSVVVR_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_8	3	492.9264831542969	2	492.795466	983.57638	0.39163	0.00019299	0.15413	7.5953E-05	0.54576	0.00026895	492.79558742133065	17.023	0.37296	17.023	16.9	17.273	0					5	3	2	0	0	0	0.0048263	1	9278	9278		110.41	66.639	1	27841000			2348	612	1365	1434	3152	3152		9606
SPPASPESWK	10	Unmodified	_SPPASPESWK_			0	0	0	Q96JM3	Q96JM3	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	MULTI-MSMS	DP1141_7	2	543.3010864257812	2	543.266739	1084.51892	0.46104	0.00025047	-0.68328	-0.00037121	-0.22225	-0.00012074	543.2661810051437	16.165	0.60007	16.165	15.815	16.415	0					11	5	3	0	0	0	0.0068683	1	7849	7849		117.81	64.06	1	37223000			2349	514	1366	1435	3153	3153		9606
SPPHCELMAGHLR	13	Oxidation (M)	_SPPHCELM(Oxidation (M))AGHLR_	SPPHCELM(1)AGHLR	SPPHCELM(140)AGHLR	0	1	0	Q8IWX8	Q8IWX8	Q8IWX8	CHERP	Calcium homeostasis endoplasmic reticulum protein	MULTI-MSMS	DP1141_7	2	507.604248046875	3	507.574744	1519.7024	-0.032782	-1.6639E-05	-2.4382	-0.0012376	-2.471	-0.0012542	507.5749109370719	14.655	1.1625	14.655	13.947	15.109	0					38	11	6	0	0	0	0.00019619	1	5217	5217		136.38	108.51	1	47126000			2350	463	1367	1436	3154	3154	344	9606
SPPHCELMAGHLR	13	Unmodified	_SPPHCELMAGHLR_			0	0	0	Q8IWX8	Q8IWX8	Q8IWX8	CHERP	Calcium homeostasis endoplasmic reticulum protein	MULTI-MSMS	DP1141_8	3	502.2823486328125	3	502.243105	1503.70749	0.62726	0.00031503	-0.50468	-0.00025347	0.12258	6.1563E-05	502.24336404487093	15.524	0.30495	15.524	15.37	15.675	0					6	2	3	0	0	0	0.034611	1	6827	6827		75.788	55.682	1	16658000			2351	463	1367	1437	3155	3155		9606
SPPPESVDTPTSTK	14	Unmodified	_SPPPESVDTPTSTK_			0	0	0	P46013	P46013	P46013	MKI67	Antigen KI-67	MSMS	DP1141_7	2	721.854736328125	2	721.854103	1441.69365	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.668	1	14.668	14.168	15.168	0								0	0	0	0.0084254	1	5527	5527		107.18	82.944	1				2352	232	1368	1438	3156	3156		9606
SPPPESVDTPTSTK	14	Unmodified	_SPPPESVDTPTSTK_			0	0	0	P46013	P46013	P46013	MKI67	Antigen KI-67	MULTI-MSMS	DP1141_8	3	721.8538818359375	2	721.854103	1441.69365	0.079152	5.7136E-05	-0.064694	-4.67E-05	0.014458	1.0436E-05	721.854024515722	14.527	0.41871	14.527	14.354	14.772	0					9	4	3	0	0	0	3.1578E-05	2	5289	5144;5289		147.62	125.09	1	6870600			2353	232	1368	1438	3157;3158	3158		9606
SPPPESVDTPTSTK	14	Unmodified	_SPPPESVDTPTSTK_			0	0	0	P46013	P46013	P46013	MKI67	Antigen KI-67	MULTI-MSMS	DP1141_9	4	721.8543701171875	2	721.854103	1441.69365	0.67677	0.00048853	0.045798	3.3059E-05	0.72257	0.00052159	722.3555932448319	14.554	0.32583	14.554	14.388	14.714	0					5	3	2	0	0	0	0.022466	1	5250	5250		78.548	36.21	1	1720500			2354	232	1368	1438	3159	3159		9606
SPPSTGSTYGSSQKEESAASGGAAYTK	27	Unmodified	_SPPSTGSTYGSSQKEESAASGGAAYTK_			0	0	1	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_7	2	869.7346801757812	3	869.399938	2605.17798	-0.12189	-0.00010597	0.62088	0.00053979	0.49899	0.00043382	869.7347452330014	15.16	0.40022	15.16	15.009	15.409	0					5	3	2	0	0	0	0.00054661	1	6441	6441		61.417	37.506	1	80329000			2355	612	1369	1439	3160	3160		9606
SPPSVTLFPPSTEELNGNK	19	Unmodified	_SPPSVTLFPPSTEELNGNK_			0	0	0	CON__Q1RMN8	CON__Q1RMN8	CON__Q1RMN8			MULTI-MSMS	DP1141_10	5	1008.0116577148438	2	1007.51002	2013.00549	0.78689	0.0007928	-0.1834	-0.00018478	0.60349	0.00060802	1008.0112644136252	19.826	0.30006	19.826	19.676	19.976	0					6	2	3	0	0	0	2.3175E-07	1	14367	14367		152.38	100.77	1	18425000		+	2356	23	1370	1440	3161	3161		
SPQESTGDPGNSSSVSEGK	19	Unmodified	_SPQESTGDPGNSSSVSEGK_			0	0	0	Q9UHF7	Q9UHF7	Q9UHF7	TRPS1	Zinc finger transcription factor Trps1	MULTI-MSMS	DP1141_7	2	926.169921875	2	925.405948	1848.79734	0.63265	0.00058546	-1.1975	-0.0011081	-0.5648	-0.00052267	925.404842279795	13.661	0.25145	13.661	13.528	13.78	0					4	2	2	0	0	0	1.6828E-11	3	4121	4028;4121;4186		159.12	138.34	1	2017200			2357	593	1371	1441	3162;3163;3164	3163		9606
SPQPDPVDTPASTK	14	Unmodified	_SPQPDPVDTPASTK_			0	0	0	P46013	P46013	P46013	MKI67	Antigen KI-67	MSMS	DP1141_7	2	720.35400390625	2	720.354271	1438.69399	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.983	1	14.983	14.483	15.483	0								0	0	0	0.011523	1	6008	6008		110.98	67.342	1				2358	232	1372	1442	3165	3165		9606
SPQVKPASTMGMGPLGK	17	2 Oxidation (M)	_SPQVKPASTM(Oxidation (M))GM(Oxidation (M))GPLGK_	SPQVKPASTM(1)GM(1)GPLGK	SPQVKPASTM(42)GM(42)GPLGK	0	2	1	Q13428	Q13428	Q13428	TCOF1	Treacle protein	MULTI-SECPEP	DP1141_10	5	573.9678344726562	3	573.291902	1716.85388	0.42688	0.00024473	-1.7494	-0.0010029	-1.3225	-0.00075817	573.2908799386349	14.531	0.26105	14.531	14.339	14.6	0					5	3	2	0	0	0	0.03022	1	5621	5621		42.149	15.123	1	1862500			2359	373	1373	1443	3166	3166	295;296	9606
SPSELFAQHIVTIVHHVK	18	Unmodified	_SPSELFAQHIVTIVHHVK_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_7	2	681.7119750976562	3	681.377575	2041.11089	0.39069	0.00026621	0.22502	0.00015332	0.61571	0.00041953	681.7120576708895	19.3	0.50094	19.3	18.95	19.451	0					19	4	5	0	0	0	0.00010391	2	12990	12778;12990		138.97	107.93	1	272060000			2360	612	1374	1444	3167;3168	3168		9606
SPSELFAQHIVTIVHHVK	18	Unmodified	_SPSELFAQHIVTIVHHVK_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_8	3	511.5360107421875	4	511.285	2041.11089	0.63265	0.00032347	-0.059743	-3.0546E-05	0.57291	0.00029292	511.28498980916424	19.325	0.4002	19.325	19.075	19.476	0					6	3	2	0	0	0	0.0095098	1	12890	12890		70.335	48.517	1	69403000			2361	612	1374	1444	3169	3169		9606
SPSSESSPQHPTPPARPR	18	Unmodified	_SPSSESSPQHPTPPARPR_			0	0	1	O14733	O14733	O14733	MAP2K7	Dual specificity mitogen-activated protein kinase kinase 7	MULTI-SECPEP	DP1141_9	4	479.7418518066406	4	479.490873	1913.93439	0.22246	0.00010667	0.20116	9.6455E-05	0.42362	0.00020312	479.49097623169723	12.828	0.79744	12.828	12.502	13.299	0					18	7	4	0	0	0	0.00030067	1	2874	2874		87.447	65.013	1	1155100			2362	45	1375	1445	3170	3170		9606
SPTWFGIPR	9	Unmodified	_SPTWFGIPR_			0	0	0	P78347	P78347	P78347	GTF2I	General transcription factor II-I	MULTI-MSMS	DP1141_7	2	530.3139038085938	2	530.782359	1059.55016	0.46174	0.00024508	0.16486	8.7507E-05	0.6266	0.00033259	530.782337108637	20.601	0.59994	20.601	20.15	20.75	0					9	5	3	0	0	0	1.8956E-14	2	14877	14877;14962		168.23	119.67	1	16446000			2363	327	1376	1446	3171;3172	3171		9606
SPTWFGIPR	9	Unmodified	_SPTWFGIPR_			0	0	0	P78347	P78347	P78347	GTF2I	General transcription factor II-I	MULTI-MSMS	DP1141_8	3	530.8153076171875	2	530.782359	1059.55016	0.085933	4.5611E-05	0.81214	0.00043107	0.89807	0.00047668	530.7823487091046	20.527	0.40074	20.527	20.377	20.778	0					5	3	2	0	0	0	0.027943	1	14676	14676		77.318	26.258	1	4705600			2364	327	1376	1446	3173	3173		9606
SPYQEFTDHLVK	12	Unmodified	_SPYQEFTDHLVK_			0	0	0	P15880	P15880	P15880	RPS2	40S ribosomal protein S2	MULTI-MSMS	DP1141_10	5	488.5768127441406	3	488.577025	1462.70924	0.53005	0.00025897	0.094066	4.5958E-05	0.62411	0.00030493	488.5771554558554	18.827	0.59012	18.827	18.487	19.077	0					10	5	3	0	0	0	2.6563E-06	1	12646	12646		142.76	109.9	1	41186000			2365	155	1377	1447	3174	3174		9606
SPYQEFTDHLVK	12	Unmodified	_SPYQEFTDHLVK_			0	0	0	P15880	P15880	P15880	RPS2	40S ribosomal protein S2	MULTI-MSMS	DP1141_9	4	732.8289184570312	2	732.361899	1462.70924	0.48098	0.00035225	-0.53246	-0.00038995	-0.051481	-3.7703E-05	732.3623737638216	18.787	0.50033	18.787	18.537	19.037	0					9	4	3	0	0	0	1.0878E-29	2	12008	11937;12008		176.95	136.07	1	17195000			2366	155	1377	1447	3175;3176	3176		9606
SPYQEFTDHLVK	12	Unmodified	_SPYQEFTDHLVK_			0	0	0	P15880	P15880	P15880	RPS2	40S ribosomal protein S2	MULTI-SECPEP	DP1141_9	4	488.248779296875	3	488.577025	1462.70924	0.19618	9.5849E-05	0.17554	8.5767E-05	0.37172	0.00018162	488.5772223258038	18.787	0.70075	18.787	18.437	19.138	0					13	6	3	0	0	0	0.021285	1	12110	12110		65.234	43.838	1	77182000			2367	155	1377	1447	3177	3177		9606
SQEEPKDTFEHDPSESIDEFNK	22	Unmodified	_SQEEPKDTFEHDPSESIDEFNK_			0	0	1	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_7	2	653.3432006835938	4	652.788498	2607.12489	0.03627	2.3677E-05	0.36386	0.00023753	0.40013	0.0002612	653.039407891846	17.59	0.59968	17.59	17.349	17.949	0					11	5	4	0	0	0	0.0034526	1	10193	10193		83.395	71.439	1	29891000			2368	580	1378	1448	3178	3178		9606
SQEEPKDTFEHDPSESIDEFNK	22	Unmodified	_SQEEPKDTFEHDPSESIDEFNK_			0	0	1	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_7	2	870.3839111328125	3	870.048905	2607.12489	0.52721	0.0004587	-0.072247	-6.2858E-05	0.45496	0.00039584	870.3828187470292	17.621	0.59968	17.621	17.349	17.949	0					16	5	5	0	0	0	1.9837E-06	2	10294	10294;10442		122.35	105.63	1	50947000			2369	580	1378	1448	3179;3180	3179		9606
SQIFSTASDNQPTVTIK	17	Unmodified	_SQIFSTASDNQPTVTIK_			0	0	0	P11021	P11021	P11021	HSPA5	78 kDa glucose-regulated protein	MULTI-MSMS	DP1141_8	3	918.9716186523438	2	918.97053	1835.92651	0.44227	0.00040644	0.67771	0.00062279	1.12	0.0010292	918.9711689095891	18.425	0.30011	18.425	18.275	18.575	0					4	2	2	0	0	0	0.017288	1	11623	11623		78.373	46.214	1	89398000			2370	139	1379	1449	3181	3181		9606
SQIHDIVLVGGSTR	14	Unmodified	_SQIHDIVLVGGSTR_			0	0	0	P11142	P11142	P11142	HSPA8	Heat shock cognate 71 kDa protein	MULTI-MSMS	DP1141_8	3	494.60748291015625	3	494.607207	1480.79979	0.51196	0.00025322	0.053467	2.6445E-05	0.56542	0.00027966	494.6072651490823	17.323	0.40098	17.323	17.173	17.574	0					10	3	4	0	0	0	0.011587	1	9882	9882		63.037	33.349	1	114460000			2371	140	1380	1450	3182	3182		9606
SQIHDIVLVGGSTR	14	Unmodified	_SQIHDIVLVGGSTR_			0	0	0	P11142	P11142	P11142	HSPA8	Heat shock cognate 71 kDa protein	MULTI-MSMS	DP1141_8	3	741.4078979492188	2	741.407172	1480.79979	0.72824	0.00053992	0.3541	0.00026253	1.0823	0.00080246	741.4074297081538	17.323	0.30099	17.323	17.173	17.474	0					4	2	2	0	0	0	0.010056	1	9886	9886		87.719	63.733	1	69990000			2372	140	1380	1450	3183	3183		9606
SQKQEEENPAEETGEEKQDTQEK	23	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))SQKQEEENPAEETGEEKQDTQEK_			1	0	2	O43768	O43768	O43768	ENSA	Alpha-endosulfine	MULTI-MSMS	DP1141_10	5	912.0715942382812	3	911.737167	2732.18967	0.025008	2.2801E-05	-0.090395	-8.2417E-05	-0.065387	-5.9616E-05	912.0713652998363	14.436	0.19612	14.436	14.276	14.472	0					6	2	3	0	0	0	7.2102E-239	1	5478	5478		251	231.98	1	9100000			2373	60	1381	1451	3184	3184		9606
SQPDPVDTPTSSKPQSK	17	Unmodified	_SQPDPVDTPTSSKPQSK_			0	0	1	P46013	P46013	P46013	MKI67	Antigen KI-67	MULTI-MSMS	DP1141_7	2	600.2991333007812	3	600.298767	1797.87447	0.81418	0.00048875	-0.40198	-0.00024131	0.4122	0.00024744	600.2984958028622	13.656	0.90999	13.656	13.125	14.035	0					33	9	5	0	0	0	0.00067272	1	3828	3828		138.91	107.13	1	11709000			2374	232	1382	1452	3185	3185		9606
SQPDPVDTPTSSKPQSK	17	Unmodified	_SQPDPVDTPTSSKPQSK_			0	0	1	P46013	P46013	P46013	MKI67	Antigen KI-67	MSMS	DP1141_8	3	600.2991333007812	3	600.298767	1797.87447	NaN	NaN	NaN	NaN	NaN	NaN	NaN	13.702	1	13.702	13.202	14.202	0								0	0	0	0.00049956	1	4010	4010		167.29	133.98	1				2375	232	1382	1452	3186	3186		9606
SQPDPVDTPTSSKPQSK	17	Unmodified	_SQPDPVDTPTSSKPQSK_			0	0	1	P46013	P46013	P46013	MKI67	Antigen KI-67	MULTI-MSMS	DP1141_9	4	600.2991943359375	3	600.298767	1797.87447	-0.060314	-3.6206E-05	0.7832	0.00047016	0.72289	0.00043395	600.63345343826	13.687	0.48625	13.687	13.391	13.877	0					16	6	3	0	0	0	0.030724	1	3905	3905		96.096	67.813	1	2076400			2376	232	1382	1452	3187	3187		9606
SQYEQLAEQNR	11	Unmodified	_SQYEQLAEQNR_			0	0	0	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MSMS	DP1141_6	1	683.3041381835938	2	683.323305	1364.63206	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.917	1	15.917	15.417	16.417	0								0	0	0	0	1	6826	6826		332.17	259.29	1			+	2377	17	1383	1453	3188	3188		9606
SQYEQLAEQNRK	12	Unmodified	_SQYEQLAEQNRK_			0	0	1	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_10	5	498.5831604003906	3	498.58295	1492.72702	0.13075	6.5191E-05	0.074011	3.6901E-05	0.20476	0.00010209	498.58303747534825	14.843	0.43891	14.843	14.6	15.039	0					10	5	4	0	0	0	0.00045171	1	6100	6100		166.29	134.57	1	68347000		+	2378	17	1384	1454	3189	3189		9606
SQYEQLAEQNRK	12	Unmodified	_SQYEQLAEQNRK_			0	0	1	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_6	1	498.5830078125	3	498.58295	1492.72702	-0.3621	-0.00018054	0.52034	0.00025943	0.15824	7.8897E-05	498.5834026313422	14.858	0.79982	14.858	14.609	15.408	0					9	6	2	0	0	0	2.5162E-09	1	5221	5221		178.53	147.96	1	246280000		+	2379	17	1384	1454	3190	3190		9606
SQYEQLAEQNRK	12	Unmodified	_SQYEQLAEQNRK_			0	0	1	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_7	2	747.806396484375	2	747.370786	1492.72702	0.40919	0.00030581	-0.4051	-0.00030276	0.0040885	3.0556E-06	747.3705404070447	14.759	0.30069	14.759	14.608	14.909	0					6	2	3	0	0	0	1.8788E-176	2	5797	5797;5828		242.49	189.37	1	25496000		+	2380	17	1384	1454	3191;3192	3191		9606
SQYEQLAEQNRK	12	Unmodified	_SQYEQLAEQNRK_			0	0	1	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_7	2	498.5830383300781	3	498.58295	1492.72702	-0.20178	-0.0001006	0.056386	2.8113E-05	-0.14539	-7.249E-05	498.5829787727006	14.759	0.50093	14.759	14.508	15.009	0					13	4	5	0	0	0	0.0032015	1	5823	5823		132.32	105.57	1	136850000		+	2381	17	1384	1454	3193	3193		9606
SQYEQLAEQNRK	12	Unmodified	_SQYEQLAEQNRK_			0	0	1	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_9	4	498.5830078125	3	498.58295	1492.72702	0.10909	5.4391E-05	0.25254	0.00012591	0.36163	0.0001803	498.5833039343247	14.84	0.54038	14.84	14.634	15.174	0					13	5	4	0	0	0	0.00099269	2	5599	5571;5599		167.11	134.96	1	366780000		+	2382	17	1384	1454	3194;3195	3195		9606
SRAPATTNNTAHQ	13	Unmodified	_SRAPATTNNTAHQ_			0	0	1	Q6ZR62	Q6ZR62	Q6ZR62	ZCCHC16	Zinc finger CCHC domain-containing protein 16	MSMS	DP1141_6	1	684.8359985351562	2	684.834371	1367.65419	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.715	1	16.715	16.215	17.215	0								0	0	0	0.011883	1	8168	8168		111.27	73.179	1				2383	441	1385	1455	3196	3196		9606
SREIFLSQPILLELEAPLK	19	Unmodified	_SREIFLSQPILLELEAPLK_			0	0	1	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_8	3	733.4290161132812	3	732.759462	2195.25656	0.5592	0.00040976	-0.59535	-0.00043625	-0.036149	-2.6488E-05	733.0932375184328	22.999	0.36935	22.999	22.788	23.157	0					10	4	3	0	0	0	1.3654E-06	1	18350	18350		150.65	133.63	1	42336000			2384	286;212;287	1386	1456	3197	3197		9606
SREIFLSQPILLELEAPLK	19	Unmodified	_SREIFLSQPILLELEAPLK_			0	0	1	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_9	4	733.4003295898438	3	732.759462	2195.25656	0.62219	0.00045591	0.029622	2.1706E-05	0.65181	0.00047762	732.7593774002777	22.987	0.34099	22.987	22.779	23.12	0					8	4	3	0	0	0	3.7309E-05	4	18418	18346;18418;18455;18458		142.23	127.03	1	20027000			2385	286;212;287	1386	1456	3198;3199;3200;3201	3199		9606
SREQSSEAAETGVSENEENPVR	22	Unmodified	_SREQSSEAAETGVSENEENPVR_			0	0	1	Q29RF7	Q29RF7	Q29RF7	PDS5A	Sister chromatid cohesion protein PDS5 homolog A	MULTI-MSMS	DP1141_7	2	802.8794555664062	3	802.365227	2404.07385	0.092392	7.4132E-05	1.6637	0.0013349	1.7561	0.0014091	802.7003196012805	15.26	0.30025	15.26	15.009	15.309	0					4	2	2	0	0	0	5.0371E-07	1	6343	6343		116.35	79.492	1	5663700			2386	415	1387	1457	3202	3202		9606
SRWDETPASQMGGSTPVLTPGK	22	Oxidation (M)	_SRWDETPASQM(Oxidation (M))GGSTPVLTPGK_	SRWDETPASQM(1)GGSTPVLTPGK	SRWDETPASQM(70)GGSTPVLTPGK	0	1	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	773.7088012695312	3	773.37423	2317.10086	0.86533	0.00066922	-1.2321	-0.00095289	-0.36679	-0.00028367	773.7072711673562	17.299	0.5573	17.299	16.892	17.45	0					10	5	4	0	0	0	0.005444	1	9954	9954		70.15	40.067	1	33917000			2387	78	1388	1458	3203	3203	72	9606
SSATSGDIWPGLSAYDNSPR	20	Unmodified	_SSATSGDIWPGLSAYDNSPR_			0	0	0	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_7	2	1041.035400390625	2	1040.98216	2079.94976	0.67945	0.00070729	-0.38888	-0.00040482	0.29057	0.00030248	1041.483326393807	20.7	0.49962	20.7	20.351	20.85	0					9	4	3	0	0	0	4.5688E-201	2	15105	15105;15157		271.08	236.16	1	29677000			2388	580	1389	1459	3204;3205	3204		9606
SSDAFTTQHALR	12	Unmodified	_SSDAFTTQHALR_			0	0	0	O95239	O95239	O95239	KIF4A	Chromosome-associated kinesin KIF4A	MULTI-SECPEP	DP1141_7	2	444.9263000488281	3	445.221352	1332.64223	0.1583	7.0479E-05	-0.12492	-5.5616E-05	0.033384	1.4863E-05	445.22130223856544	15.459	0.40455	15.459	15.21	15.614	0					5	3	2	0	0	0	0.020723	1	6831	6831		72.731	46.792	1	35949000			2389	89	1390	1460	3206	3206		9606
SSFYPDGGDQETAK	14	Unmodified	_SSFYPDGGDQETAK_			0	0	0	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_7	2	750.8534545898438	2	751.32571	1500.63687	1.0122	0.00076049	-0.44299	-0.00033283	0.56921	0.00042766	751.3250382779288	16.465	0.52322	16.465	16.215	16.738	0					9	5	2	0	0	0	6.2256E-30	2	8312	8312;8476		178.46	140.9	1	43168000			2390	580	1391	1461	3207;3208	3207		9606
SSFYPDGGDQETAK	14	Unmodified	_SSFYPDGGDQETAK_			0	0	0	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MSMS	DP1141_8	3	751.3264770507812	2	751.32571	1500.63687	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.525	1	16.525	16.025	17.025	0								0	0	0	0.013577	1	8393	8393		109.16	69.219	1				2391	580	1391	1461	3209	3209		9606
SSGGREDLESSGLQR	15	Unmodified	_SSGGREDLESSGLQR_			0	0	1	Q9UK76	Q9UK76	Q9UK76	HN1	Hematological and neurological expressed 1 protein;Hematological and neurological expressed 1 protein, N-terminally processed	MULTI-MSMS	DP1141_10	5	526.5889892578125	3	526.588652	1576.74413	0.1333	7.0194E-05	0.21084	0.00011102	0.34414	0.00018122	526.5887453120048	14.994	0.38444	14.994	14.736	15.12	0					13	4	5	0	0	0	0.0001416	1	6342	6342		148.18	116.86	1	82540000			2392	596	1392	1462	3210	3210		9606
SSGGREDLESSGLQR	15	Unmodified	_SSGGREDLESSGLQR_			0	0	1	Q9UK76	Q9UK76	Q9UK76	HN1	Hematological and neurological expressed 1 protein;Hematological and neurological expressed 1 protein, N-terminally processed	MULTI-SECPEP	DP1141_10	5	788.875732421875	2	789.37934	1576.74413	0.36789	0.00029041	0.22106	0.0001745	0.58895	0.00046491	789.3798193192547	14.995	0.23264	14.995	14.806	15.039	0					6	2	3	0	0	0	8.4938E-60	1	6289	6289		195.77	129.58	1	12867000			2393	596	1392	1462	3211	3211		9606
SSGHSSSELSPDAVEK	16	Unmodified	_SSGHSSSELSPDAVEK_			0	0	0	Q9UQ35	Q9UQ35	Q9UQ35	SRRM2	Serine/arginine repetitive matrix protein 2	MULTI-MSMS	DP1141_6	1	539.758544921875	3	539.584796	1615.73256	-0.043537	-2.3492E-05	1.2065	0.00065099	1.1629	0.0006275	539.5850555039291	14.658	0.29943	14.658	14.409	14.708	0					4	2	2	0	0	0	0.020893	1	4959	4959		61.649	42.45	1	1175500			2394	607	1393	1463	3212	3212		9606
SSGPTSLFAVTVAPPGAR	18	Unmodified	_SSGPTSLFAVTVAPPGAR_			0	0	0	Q00839	Q00839	Q00839	HNRNPU	Heterogeneous nuclear ribonucleoprotein U	MULTI-MSMS	DP1141_6	1	858.4620361328125	2	857.959768	1713.90498	0.99089	0.00085014	-0.15147	-0.00012996	0.83941	0.00072018	857.959810929232	20.532	0.2911	20.532	20.291	20.582	0					6	2	3	0	0	0	0.010216	1	14291	14291		103.85	68.143	1	10581000			2395	337	1394	1464	3213	3213		9606
SSGPTSLFAVTVAPPGAR	18	Unmodified	_SSGPTSLFAVTVAPPGAR_			0	0	0	Q00839	Q00839	Q00839	HNRNPU	Heterogeneous nuclear ribonucleoprotein U	MULTI-MSMS	DP1141_7	2	857.9599609375	2	857.959768	1713.90498	0.70805	0.00060748	0.15242	0.00013077	0.86048	0.00073825	858.4614323604915	20.501	0.40039	20.501	20.15	20.551	0					7	3	3	0	0	0	0.0015444	1	14833	14833		157.5	102.71	1	86812000			2396	337	1394	1464	3214	3214		9606
SSGPYGGGGQYFAKPR	16	Unmodified	_SSGPYGGGGQYFAKPR_			0	0	1	P09651	P09651	P09651	HNRNPA1	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed	MULTI-MSMS	DP1141_9	4	543.7591552734375	3	543.598711	1627.7743	0.46698	0.00025385	0.24236	0.00013175	0.70934	0.0003856	543.5987929383402	16.308	0.49492	16.308	16.058	16.553	0					12	4	4	0	0	0	0.018889	1	7921	7921		133.98	112.92	1	240260000			2397	130	1395	1465	3215	3215		9606
SSGPYGGGGQYFAKPR	16	Unmodified	_SSGPYGGGGQYFAKPR_			0	0	1	P09651	P09651	P09651	HNRNPA1	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed	MULTI-MSMS	DP1141_9	4	814.6075439453125	2	814.894429	1627.7743	-0.44774	-0.00036486	0.79695	0.00064943	0.3492	0.00028456	814.8953268723711	16.308	0.30008	16.308	16.158	16.458	0					6	2	3	0	0	0	7.1623E-211	2	8037	8037;8136		242.97	209.01	1	33524000			2398	130	1395	1465	3216;3217	3216		9606
SSMSGLHLVK	10	Unmodified	_SSMSGLHLVK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	530.5779418945312	2	529.786784	1057.55902	0.22423	0.0001188	-0.2788	-0.00014771	-0.054569	-2.891E-05	529.7866700214828	16.355	0.50022	16.355	16.005	16.505	0					10	4	4	0	0	0	0.0023511	2	7462	7462;7575		129.42	89.318	1	59376000			2399	367	1396	1466	3218;3219	3218		9606
SSNPSISDDSYFR	13	Unmodified	_SSNPSISDDSYFR_			0	0	0	Q8IX01	Q8IX01	Q8IX01	SUGP2	SURP and G-patch domain-containing protein 2	MULTI-MSMS	DP1141_7	2	737.390380859375	2	737.825877	1473.6372	0.38758	0.00028597	0.3871	0.00028561	0.77468	0.00057158	738.3273761805866	18.099	0.30014	18.099	17.949	18.249	0					4	2	2	0	0	0	0.0045082	1	11133	11133		115.91	74.921	1	7871100			2400	464	1397	1467	3220	3220		9606
SSPSVKPAVDPAAAK	15	Unmodified	_SSPSVKPAVDPAAAK_			0	0	1	Q6FI81	Q6FI81	Q6FI81	CIAPIN1	Anamorsin	MULTI-MSMS	DP1141_9	4	475.5093994140625	3	475.596308	1423.76709	0.47206	0.00022451	-0.25807	-0.00012274	0.214	0.00010178	475.5961563620905	14.432	0.53607	14.432	14.178	14.714	0					10	6	3	0	0	0	0.013003	1	4918	4918		95.195	62.901	1	11271000			2401	430	1398	1468	3221	3221		9606
SSRPGREDVGAAGAR	15	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))SSRPGREDVGAAGAR_			1	0	2	Q8TA86	Q8TA86	Q8TA86	RP9	Retinitis pigmentosa 9 protein	MSMS	DP1141_10	5	509.92578125	3	509.925598	1526.75497	NaN	NaN	NaN	NaN	NaN	NaN	NaN	13.698	1	13.698	13.198	14.198	0								0	0	0	0.022182	1	4362	4362		80.371	47.873	1				2402	479	1399	1469	3222	3222		9606
SSRPGREDVGAAGAR	15	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))SSRPGREDVGAAGAR_			1	0	2	Q8TA86	Q8TA86	Q8TA86	RP9	Retinitis pigmentosa 9 protein	MULTI-SECPEP	DP1141_9	4	509.5649719238281	3	509.925598	1526.75497	-0.18999	-9.6882E-05	0.48156	0.00024556	0.29157	0.00014868	509.9260309135727	13.637	0.26853	13.637	13.474	13.743	0					5	3	2	0	0	0	0.028274	1	3792	3792		41.577	11.889	1	1960400			2403	479	1399	1469	3223	3223		9606
SSSSSAASDTATSTQRPLR	19	Unmodified	_SSSSSAASDTATSTQRPLR_			0	0	1	Q96T37	Q96T37	Q96T37	RBM15	Putative RNA-binding protein 15	MULTI-SECPEP	DP1141_7	2	636.9818115234375	3	637.311847	1908.91371	0.47928	0.00030545	0.44226	0.00028186	0.92154	0.00058731	637.3119944329615	13.99	0.25508	13.99	13.78	14.035	0					4	2	2	0	0	0	7.3534E-07	1	4546	4546		112.5	58.672	1	16570000			2404	525	1400	1470	3224	3224		9606
SSTATHPPGPAVQLNK	16	Unmodified	_SSTATHPPGPAVQLNK_			0	0	0	Q14684	Q14684	Q14684	RRP1B	Ribosomal RNA processing protein 1 homolog B	MULTI-MSMS	DP1141_10	5	535.9910278320312	3	535.617883	1603.83182	-0.19221	-0.00010295	1.063	0.00056938	0.87083	0.00046643	535.6184659639465	14.995	0.46296	14.995	14.736	15.199	0					10	5	3	0	0	0	0.0087901	1	6375	6375		100.73	65.829	1	36484000			2405	390	1401	1471	3225	3225		9606
SSTPLPTISSSAENTR	16	Unmodified	_SSTPLPTISSSAENTR_			0	0	0	P42166	P42166	P42166	TMPO	Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin	MSMS	DP1141_8	3	824.4130249023438	2	824.412848	1646.81114	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.238	1	17.238	16.738	17.738	0								0	0	0	4.9838E-75	1	9567	9567		188.96	127.01	1				2406	225	1402	1472	3226	3226		9606
SSTPLPTISSSAENTR	16	Unmodified	_SSTPLPTISSSAENTR_			0	0	0	P42166	P42166	P42166	TMPO	Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin	MULTI-SECPEP	DP1141_9	4	824.9143676757812	2	824.412848	1646.81114	-0.40748	-0.00033593	0.8223	0.00067791	0.41482	0.00034198	824.4134649691207	17.188	0.48398	17.188	16.854	17.338	0					6	5	2	0	0	0	7.9893E-50	1	9502	9502		188.48	138.03	1	79875000			2407	225	1402	1472	3227	3227		9606
SSVETTPSVIQHVGQPPATPAK	22	Unmodified	_SSVETTPSVIQHVGQPPATPAK_			0	0	0	Q6W2J9	Q6W2J9	Q6W2J9	BCOR	BCL-6 corepressor	MULTI-MSMS	DP1141_7	2	745.0630493164062	3	744.39373	2230.15936	0.82661	0.00061532	0.26733	0.000199	1.0939	0.00081432	744.7282396136994	16.899	0.313	16.899	16.738	17.051	0					10	3	4	0	0	0	1.7065E-09	2	9232	9232;9330		108.12	81.315	1	13270000			2408	438	1403	1473	3228;3229	3228		9606
STADSGGEGLETAPK	15	Unmodified	_STADSGGEGLETAPK_			0	0	0	Q8NFC6	Q8NFC6	Q8NFC6	BOD1L1	Biorientation of chromosomes in cell division protein 1-like 1	MULTI-SECPEP	DP1141_7	2	709.8292846679688	2	710.333535	1418.65252	0.35098	0.00024931	-2.1449	-0.0015236	-1.7939	-0.0012743	710.331810702837	14.859	0.30069	14.859	14.608	14.909	0					4	2	2	0	0	0	9.8607E-06	1	5841	5841		133.07	96.376	1	14227000			2409	474	1404	1474	3230	3230		9606
STELLIR	7	Unmodified	_STELLIR_			0	0	0	Q71DI3;Q16695;P84243;P68431;Q5TEC6;Q6NXT2	Q71DI3	Q71DI3	HIST2H3A;HIST3H3;H3F3A;HIST1H3A;HIST2H3PS2;H3F3C	Histone H3.2;Histone H3.1t;Histone H3.3;Histone H3.1;Histone H3;Histone H3.3C	MULTI-MSMS	DP1141_10	5	831.9193725585938	1	831.493444	830.486168	-0.18866	-0.00015687	0.76036	0.00063224	0.5717	0.00047537	831.4939938376288	17.237	0.40057	17.237	17.087	17.488	0					7	3	3	0	0	0	2.4702E-95	2	10083	10083;10216		212.65	70.128	1	133350000			2410	324	1405	1475	3231;3232	3231		9606
STELLIR	7	Unmodified	_STELLIR_			0	0	0	Q71DI3;Q16695;P84243;P68431;Q5TEC6;Q6NXT2	Q71DI3	Q71DI3	HIST2H3A;HIST3H3;H3F3A;HIST1H3A;HIST2H3PS2;H3F3C	Histone H3.2;Histone H3.1t;Histone H3.3;Histone H3.1;Histone H3;Histone H3.3C	MULTI-MSMS	DP1141_10	5	416.25054931640625	2	416.25036	830.486168	-0.10748	-4.4738E-05	0.33439	0.00013919	0.22692	9.4454E-05	416.2505962294048	17.237	0.60044	17.237	17.087	17.688	0					16	5	5	0	0	0	2.1961E-22	2	10226	10133;10226		170.43	76.839	1	1101400000			2411	324	1405	1475	3233;3234	3234		9606
STESLQANVQR	11	Unmodified	_STESLQANVQR_			0	0	0	P26373	P26373	P26373	RPL13	60S ribosomal protein L13	MULTI-MSMS	DP1141_10	5	616.8153076171875	2	616.815116	1231.61568	-0.43258	-0.00026682	0.73963	0.00045621	0.30704	0.00018939	616.8156451804349	14.995	0.47395	14.995	14.806	15.28	0					12	5	4	0	0	0	5.6423E-132	1	6361	6361		226.46	175.65	1	141660000			2412	188	1406	1476	3235	3235		9606
STESLQANVQR	11	Unmodified	_STESLQANVQR_			0	0	0	P26373	P26373	P26373	RPL13	60S ribosomal protein L13	MULTI-MSMS	DP1141_6	1	617.2849731445312	2	616.815116	1231.61568	0.13569	8.3699E-05	0.011027	6.8014E-06	0.14672	9.05E-05	616.815134887508	14.958	0.30017	14.958	14.808	15.108	0					4	2	2	0	0	0	5.3307E-176	1	5472	5472		239.82	195.45	1	5647900			2413	188	1406	1476	3236	3236		9606
STFREESPLR	10	Unmodified	_STFREESPLR_			0	0	1	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-SECPEP	DP1141_7	2	611.3736572265625	2	611.314751	1220.61495	0.42711	0.0002611	0.088644	5.419E-05	0.51576	0.00031529	611.3149246592099	15.664	1.1053	15.664	15.309	16.415	0					19	10	3	0	0	0	0.0060657	1	7032	7032		93.598	44.156	1	51912000			2414	580	1407	1477	3237	3237		9606
STFVLDEFKR	10	Unmodified	_STFVLDEFKR_			0	0	1	P26641	P26641	P26641	EEF1G	Elongation factor 1-gamma	MULTI-SECPEP	DP1141_9	4	621.845947265625	2	621.32987	1240.64519	0.20129	0.00012507	-1.137	-0.00070645	-0.93571	-0.00058138	621.3294349970656	18.787	0.40004	18.787	18.537	18.937	0					9	3	4	0	0	0	0.0075795	1	11952	11952		118.33	88.08	1	8249700			2415	189	1408	1478	3238	3238		9606
STGEAFVQFASQEIAEK	17	Unmodified	_STGEAFVQFASQEIAEK_			0	0	0	P31943;P55795	P31943;P55795	P31943	HNRNPH1;HNRNPH2	Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H2	MSMS	DP1141_9	4	921.480224609375	2	921.449431	1840.88431	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.283	1	21.283	20.783	21.783	0								0	0	0	0	1	15793	15793		289.37	230.3	1				2416	200;272	1409	1479	3239	3239		9606
STGLELETPSLVPVKK	16	Unmodified	_STGLELETPSLVPVKK_			0	0	1	Q96QC0	Q96QC0	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	MULTI-SECPEP	DP1141_7	2	566.766357421875	3	566.660977	1696.9611	0.098253	5.5676E-05	0.48694	0.00027593	0.58519	0.00033161	566.9955716284958	18.8	0.39993	18.8	18.55	18.95	0					7	3	3	0	0	0	0.00033824	1	12096	12096		112.02	112.02	1	77013000			2417	520	1410	1480	3240	3240		9606
STGLELETPSLVPVKK	16	Unmodified	_STGLELETPSLVPVKK_			0	0	1	Q96QC0	Q96QC0	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	MULTI-SECPEP	DP1141_8	3	566.7665405273438	3	566.660977	1696.9611	-0.011517	-6.5261E-06	0.73752	0.00041793	0.72601	0.0004114	566.9957849900701	18.725	0.40073	18.725	18.475	18.876	0					5	3	2	0	0	0	0.010893	1	12053	12053		68.283	44.327	1	12311000			2418	520	1410	1480	3241	3241		9606
STLVGHDTFTK	11	Unmodified	_STLVGHDTFTK_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MULTI-MSMS	DP1141_10	5	603.3123779296875	2	603.311677	1204.6088	0.33304	0.00020092	-0.46095	-0.00027809	-0.12791	-7.717E-05	603.3120929862151	15.415	2.5488	15.415	15.039	17.588	0					68	30	6	0	0	0	7.1955E-96	9	7159	6899;6988;7090;7159;7998;8046;8405;9030;9882		214.05	159.33	1	23284000000		+	2419	29	1411	1481	3242;3243;3244;3245;3246;3247;3248;3249;3250	3245		
STLVGHDTFTK	11	Unmodified	_STLVGHDTFTK_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MULTI-MSMS	DP1141_10	5	402.5438232421875	3	402.543544	1204.6088	0.47271	0.00019028	-0.32314	-0.00013008	0.14956	6.0206E-05	402.54360838726626	15.415	1.0832	15.415	15.28	16.363	0					37	11	6	0	0	0	0.0028708	1	7160	7160		121.61	93.964	1	2726600000		+	2420	29	1411	1481	3251	3251		
STLVGHDTFTK	11	Unmodified	_STLVGHDTFTK_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MULTI-MSMS	DP1141_10	5	402.5436096191406	3	402.543544	1204.6088	0.0858	3.4538E-05	0.12159	4.8946E-05	0.20739	8.3485E-05	402.54359779818986	36.77	1.7682	36.77	36.711	38.479	0					38	32	2	0	0	0	0.027407	1	34452	34452		82.489	63.212	1	2772500		+	2421	29	1411	1481	3252	3252		
STLVGHDTFTK	11	Unmodified	_STLVGHDTFTK_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MULTI-MSMS	DP1141_6	1	402.2071533203125	3	402.543544	1204.6088	-0.52377	-0.00021084	0.30795	0.00012396	-0.21583	-8.688E-05	402.5435331350196	15.458	0.59544	15.458	15.209	15.804	0					14	5	4	0	0	0	0.011978	1	6158	6158		106.16	70.979	1	38977000		+	2422	29	1411	1481	3253	3253		
STLVGHDTFTK	11	Unmodified	_STLVGHDTFTK_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MULTI-MSMS	DP1141_6	1	603.31201171875	2	603.311677	1204.6088	0.14949	9.0187E-05	0.30075	0.00018144	0.45023	0.00027163	603.3118978314955	15.458	0.69616	15.458	15.209	15.905	0					17	6	4	0	0	0	0.0053412	1	6260	6260		119.68	80.876	1	205870000		+	2423	29	1411	1481	3254	3254		
STLVGHDTFTK	11	Unmodified	_STLVGHDTFTK_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MULTI-MSMS	DP1141_7	2	602.9837646484375	2	603.311677	1204.6088	0.29676	0.00017904	-0.074335	-4.4847E-05	0.22242	0.00013419	603.3116379606442	15.459	0.30464	15.459	15.309	15.614	0					4	2	2	0	0	0	1.1745E-132	2	6781	6690;6781		231.38	168.8	1	269870000		+	2424	29	1411	1481	3255;3256	3256		
STLVGHDTFTK	11	Unmodified	_STLVGHDTFTK_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MULTI-MSMS	DP1141_8	3	603.9445190429688	2	603.311677	1204.6088	0.68359	0.00041242	-2.0525	-0.0012383	-1.3689	-0.00082589	603.3104097884507	15.221	0.60211	15.221	14.972	15.575	0					12	5	3	0	0	0	8.1063E-09	1	6615	6615		157.75	84.817	1	58059000		+	2425	29	1411	1481	3257	3257		
STLVGHDTFTK	11	Unmodified	_STLVGHDTFTK_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MULTI-MSMS	DP1141_9	4	603.9440307617188	2	603.311677	1204.6088	0.070573	4.2577E-05	-1.1736	-0.00070804	-1.103	-0.00066547	603.310947553306	15.247	0.69295	15.247	14.98	15.673	0					11	6	3	0	0	0	5.195700000000001E-41	1	6638	6638		188.91	116.59	1	29778000		+	2426	29	1411	1481	3258	3258		
STNENANTPAAR	12	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))STNENANTPAAR_			1	0	0	P52292	P52292	P52292	KPNA2	Importin subunit alpha-1	MSMS	DP1141_8	3	644.3001708984375	2	644.29983	1286.58511	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.17	1	14.17	13.67	14.67	0								0	0	0	3.5616E-23	1	4676	4676		158.79	105.03	1				2427	264	1412	1482	3259	3259		9606
STNGDTFLGGEDFDQALLR	19	Unmodified	_STNGDTFLGGEDFDQALLR_			0	0	0	P38646	P38646	P38646	HSPA9	Stress-70 protein, mitochondrial	MULTI-MSMS	DP1141_8	3	1028.5303955078125	2	1028.48453	2054.95451	0.70564	0.00072574	0.033841	3.4805E-05	0.73949	0.00076055	1028.9852593327398	21.829	0.49954	21.829	21.679	22.179	0					5	4	2	0	0	0	0.00062927	1	17035	17035		130.88	98.381	1	11091000			2428	217	1413	1483	3260	3260		9606
STPKEETVNDPEEAGHR	17	Unmodified	_STPKEETVNDPEEAGHR_			0	0	1	O00567	O00567	O00567	NOP56	Nucleolar protein 56	MULTI-MSMS	DP1141_8	3	632.9639282226562	3	632.629176	1894.8657	0.43902	0.00027773	0.17588	0.00011126	0.61489	0.000389	632.6292455971104	12.987	0.66564	12.987	12.706	13.372	0					16	6	3	0	0	0	0.0012766	2	3120	3120;3210		97.579	66.373	1	921660			2429	38	1414	1484	3261;3262	3261		9606
STPKEETVNDPEEAGHR	17	Unmodified	_STPKEETVNDPEEAGHR_			0	0	1	O00567	O00567	O00567	NOP56	Nucleolar protein 56	MULTI-SECPEP	DP1141_8	3	474.90386962890625	4	474.723701	1894.8657	0.29395	0.00013954	-0.21584	-0.00010246	0.078111	3.7081E-05	474.7235902698014	12.957	0.81431	12.957	12.706	13.52	0					20	8	3	0	0	0	0.028302	1	3091	3091		60.541	45.883	1	1868500			2430	38	1414	1484	3263	3263		9606
STSESFIQHIVSLVHHVK	18	Unmodified	_STSESFIQHIVSLVHHVK_			0	0	0	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_7	2	684.008544921875	3	683.368968	2047.08507	0.83329	0.00056944	0.025231	1.7242E-05	0.85852	0.00058669	683.7034042938285	21.2	0.69937	21.2	20.95	21.65	0					16	6	5	0	0	0	9.7463E-05	3	15785	15785;15940;15957		104.78	92.741	1	82284000			2431	580	1415	1485	3264;3265;3266	3264		9606
STSESFIQHIVSLVHHVK	18	Unmodified	_STSESFIQHIVSLVHHVK_			0	0	0	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_7	2	513.029541015625	4	512.778545	2047.08507	0.31341	0.00016071	0.25379	0.00013014	0.5672	0.00029085	513.0294291154969	21.2	0.59966	21.2	20.85	21.45	0					16	5	5	0	0	0	0.010225	1	15955	15955		61.962	51.816	1	129670000			2432	580	1415	1485	3267	3267		9606
STTLDAGNIK	10	Unmodified	_STTLDAGNIK_			0	0	0	O75400	O75400	O75400	PRPF40A	Pre-mRNA-processing factor 40 homolog A	MULTI-MSMS	DP1141_7	2	510.79547119140625	2	510.272021	1018.52949	-0.27302	-0.00013931	-0.51513	-0.00026285	-0.78814	-0.00040217	510.2720518104283	15.442	0.50249	15.442	15.009	15.512	0					10	4	3	0	0	0	0.005905	1	6670	6670		115.49	64.301	1	21258000			2433	74	1416	1486	3268	3268		9606
SVAGGFVYTYK	11	Unmodified	_SVAGGFVYTYK_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	596.8504028320312	2	596.305864	1190.59717	0.73299	0.00043709	-0.26037	-0.00015526	0.47261	0.00028182	596.3056504009139	18.555	0.30005	18.555	18.405	18.705	0					4	2	2	0	0	0	0.0044145	1	11152	11152		105.2	26.931	1	168650000			2434	402	1417	1487	3269	3269		9606
SVAGGFVYTYK	11	Unmodified	_SVAGGFVYTYK_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_7	2	595.8172607421875	2	596.305864	1190.59717	0.47198	0.00028145	0.27583	0.00016448	0.74781	0.00044592	596.3060042207774	18.5	0.30053	18.5	18.349	18.65	0					4	2	2	0	0	0	0.0051354	1	11720	11720		109.44	76.598	1	308490000			2435	402	1417	1487	3270	3270		9606
SVAVYGGGSMWEQAK	15	Oxidation (M)	_SVAVYGGGSM(Oxidation (M))WEQAK_	SVAVYGGGSM(1)WEQAK	SVAVYGGGSM(95)WEQAK	0	1	0	Q86XP3	Q86XP3	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	MULTI-MSMS	DP1141_7	2	794.1234130859375	2	793.369398	1584.72424	0.69831	0.00055402	0.27826	0.00022076	0.97657	0.00077478	793.36972664552	17.699	0.39989	17.699	17.549	17.949	0					5	3	2	0	0	0	0.018785	1	10373	10373		95.401	61.023	1	63675000			2436	460	1418	1488	3271	3271	340	9606
SVHSSVPLLNSK	12	Unmodified	_SVHSSVPLLNSK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	634.3539428710938	2	634.353877	1266.6932	0.54822	0.00034777	0.012087	7.6673E-06	0.56031	0.00035543	634.3538678070768	16.155	0.79484	16.155	15.51	16.305	0					20	7	4	0	0	0	2.3497E-96	4	6936	6859;6936;7129;7333		215.72	140.8	1	147430000			2437	367	1419	1489	3272;3273;3274;3275	3273		9606
SVHSSVPLLNSK	12	Unmodified	_SVHSSVPLLNSK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	424.2297058105469	3	423.238343	1266.6932	0.32342	0.00013688	-0.029167	-1.2345E-05	0.29425	0.00012454	423.2384059356855	16.155	0.99683	16.155	15.408	16.405	0					29	9	5	0	0	0	0.0034122	2	7239	7140;7239		77.674	55.095	1	304130000			2438	367	1419	1489	3276;3277	3277		9606
SVHSSVPLLNSKDPIDR	17	Unmodified	_SVHSSVPLLNSKDPIDR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	622.337158203125	3	622.002285	1862.98503	0.57071	0.00035498	-0.39055	-0.00024292	0.18016	0.00011206	622.0023081813843	17.053	0.79918	17.053	16.505	17.304	0					35	9	7	0	0	0	6.258499999999999E-87	3	8454	8218;8454;8515		236.12	214.28	1	748730000			2439	367	1420	1490	3278;3279;3280	3279		9606
SVHSSVPLLNSKDPIDR	17	Unmodified	_SVHSSVPLLNSKDPIDR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	467.0039978027344	4	466.753533	1862.98503	0.073729	3.4413E-05	0.58998	0.00027538	0.66371	0.00030979	467.00426421031153	17.053	0.69866	17.053	16.505	17.204	0					28	8	6	0	0	0	0.02017	1	8535	8535		133.87	83.88	1	360810000			2440	367	1420	1490	3281	3281		9606
SVHSSVPLLNSKDPIDR	17	Unmodified	_SVHSSVPLLNSKDPIDR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	933.0015258789062	2	932.499789	1862.98503	-0.23283	-0.00021711	0.57028	0.00053179	0.33745	0.00031468	932.5003305055161	17.053	0.27927	17.053	16.824	17.103	0					8	3	3	0	0	0	3.0673E-191	2	8668	8668;8803		242.4	204.38	1	43959000			2441	367	1420	1490	3282;3283	3282		9606
SVHSSVPLLNSKDPIDR	17	Unmodified	_SVHSSVPLLNSKDPIDR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	622.0023803710938	3	622.002285	1862.98503	0.56717	0.00035278	0.59057	0.00036733	1.1577	0.00072011	622.3371882374006	17.003	0.60475	17.003	16.644	17.249	0					11	6	3	0	0	0	1.1717999999999999E-144	2	9333	9205;9333		239.51	190.44	1	124180000			2442	367	1420	1490	3284;3285	3285		9606
SVHSSVPLLNSKDPIDR	17	Unmodified	_SVHSSVPLLNSKDPIDR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_7	2	466.8677062988281	4	466.753533	1862.98503	0.75524	0.00035251	-0.13842	-6.4609E-05	0.61682	0.0002879	467.0040999385134	17.003	0.313	17.003	16.738	17.051	0					5	3	2	0	0	0	4.1409E-05	1	9233	9233		100.68	67.756	1	63736000			2443	367	1420	1490	3286	3286		9606
SVHSSVPLLNSKDPIDR	17	Unmodified	_SVHSSVPLLNSKDPIDR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MSMS	DP1141_8	3	622.001708984375	3	622.002285	1862.98503	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.972	1	16.972	16.472	17.472	0								0	0	0	1.1983E-28	1	9137	9137		179.9	139.28	1				2444	367	1420	1490	3287	3287		9606
SVHSSVPLLNSKDPIDR	17	Unmodified	_SVHSSVPLLNSKDPIDR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_9	4	622.3388061523438	3	622.002285	1862.98503	0.22796	0.00014179	0.61644	0.00038343	0.8444	0.00052522	622.3377377833067	17.007	0.45603	17.007	16.782	17.238	0					11	5	3	0	0	0	0.00080716	1	9155	9155		118.52	89.394	1	33485000			2445	367	1420	1490	3288	3288		9606
SVIDPVPAPVGDSHVDGAAK	20	Unmodified	_SVIDPVPAPVGDSHVDGAAK_			0	0	0	Q13177	Q13177	Q13177	PAK2	Serine/threonine-protein kinase PAK 2;PAK-2p27;PAK-2p34	MULTI-SECPEP	DP1141_9	4	644.8399658203125	3	644.333812	1929.97961	0.69752	0.00044943	-0.26198	-0.0001688	0.43554	0.00028063	644.6677670054916	17.387	0.49016	17.387	17.047	17.537	0					8	4	3	0	0	0	0.035067	1	9717	9717		66.606	32.329	1	10051000			2446	371	1421	1491	3289	3289		9606
SVNDQPSGNLPFLKPDDIQYFDK	23	Unmodified	_SVNDQPSGNLPFLKPDDIQYFDK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_6	1	879.9176635742188	3	879.765892	2636.27585	0.87944	0.0007737	0.17936	0.0001578	1.0588	0.0009315	880.0999646400861	21.256	0.24916	21.256	21.046	21.296	0					4	2	2	0	0	0	1.2416E-06	1	15325	15325		136.53	115.93	1	5874400			2447	78	1422	1492	3290	3290		9606
SVNDQPSGNLPFLKPDDIQYFDK	23	Unmodified	_SVNDQPSGNLPFLKPDDIQYFDK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	879.9700317382812	3	879.765892	2636.27585	0.63866	0.00056187	-0.1114	-9.8005E-05	0.52726	0.00046387	880.1001607504334	21.2	0.69948	21.2	20.85	21.55	0					26	6	6	0	0	0	1.0691000000000001E-31	2	15740	15740;15836		170.02	139.81	1	439510000			2448	78	1422	1492	3291;3292	3291		9606
SVNDQPSGNLPFLKPDDIQYFDK	23	Unmodified	_SVNDQPSGNLPFLKPDDIQYFDK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	880.43408203125	3	879.765892	2636.27585	0.52883	0.00046525	0.53005	0.00046632	1.0589	0.00093157	880.1007566078131	21.228	0.60091	21.228	20.878	21.479	0					12	5	4	0	0	0	0.0012585	3	15731	15429;15564;15731		93.729	76.167	1	127640000			2449	78	1422	1492	3293;3294;3295	3295		9606
SVSLTGAPESVQK	13	Unmodified	_SVSLTGAPESVQK_			0	0	0	Q92945	Q92945	Q92945	KHSRP	Far upstream element-binding protein 2	MULTI-MSMS	DP1141_8	3	651.8262939453125	2	651.848624	1301.6827	0.66342	0.00043245	0.98396	0.00064139	1.6474	0.0010738	651.849181677418	16.226	0.30043	16.226	16.076	16.376	0					4	2	2	0	0	0	0.0054196	1	8016	8016		134.84	52.894	1	20853000			2450	500	1423	1493	3296	3296		9606
SVTCTYSPALNK	12	Unmodified	_SVTCTYSPALNK_			0	0	0	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MULTI-MSMS	DP1141_8	3	670.829833984375	2	670.829377	1339.6442	0.1475	9.8945E-05	0.24445	0.00016398	0.39194	0.00026293	670.8296556902054	16.226	0.30036	16.226	15.976	16.276	0					8	2	4	0	0	0	1.975E-15	1	7918	7918		175.91	137.64	1	138180000			2451	104	1424	1494	3297	3297		9606
SVTEQGAELSNEER	14	Unmodified	_SVTEQGAELSNEER_			0	0	0	P63104	P63104	P63104	YWHAZ	14-3-3 protein zeta/delta	MULTI-MSMS	DP1141_10	5	774.385498046875	2	774.860448	1547.70634	0.52046	0.00040328	-2.8285	-0.0021917	-2.308	-0.0017884	774.8579560310307	15.595	0.32087	15.595	15.46	15.781	0					8	3	3	0	0	0	0	1	7346	7346		299.42	206.58	1	11155000			2452	316	1425	1495	3298	3298		9606
SVTNEDVTQEELGGAK	16	Unmodified	_SVTNEDVTQEELGGAK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_6	1	839.4037475585938	2	838.902313	1675.79007	0.5843	0.00049017	-0.07016	-5.8858E-05	0.51414	0.00043131	838.9022882529374	16.68	0.22432	16.68	16.505	16.729	0					6	2	3	0	0	0	1.3686000000000002E-287	1	8185	8185		267.07	226.35	1	47998000			2453	111	1426	1496	3299	3299		9606
SVTNEDVTQEELGGAK	16	Unmodified	_SVTNEDVTQEELGGAK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MSMS	DP1141_8	3	838.9025268554688	2	838.902313	1675.79007	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.705	1	16.705	16.205	17.205	0								0	0	0	0	1	8692	8692		304.57	230.11	1				2454	111	1426	1496	3300	3300		9606
SVTWPEEGKLR	11	Unmodified	_SVTWPEEGKLR_			0	0	1	Q96QC0	Q96QC0	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	MSMS	DP1141_7	2	651.361328125	2	651.346052	1300.67755	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.374	1	17.374	16.874	17.874	0								0	0	0	0.021516	1	9889	9889		94.692	45.269	1				2455	520	1427	1497	3301	3301		9606
SVVEFLQGYIGVPHGGFPEPFR	22	Unmodified	_SVVEFLQGYIGVPHGGFPEPFR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	812.42333984375	3	811.418099	2431.23247	0.55681	0.00045181	-0.61538	-0.00049933	-0.058566	-4.7521E-05	811.7520432767849	23.321	0.65346	23.321	22.906	23.559	0					24	8	5	0	0	0	9.4148E-08	2	19024	19024;19083		117.03	84.515	1	74270000			2456	142	1428	1498	3302;3303	3302		9606
SVVPPNR	7	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))SVVPPNR_			1	0	0	O43809	O43809	O43809	NUDT21	Cleavage and polyadenylation specificity factor subunit 5	MULTI-MSMS	DP1141_10	5	810.865478515625	1	810.446828	809.439552	0.48997	0.00039709	0.14055	0.00011391	0.63052	0.000511	810.446889194161	16.116	0.8535	16.116	15.873	16.727	0					14	9	3	0	0	0	0.029294	1	8094	8094		44.611	12.14	1	56656000			2457	61	1429	1499	3304	3304		9606
SWAQASVTHGAHGDGGR	17	Unmodified	_SWAQASVTHGAHGDGGR_			0	0	0	P48634	P48634	P48634	PRRC2A	Protein PRRC2A	MULTI-SECPEP	DP1141_10	5	565.575439453125	3	565.264503	1692.77168	0.66942	0.0003784	-0.84938	-0.00048013	-0.17996	-0.00010173	565.5982834949453	14.407	0.19612	14.407	14.276	14.472	0					6	2	3	0	0	0	0.016974	1	5356	5356		68.845	44.314	1	1756900			2458	243	1430	1500	3305	3305		9606
SWAQASVTHGAHGDGGR	17	Unmodified	_SWAQASVTHGAHGDGGR_			0	0	0	P48634	P48634	P48634	PRRC2A	Protein PRRC2A	MULTI-MSMS	DP1141_7	2	565.264404296875	3	565.264503	1692.77168	0.23672	0.00013381	-2.8741	-0.0016247	-2.6374	-0.0014908	565.2630119533185	14.658	0.49814	14.658	14.21	14.708	0					12	4	3	0	0	0	0.017764	2	5392	5225;5392		68.173	39.375	1	20764000			2459	243	1430	1500	3306;3307	3307		9606
SWLSYSYQSR	10	Unmodified	_SWLSYSYQSR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MSMS	DP1141_7	2	638.6604614257812	2	638.801477	1275.5884	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.49	1	19.49	18.99	19.99	0								0	0	0	3.4569E-32	1	13249	13249		169.44	101.42	1				2460	402	1431	1501	3308	3308		9606
SYCAEIAHNVSSK	13	Unmodified	_SYCAEIAHNVSSK_			0	0	0	P62910	P62910	P62910	RPL32	60S ribosomal protein L32	MULTI-MSMS	DP1141_10	5	733.3408203125	2	733.34064	1464.66673	0.76081	0.00055793	-0.59551	-0.00043671	0.1653	0.00012122	733.3402785122908	15.736	0.55735	15.736	15.609	16.166	0					9	5	3	0	0	0	0.018977	1	7715	7715		92.112	63.935	1	15118000			2461	312	1432	1502	3309	3309		9606
SYELPDGQVITIGNER	16	Unmodified	_SYELPDGQVITIGNER_			0	0	0	P60709;Q6S8J3;P68133;P68032;A5A3E0;Q9BYX7;P63267;P62736;P63261	P60709;P63261	P60709	ACTB;POTEE;ACTA1;ACTC1;POTEF;POTEKP;ACTG2;ACTA2;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;POTE ankyrin domain family member E;Actin, alpha skeletal muscle;Actin, alpha cardiac muscle 1;POTE ankyrin domain family member F;Putative beta-actin-like protein 3;Putative beta-actin-like protein 3, N-terminally processed;Actin, gamma-enteric smooth muscle;Actin, aortic smooth muscle;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	MULTI-SECPEP	DP1141_10	5	896.4845581054688	2	895.949598	1789.88464	0.65614	0.00058787	0.31016	0.00027789	0.9663	0.00086576	896.451021633116	20.626	0.69985	20.626	20.376	21.076	0					8	6	2	0	0	0	0.026164	1	15496	15496		79.633	50.083	1	44807000			2462	277;318	1433	1503	3310	3310		9606
SYELPDGQVITIGNER	16	Unmodified	_SYELPDGQVITIGNER_			0	0	0	P60709;Q6S8J3;P68133;P68032;A5A3E0;Q9BYX7;P63267;P62736;P63261	P60709;P63261	P60709	ACTB;POTEE;ACTA1;ACTC1;POTEF;POTEKP;ACTG2;ACTA2;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;POTE ankyrin domain family member E;Actin, alpha skeletal muscle;Actin, alpha cardiac muscle 1;POTE ankyrin domain family member F;Putative beta-actin-like protein 3;Putative beta-actin-like protein 3, N-terminally processed;Actin, gamma-enteric smooth muscle;Actin, aortic smooth muscle;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	MULTI-SECPEP	DP1141_7	2	896.4854736328125	2	895.949598	1789.88464	0.69469	0.0006224	0.10491	9.3992E-05	0.7996	0.0007164	895.9493566394552	20.611	0.59961	20.611	20.351	20.95	0					9	5	3	0	0	0	3.7082E-11	1	14993	14993		150.22	113.63	1	8319400			2463	277;318	1433	1503	3311	3311		9606
SYELPDGQVITIGNER	16	Unmodified	_SYELPDGQVITIGNER_			0	0	0	P60709;Q6S8J3;P68133;P68032;A5A3E0;Q9BYX7;P63267;P62736;P63261	P60709;P63261	P60709	ACTB;POTEE;ACTA1;ACTC1;POTEF;POTEKP;ACTG2;ACTA2;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;POTE ankyrin domain family member E;Actin, alpha skeletal muscle;Actin, alpha cardiac muscle 1;POTE ankyrin domain family member F;Putative beta-actin-like protein 3;Putative beta-actin-like protein 3, N-terminally processed;Actin, gamma-enteric smooth muscle;Actin, aortic smooth muscle;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	MULTI-MSMS	DP1141_9	4	895.9498291015625	2	895.949598	1789.88464	0.99791	0.00089408	-0.80312	-0.00071955	0.19479	0.00017452	895.9490179809002	20.746	0.70067	20.746	20.237	20.937	0					14	6	4	0	0	0	0.0017226	1	14921	14921		101.6	78.217	1	15326000			2464	277;318	1433	1503	3312	3312		9606
SYLNMDAIMEAIKK	14	2 Oxidation (M)	_SYLNM(Oxidation (M))DAIM(Oxidation (M))EAIKK_	SYLNM(1)DAIM(1)EAIKK	SYLNM(65)DAIM(65)EAIKK	0	2	1	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-SECPEP	DP1141_8	3	553.2587890625	3	553.60912	1657.80553	0.52186	0.00028891	-0.17306	-9.5806E-05	0.3488	0.0001931	553.9433825117895	18.125	0.40091	18.125	17.874	18.275	0					7	3	3	0	0	0	0.010912	1	11017	11017		65.043	40.512	1	120680000			2465	110	1434	1504	3313	3313	97;98	9606
SYLNMDAIMEAIKK	14	2 Oxidation (M)	_SYLNM(Oxidation (M))DAIM(Oxidation (M))EAIKK_	SYLNM(1)DAIM(1)EAIKK	SYLNM(52)DAIM(52)EAIKK	0	2	1	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-SECPEP	DP1141_9	4	554.3060913085938	3	553.60912	1657.80553	0.46233	0.00025595	0.52151	0.00028871	0.98384	0.00054466	553.6090096865723	18.187	0.29993	18.187	17.937	18.237	0					4	2	2	0	0	0	0.026917	1	10968	10968		51.726	28.364	1	5695000			2466	110	1434	1504	3314	3314	97;98	9606
SYSDPPLK	8	Unmodified	_SYSDPPLK_			0	0	0	P52597	P52597	P52597	HNRNPF	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed	MULTI-MSMS	DP1141_9	4	453.7318420410156	2	453.732	905.449448	-0.23582	-0.000107	0.60458	0.00027432	0.36876	0.00016732	453.7321507641294	15.238	0.85886	15.238	14.714	15.573	0					17	8	4	0	0	0	0.0068425	1	6257	6257		113.5	78.394	1	31729000			2467	266	1435	1505	3315	3315		9606
SYYFPVK	7	Unmodified	_SYYFPVK_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	452.59814453125	2	452.234179	902.453805	1.1501	0.0005201	-0.67169	-0.00030376	0.47838	0.00021634	452.2338080994215	18.36	0.59958	18.36	18.105	18.705	0					12	5	4	0	0	0	0.032661	1	10802	10802		95.793	60.299	1	96186000			2468	402	1436	1506	3316	3316		9606
TAAFIWPMLIHIMDQK	16	2 Oxidation (M)	_TAAFIWPM(Oxidation (M))LIHIM(Oxidation (M))DQK_	TAAFIWPM(1)LIHIM(1)DQK	TAAFIWPM(74)LIHIM(74)DQK	0	2	0	Q86XP3	Q86XP3	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	MULTI-MSMS	DP1141_7	2	650.0023803710938	3	649.66708	1945.97941	0.13085	8.5009E-05	0.7354	0.00047776	0.86625	0.00056277	650.0020234699637	21.7	0.5979	21.7	21.35	21.948	0					10	5	4	0	0	0	0.0056563	1	16581	16581		73.833	47.855	1	12879000			2469	460	1437	1507	3317	3317	341;342	9606
TAAFIWPMLIHIMDQK	16	Oxidation (M)	_TAAFIWPMLIHIM(Oxidation (M))DQK_	TAAFIWPM(0.213)LIHIM(0.787)DQK	TAAFIWPM(-5.7)LIHIM(5.7)DQK	0	1	0	Q86XP3	Q86XP3	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	MULTI-SECPEP	DP1141_7	2	644.3948364257812	3	644.335442	1929.9845	0.032001	2.0619E-05	0.20415	0.00013154	0.23615	0.00015216	644.3355932562804	23.103	0.3971	23.103	22.801	23.198	0					8	5	3	0	0	0	0.0068845	1	18216	18216		73.833	47.104	2	3906500			2470	460	1437	1508	3318	3318	341;342	9606
TAPTLSPEHWK	11	Unmodified	_TAPTLSPEHWK_			0	0	0	Q96JM3	Q96JM3	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	MULTI-MSMS	DP1141_7	2	633.8275756835938	2	633.827495	1265.64044	0.42058	0.00026657	-0.013619	-8.6318E-06	0.40696	0.00025794	633.8273538664151	16.565	0.73839	16.565	16.215	16.953	0					5	3	2	0	0	0	0.0049956	1	8649	8649		114.89	86.813	1	32808000			2471	514	1438	1509	3319	3319		9606
TAQIMFQAYGDK	12	Unmodified	_TAQIMFQAYGDK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	687.6757202148438	2	686.83192	1371.64929	1.263	0.00086748	-0.37	-0.00025413	0.89302	0.00061335	686.8316742095242	18.755	0.4008	18.755	18.604	19.005	0					5	3	2	0	0	0	0.0050881	1	11572	11572		121.29	86.109	1	316990000			2472	367	1439	1510	3320	3320		9606
TAVCDIPPR	9	Unmodified	_TAVCDIPPR_			0	0	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_10	5	514.7633666992188	2	514.763309	1027.51206	0.32193	0.00016572	0.16504	8.4959E-05	0.48697	0.00025067	514.763437191032	15.16	1.3823	15.16	14.884	16.266	0					34	15	4	0	0	0	0.00072982	4	6605	6605;6614;6882;7145		131.06	75.386	1	109600000			2473	122;323;381	1440	1511	3321;3322;3323;3324	3321		9606
TAVCDIPPR	9	Unmodified	_TAVCDIPPR_			0	0	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_6	1	515.2911987304688	2	514.763309	1027.51206	-0.21469	-0.00011051	0.5237	0.00026958	0.30901	0.00015907	514.7634569807416	16.914	0.79889	16.914	16.205	17.004	0					11	9	2	0	0	0	0.026905	1	8496	8496		78.334	44.538	1	11539000			2474	122;323;381	1440	1511	3325	3325		9606
TAVCDIPPR	9	Unmodified	_TAVCDIPPR_			0	0	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_8	3	514.76318359375	2	514.763309	1027.51206	0.62598	0.00032223	-0.43518	-0.00022402	0.1908	9.8217E-05	514.7631325809358	15.221	1.3033	15.221	14.873	16.176	0					33	12	4	0	0	0	0.0048991	3	6282	6282;6304;7606		110.87	49.9	1	279860000			2475	122;323;381	1440	1511	3326;3327;3328	3326		9606
TAVCDIPPR	9	Unmodified	_TAVCDIPPR_			0	0	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_9	4	514.7677612304688	2	514.763309	1027.51206	0.23401	0.00012046	0.09609	4.9464E-05	0.3301	0.00016993	514.763299544194	15.224	1.1784	15.224	14.98	16.158	0					24	11	3	0	0	0	0.00049575	3	6106	6106;6190;6593		132.76	69.478	1	88374000			2476	122;323;381	1440	1511	3329;3330;3331	3329		9606
TAVCDIPPR	9	Unmodified	_TAVCDIPPR_			0	0	0	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1	P07437;P68371;Q13885	P68371	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	MULTI-MSMS	DP1141_9	4	514.7637329101562	2	514.763309	1027.51206	0.027335	1.4071E-05	1.2458	0.00064127	1.2731	0.00065534	514.7639369589043	16.907	0.97976	16.907	16.158	17.138	0					16	11	2	0	0	0	0.0097966	1	8721	8721		90.657	57.816	1	53041000			2477	122;323;381	1440	1511	3332	3332		9606
TAVETAVLLLR	11	Unmodified	_TAVETAVLLLR_			0	0	0	P49368	P49368	P49368	CCT3	T-complex protein 1 subunit gamma	MULTI-MSMS	DP1141_8	3	593.856689453125	2	593.363713	1184.71287	0.33787	0.00020048	0.23143	0.00013732	0.5693	0.0003378	593.3637691208992	20.928	0.40011	20.928	20.778	21.178	0					5	3	2	0	0	0	0.0042907	1	15250	15250		131.62	82.822	1	30944000			2478	246	1441	1512	3333	3333		9606
TAWAETSRPPETEPGPPAPKPPLPPPHR	28	Unmodified	_TAWAETSRPPETEPGPPAPKPPLPPPHR_			0	0	2	P48634	P48634	P48634	PRRC2A	Protein PRRC2A	MULTI-MSMS	DP1141_7	2	753.6453247070312	4	753.393799	3009.54609	1.0646	0.00080205	-0.18454	-0.00013903	0.88003	0.00066301	753.6446129060153	16.895	0.313	16.895	16.738	17.051	0					9	3	4	0	0	0	0.0069731	1	9210	9210		42.172	29.08	1	16668000			2479	243	1442	1513	3334	3334		9606
TAWTMGARGLDKR	13	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))TAWTMGARGLDKR_			1	0	2	Q8WYP3	Q8WYP3	Q8WYP3	RIN2	Ras and Rab interactor 2	MULTI-MSMS	DP1141_7	2	502.262451171875	3	502.261153	1503.76163	-0.084604	-4.2493E-05	2.3318	0.0011712	2.2472	0.0011287	502.26191505128037	15.675	0.60515	15.675	15.21	15.815	0					11	5	4	0	0	0	0.018723	1	7271	7271		51.841	21.905	1	17292000			2480	489	1443	1514	3335	3335		9606
TCPVQLWVDSTPPPGTR	17	Unmodified	_TCPVQLWVDSTPPPGTR_			0	0	0	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MULTI-MSMS	DP1141_8	3	956.4775390625	2	955.975093	1909.93563	0.28352	0.00027104	0.26257	0.00025101	0.54609	0.00052205	955.9752251721633	20.327	0.80114	20.327	19.777	20.578	0					11	7	2	0	0	0	2.6629E-23	2	14296	14147;14296		212.1	174.4	1	36427000			2481	104	1444	1515	3336;3337	3337		9606
TCPVQLWVDSTPPPGTR	17	Unmodified	_TCPVQLWVDSTPPPGTR_			0	0	0	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MULTI-MSMS	DP1141_9	4	956.4768676757812	2	955.975093	1909.93563	0.58917	0.00056324	-0.27361	-0.00026157	0.31556	0.00030167	956.4762122454374	20.287	0.59926	20.287	20.037	20.636	0					10	5	3	0	0	0	8.2875E-10	2	14346	14346;14457		195.71	156.09	1	38995000			2482	104	1444	1515	3338;3339	3338		9606
TCVFEKENDPSVMR	14	Unmodified	_TCVFEKENDPSVMR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	571.5986328125	3	571.264123	1710.77054	0.2585	0.00014767	-0.23578	-0.00013469	0.022718	1.2978E-05	571.5985812649791	16.635	0.61838	16.635	16.205	16.824	0					17	6	6	0	0	0	0.00011756	1	8114	8114		147.73	129.32	1	83867000			2483	367	1445	1516	3340	3340		9606
TCVFEKENDPSVMR	14	Unmodified	_TCVFEKENDPSVMR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	856.8941650390625	2	856.392547	1710.77054	0.35758	0.00030623	-0.24877	-0.00021305	0.10881	9.318E-05	856.3926217558266	16.66	0.31879	16.66	16.505	16.824	0					9	3	4	0	0	0	0.0069752	1	8141	8141		150.09	127.9	1	9102300			2484	367	1445	1516	3341	3341		9606
TCVFEKENDPSVMR	14	Oxidation (M)	_TCVFEKENDPSVM(Oxidation (M))R_	TCVFEKENDPSVM(1)R	TCVFEKENDPSVM(69)R	0	1	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_7	2	577.2968139648438	3	576.595762	1726.76546	0.31927	0.00018409	0.58157	0.00033533	0.90084	0.00051942	576.9302392452344	15.584	0.50524	15.584	15.309	15.815	0					8	4	3	0	0	0	0.010845	1	6966	6966		68.751	37.536	1	12278000			2485	367	1445	1517	3342	3342	286	9606
TDAAVSFAK	9	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))TDAAVSFAK_			1	0	0	P05141	P05141	P05141	SLC25A5	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed	MULTI-SECPEP	DP1141_6	1	475.9010925292969	2	476.242732	950.470912	0.59925	0.00028539	-0.58069	-0.00027655	0.018566	8.8419E-06	476.242330001235	18.654	0.40052	18.654	18.405	18.805	0					5	3	2	0	0	0	0.015432	1	11283	11283		82.75	57.176	1	16592000			2486	109	1446	1518	3343	3343		9606
TDCDIEDDRLAAMFR	15	Unmodified	_TDCDIEDDRLAAMFR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	609.8587036132812	3	609.938187	1826.79273	0.78468	0.0004786	-1.2316	-0.0007512	-0.44692	-0.0002726	609.9377402229914	20.238	0.67587	20.238	19.906	20.582	0					22	6	5	0	0	0	0.011514	1	13687	13687		104.59	71.585	1	29377000			2487	367	1447	1519	3344	3344		9606
TDCNHIFLNFVPTVIMDPSK	20	Oxidation (M)	_TDCNHIFLNFVPTVIM(Oxidation (M))DPSK_	TDCNHIFLNFVPTVIM(1)DPSK	TDCNHIFLNFVPTVIM(140)DPSK	0	1	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	789.052001953125	3	788.716939	2363.12899	0.34737	0.00027398	0.067479	5.3222E-05	0.41485	0.0003272	789.0515082864844	21.825	0.44425	21.825	21.628	22.072	0					16	5	6	0	0	0	3.416E-05	3	16230	16062;16230;16281		139.38	118.76	1	30162000			2488	367	1448	1520	3345;3346;3347	3346	287	9606
TDEKVDESGPPAPSKPR	17	Unmodified	_TDEKVDESGPPAPSKPR_			0	0	2	Q29RF7	Q29RF7	Q29RF7	PDS5A	Sister chromatid cohesion protein PDS5 homolog A	MULTI-MSMS	DP1141_7	2	453.2299499511719	4	453.229891	1808.89046	0.44472	0.00020156	-0.018615	-8.4367E-06	0.4261	0.00019312	453.2299133192714	13.076	1.4227	13.076	12.524	13.947	0					39	14	4	0	0	0	0.0051791	2	3208	3116;3208		81.651	61.472	1	2076300			2489	415	1449	1521	3348;3349	3349		9606
TDEKVDESGPPAPSKPR	17	Unmodified	_TDEKVDESGPPAPSKPR_			0	0	2	Q29RF7	Q29RF7	Q29RF7	PDS5A	Sister chromatid cohesion protein PDS5 homolog A	MULTI-MSMS	DP1141_7	2	603.971435546875	3	603.970762	1808.89046	0.50681	0.0003061	-0.33853	-0.00020447	0.16827	0.00010163	604.3043430917124	12.934	1.1954	12.934	12.424	13.62	0					22	11	3	0	0	0	0.010973	2	3330	3214;3330		82.942	55.004	1	1034600			2490	415	1449	1521	3350;3351	3351		9606
TDEKVDESGPPAPSKPR	17	Unmodified	_TDEKVDESGPPAPSKPR_			0	0	2	Q29RF7	Q29RF7	Q29RF7	PDS5A	Sister chromatid cohesion protein PDS5 homolog A	MULTI-MSMS	DP1141_9	4	453.22998046875	4	453.229891	1808.89046	-0.55183	-0.0002501	0.89215	0.00040435	0.34033	0.00015425	453.23015207452755	13.543	0.80639	13.543	13.004	13.81	0					21	9	4	0	0	0	0.025323	1	3663	3663		63.462	44.639	1	841690			2491	415	1449	1521	3352	3352		9606
TDFGIFR	7	Unmodified	_TDFGIFR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_10	5	428.7648620605469	2	428.221603	854.428653	0.77708	0.00033276	-0.70581	-0.00030224	0.071271	3.052E-05	428.2212474569293	19.826	0.40012	19.826	19.676	20.076	0					8	3	3	0	0	0	0.0010528	1	14176	14176		118.06	90.74	1	191450000			2492	567	1450	1522	3353	3353		9606
TDFGIFR	7	Unmodified	_TDFGIFR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_7	2	428.293212890625	2	428.221603	854.428653	0.49286	0.00021105	-0.20417	-8.743E-05	0.28869	0.00012362	428.2214541904686	19.8	0.2998	19.8	19.65	19.95	0					4	2	2	0	0	0	0.00014092	1	13749	13749		124.32	97.007	1	68632000			2493	567	1450	1522	3354	3354		9606
TDFGIFR	7	Unmodified	_TDFGIFR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	428.2931823730469	2	428.221603	854.428653	0.25465	0.00010904	-0.10846	-4.6446E-05	0.14618	6.2599E-05	428.22174712254275	19.827	1.1021	19.827	19.576	20.678	0					19	10	3	0	0	0	0.00030567	1	13653	13653		121.68	81.111	1	1526399999.9999998			2494	567	1450	1522	3355	3355		9606
TDFGIFR	7	Unmodified	_TDFGIFR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	428.22161865234375	2	428.221603	854.428653	0.33114	0.0001418	-0.15356	-6.5756E-05	0.17758	7.6044E-05	428.22144368529433	19.788	0.49732	19.788	19.639	20.136	0					10	4	3	0	0	0	1.2298E-05	1	13695	13695		129.96	97.032	1	42175000			2495	567	1450	1522	3356	3356		9606
TDPENTDYTMEHGATR	16	Oxidation (M)	_TDPENTDYTM(Oxidation (M))EHGATR_	TDPENTDYTM(1)EHGATR	TDPENTDYTM(69)EHGATR	0	1	0	Q9BW85	Q9BW85	Q9BW85	CCDC94	Coiled-coil domain-containing protein 94	MULTI-SECPEP	DP1141_9	4	619.3006591796875	3	618.591733	1852.75337	0.16347	0.00010112	-0.21963	-0.00013586	-0.056163	-3.4742E-05	618.5917524986227	14.344	0.2261	14.344	14.247	14.473	0					6	2	3	0	0	0	0.0071484	1	4813	4813		68.978	49.284	1	3070800			2496	542	1451	1523	3357	3357	388	9606
TDRGGDSIGETPTPGASK	18	Unmodified	_TDRGGDSIGETPTPGASK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_10	5	582.6137084960938	3	582.614867	1744.82277	0.28255	0.00016462	-0.14043	-8.1815E-05	0.14213	8.2805E-05	582.6147335758205	14.436	0.26263	14.436	14.276	14.539	0					5	3	2	0	0	0	0.010805	1	5496	5496		82.865	45.774	1	7812600			2497	78	1452	1524	3358	3358		9606
TDRGGDSIGETPTPGASK	18	Unmodified	_TDRGGDSIGETPTPGASK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MSMS	DP1141_6	1	582.6150512695312	3	582.614867	1744.82277	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.485	1	14.485	13.985	14.985	0								0	0	0	0.0027022	1	4693	4693		119.51	77.118	1				2498	78	1452	1524	3359	3359		9606
TDRGGDSIGETPTPGASK	18	Unmodified	_TDRGGDSIGETPTPGASK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	873.4193725585938	2	873.418662	1744.82277	0.40842	0.00035673	-0.0070737	-6.1783E-06	0.40135	0.00035055	873.4185214272686	14.458	0.49814	14.458	14.21	14.708	0					6	4	2	0	0	0	5.2819E-44	1	5248	5248		187.08	127	1	43004000			2499	78	1452	1524	3360	3360		9606
TDRGGDSIGETPTPGASK	18	Unmodified	_TDRGGDSIGETPTPGASK_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MSMS	DP1141_9	4	582.6150512695312	3	582.614867	1744.82277	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.516	1	14.516	14.016	15.016	0								0	0	0	0.0052499	1	5068	5068		116.61	80.719	1				2500	78	1452	1524	3361	3361		9606
TDRGGDSIGETPTPGASKR	19	Unmodified	_TDRGGDSIGETPTPGASKR_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_6	1	476.23846435546875	4	476.238247	1900.92388	0.43596	0.00020762	-0.34839	-0.00016591	0.087571	4.1704E-05	476.2381342490719	13.847	0.56672	13.847	13.488	14.054	0					15	6	4	0	0	0	0.0072923	2	3878	3878;3969		73.918	55.46	1	2279600			2501	78	1453	1525	3362;3363	3362		9606
TDRGGDSIGETPTPGASKR	19	Unmodified	_TDRGGDSIGETPTPGASKR_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	476.23870849609375	4	476.238247	1900.92388	0.85018	0.00040489	-0.42695	-0.00020333	0.42323	0.00020156	476.48880517567676	13.819	0.88374	13.819	13.327	14.21	0					26	9	4	0	0	0	0.01718	1	4081	4081		61.757	49.202	1	46462000			2502	78	1453	1525	3364	3364		9606
TDRGGDSIGETPTPGASKR	19	Unmodified	_TDRGGDSIGETPTPGASKR_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	634.9828491210938	3	634.64857	1900.92388	0.42411	0.00026916	0.21146	0.0001342	0.63557	0.00040336	634.6487180248845	13.819	0.72133	13.819	13.226	13.947	0					17	7	4	0	0	0	1.0123E-05	3	4197	4197;4280;4288		121.51	103.81	1	12051000			2503	78	1453	1525	3365;3366;3367	3365		9606
TDRGGDSIGETPTPGASKR	19	Unmodified	_TDRGGDSIGETPTPGASKR_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	476.23846435546875	4	476.238247	1900.92388	0.16866	8.0322E-05	-0.05127	-2.4417E-05	0.11739	5.5905E-05	476.2382182787624	13.845	0.51488	13.845	13.453	13.968	0					18	6	4	0	0	0	0.0027644	1	4215	4215		85.51	67.414	1	15628000			2504	78	1453	1525	3368	3368		9606
TDRGGDSIGETPTPGASKR	19	Unmodified	_TDRGGDSIGETPTPGASKR_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	634.6489868164062	3	634.64857	1900.92388	0.33097	0.00021005	-0.014501	-9.2028E-06	0.31647	0.00020085	634.6486228912204	13.845	0.30828	13.845	13.66	13.968	0					5	3	2	0	0	0	0.0053301	1	4234	4234		82.367	55.817	1	6630400			2505	78	1453	1525	3369	3369		9606
TDRGGDSIGETPTPGASKR	19	Unmodified	_TDRGGDSIGETPTPGASKR_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_9	4	476.489013671875	4	476.238247	1900.92388	0.38962	0.00018555	-0.15257	-7.2661E-05	0.23705	0.00011289	476.2382732909661	13.842	0.63952	13.842	13.474	14.114	0					17	9	3	0	0	0	0.0027644	2	4059	4059;4078		85.51	66.504	1	8200100			2506	78	1453	1525	3370;3371	3370		9606
TDRGGDSIGETPTPGASKR	19	Unmodified	_TDRGGDSIGETPTPGASKR_			0	0	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_9	4	634.9835815429688	3	634.64857	1900.92388	0.4913	0.0003118	0.20897	0.00013262	0.70027	0.00044442	635.317636420496	13.823	0.33921	13.823	13.601	13.94	0					8	4	3	0	0	0	0.016272	1	4091	4091		71.842	46.018	1	1428000			2507	78	1453	1525	3372	3372		9606
TDRYTIHSQLEHLQSK	16	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))TDRYTIHSQLEHLQSK_			1	0	1	Q9BWJ5	Q9BWJ5	Q9BWJ5	SF3B5	Splicing factor 3B subunit 5	MULTI-MSMS	DP1141_10	5	666.8544921875	3	666.672827	1996.99665	-0.51878	-0.00034586	1.3089	0.0008726	0.79011	0.00052675	667.007842999811	17.432	0.3006	17.432	17.187	17.488	0					8	2	4	0	0	0	0.00054783	2	10237	10237;10431		133.87	113.27	1	27803000			2508	543	1454	1526	3373;3374	3373		9606
TDTNVSKPSFAAESVGQSAEPPKPSVEPALQQHR	34	Unmodified	_TDTNVSKPSFAAESVGQSAEPPKPSVEPALQQHR_			0	0	2	Q6W2J9	Q6W2J9	Q6W2J9	BCOR	BCL-6 corepressor	MULTI-MSMS	DP1141_7	2	718.8760375976562	5	718.763447	3588.78085	0.56551	0.00040647	0.4283	0.00030784	0.9938	0.00071431	718.9640421964085	17.099	0.39636	17.099	16.953	17.349	0					5	3	2	0	0	0	6.0126E-20	1	9543	9543		102.75	81.558	1	13329000			2509	438	1455	1527	3375	3375		9606
TDYNASVSVPDSSGPER	17	Unmodified	_TDYNASVSVPDSSGPER_			0	0	0	P61978	P61978	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	MULTI-MSMS	DP1141_10	5	890.9036865234375	2	890.902844	1779.79114	-0.14781	-0.00013168	0.6685	0.00059557	0.52069	0.00046388	890.9033723022764	16.893	0.20826	16.893	16.797	17.005	0					7	3	3	0	0	0	0	2	9526	9526;9558		297.5	258.33	1	33104000			2510	284	1456	1528	3376;3377	3376		9606
TDYNASVSVPDSSGPER	17	Unmodified	_TDYNASVSVPDSSGPER_			0	0	0	P61978	P61978	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	MULTI-MSMS	DP1141_8	3	890.9031372070312	2	890.902844	1779.79114	0.23597	0.00021023	0.17479	0.00015573	0.41077	0.00036595	890.9029036889394	16.878	0.4419	16.878	16.731	17.173	0					11	4	4	0	0	0	1.3246E-23	2	9065	9065;9069		173.19	140.86	1	182120000			2511	284	1456	1528	3378;3379	3378		9606
TDYNASVSVPDSSGPER	17	Unmodified	_TDYNASVSVPDSSGPER_			0	0	0	P61978	P61978	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	MULTI-MSMS	DP1141_9	4	890.9035034179688	2	890.902844	1779.79114	0.95853	0.00085396	-0.39013	-0.00034757	0.5684	0.00050639	890.902593069845	16.886	0.17482	16.886	16.782	16.957	0					10	2	5	0	0	0	0	2	8968	8968;8981		270.21	270.21	1	66962000			2512	284	1456	1528	3380;3381	3380		9606
TEDFIIDTLELR	12	Unmodified	_TEDFIIDTLELR_			0	0	0	Q01780	Q01780	Q01780	EXOSC10	Exosome component 10	MSMS	DP1141_7	2	732.8828735351562	2	732.882664	1463.75077	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.76	1	22.76	22.26	23.26	0								0	0	0	5.0308999999999997E-23	1	18126	18126		162.36	116.2	1				2513	340	1457	1529	3382	3382		9606
TEDFIIDTLELR	12	Unmodified	_TEDFIIDTLELR_			0	0	0	Q01780	Q01780	Q01780	EXOSC10	Exosome component 10	MULTI-MSMS	DP1141_8	3	733.3844604492188	2	732.882664	1463.75077	0.57567	0.0004219	-0.014515	-1.0638E-05	0.56116	0.00041126	732.8827380155772	22.72	0.30737	22.72	22.565	22.872	0					5	3	2	0	0	0	0.0048098	1	17932	17932		116.77	82.234	1	6410700			2514	340	1457	1529	3383	3383		9606
TEELEEESFPER	12	Unmodified	_TEELEEESFPER_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_6	1	747.8340454101562	2	747.833368	1493.65218	0.20944	0.00015663	-2.6141	-0.0019549	-2.4047	-0.0017983	748.3325365737189	17.555	0.50063	17.555	17.404	17.905	0					7	4	2	0	0	0	5.4162E-06	2	9946	9747;9946		152.97	128.63	1	6756900			2515	612	1458	1530	3384;3385	3385		9606
TEELEEESFPER	12	Unmodified	_TEELEEESFPER_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_7	2	748.3350219726562	2	747.833368	1493.65218	0.77531	0.00057981	-0.20419	-0.0001527	0.57113	0.00042711	747.8332751052645	17.699	0.49956	17.699	17.45	17.949	0					13	4	4	0	0	0	2.5796999999999997E-80	2	10475	10475;10603		204.52	177.77	1	27450000			2516	612	1458	1530	3386;3387	3386		9606
TEELEEESFPER	12	Unmodified	_TEELEEESFPER_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-MSMS	DP1141_8	3	747.8336791992188	2	747.833368	1493.65218	0.84058	0.00062861	0.43131	0.00032255	1.2719	0.00095116	747.8333521168204	17.624	0.40013	17.624	17.474	17.874	0					5	3	2	0	0	0	0.014452	1	10463	10463		85.29	59.248	1	6061500			2517	612	1458	1530	3388	3388		9606
TEELNKEVASNSELVQSSR	19	Unmodified	_TEELNKEVASNSELVQSSR_			0	0	1	CON__P08779;P08779	CON__P08779	CON__P08779	KRT16	Keratin, type I cytoskeletal 16	MULTI-MSMS	DP1141_9	4	707.6881713867188	3	707.353712	2119.03931	0.73298	0.00051848	-0.3118	-0.00022056	0.42118	0.00029792	707.6878022668096	16.821	0.44533	16.821	16.693	17.138	0					12	5	4	0	0	0	3.6694E-34	2	8931	8931;8971		172.6	142.78	1	183780000		+	2518	16	1459	1531	3389;3390	3389		9606
TEELNKEVASNSELVQSSR	19	Unmodified	_TEELNKEVASNSELVQSSR_			0	0	1	CON__P08779;P08779	CON__P08779	CON__P08779	KRT16	Keratin, type I cytoskeletal 16	MULTI-MSMS	DP1141_9	4	1061.028076171875	2	1060.52693	2119.03931	-0.20465	-0.00021704	0.3902	0.00041381	0.18554	0.00019677	1061.028282920658	16.821	0.26403	16.821	16.693	16.957	0					8	3	3	0	0	0	3.1618999999999996E-248	1	8936	8936		258.41	184.46	1	45406000		+	2519	16	1459	1531	3391	3391		9606
TEIIILATR	9	Unmodified	_TEIIILATR_			0	0	0	P23396	P23396	P23396	RPS3	40S ribosomal protein S3	MULTI-MSMS	DP1141_10	5	515.7431030273438	2	515.318774	1028.623	0.9966	0.00051357	-0.22921	-0.00011812	0.76739	0.00039545	515.3185944811397	19.227	0.59915	19.227	18.977	19.576	0					7	5	2	0	0	0	0.0097966	1	13354	13354		90.657	61.184	1	74243000			2520	182	1460	1532	3392	3392		9606
TEILPPFFK	9	Unmodified	_TEILPPFFK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_6	1	546.3106079101562	2	546.310418	1090.60628	0.55971	0.00030578	-0.033811	-1.8471E-05	0.5259	0.0002873	546.3103405665732	21.335	0.34422	21.335	21.126	21.47	0					8	3	3	0	0	0	0.00053657	1	15471	15471		134.81	36.353	1	38339000			2521	78	1461	1533	3393	3393		9606
TEILPPFFK	9	Unmodified	_TEILPPFFK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	546.3109130859375	2	546.310418	1090.60628	0.44534	0.00024329	0.42968	0.00023474	0.87502	0.00047803	546.3107317511448	21.3	1.0959	21.3	21.05	22.146	0					18	10	2	0	0	0	4.8081E-05	2	15988	15988;16438		147.34	24.474	1	806660000			2522	78	1461	1533	3394;3395	3394		9606
TEILPPFFK	9	Unmodified	_TEILPPFFK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-SECPEP	DP1141_7	2	1091.2591552734375	1	1091.61356	1090.60628	0.61578	0.0006722	0.57396	0.00062654	1.1897	0.0012987	1091.6140993730835	21.3	0.30011	21.3	21.15	21.45	0					4	2	2	0	0	0	0.011697	1	15890	15890		75.213	75.213	1	44550000			2523	78	1461	1533	3396	3396		9606
TEILPPFFK	9	Unmodified	_TEILPPFFK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	546.3108520507812	2	546.310418	1090.60628	0.82537	0.00045091	-0.71284	-0.00038943	0.11252	6.1473E-05	546.3099946921179	21.329	0.50131	21.329	21.078	21.579	0					7	4	2	0	0	0	0.0067275	1	15860	15860		116.9	20.713	1	112580000			2524	78	1461	1533	3397	3397		9606
TERDTPGHGSGWAETPR	17	Unmodified	_TERDTPGHGSGWAETPR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-SECPEP	DP1141_7	2	618.5369262695312	3	618.622356	1852.84524	0.23567	0.00014579	0.29975	0.00018543	0.53543	0.00033123	618.6225198769	14.658	0.30041	14.658	14.508	14.809	0					4	2	2	0	0	0	1.7613E-05	1	5541	5541		114.03	92.198	1	48282000			2525	78	1462	1534	3398	3398		9606
TFAPEEISAMVLTK	14	Unmodified	_TFAPEEISAMVLTK_			0	0	0	P11021	P11021	P11021	HSPA5	78 kDa glucose-regulated protein	MULTI-MSMS	DP1141_8	3	768.9052734375	2	768.902542	1535.79053	0.52025	0.00040002	1.1212	0.00086212	1.6415	0.0012621	768.9037897100947	21.629	0.40077	21.629	21.279	21.679	0					7	3	3	0	0	0	0.026986	1	16275	16275		69.815	28.126	1	17190000			2526	139	1463	1535	3399	3399		9606
TFEDFVR	7	Unmodified	_TFEDFVR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	457.22479248046875	2	457.224342	912.434132	0.8089	0.00036985	0.044525	2.0358E-05	0.85342	0.00039021	457.2243721436531	18.654	2.9013	18.654	18.305	21.206	0					52	29	4	0	0	0	5.0987E-12	2	11477	11459;11477		158.53	121.95	1	426130000			2527	367	1464	1536	3400;3401	3401		9606
TFEDFVR	7	Unmodified	_TFEDFVR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	913.9651489257812	1	913.441409	912.434132	0.28596	0.00026121	0.39269	0.0003587	0.67865	0.00061991	913.4416592817419	18.654	0.60084	18.654	18.504	19.105	0					10	5	3	0	0	0	6.8863E-10	1	11547	11547		148.33	96.096	1	31179000			2528	367	1464	1536	3402	3402		9606
TFQVLGNLYSEGDCTYLK	18	Unmodified	_TFQVLGNLYSEGDCTYLK_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MSMS	DP1141_10	5	1054.518310546875	2	1054.50388	2106.99321	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.54	1	21.54	21.04	22.04	0								0	0	0	0.0033102	1	16734	16734		128.76	77.152	1				2529	521	1465	1537	3403	3403		9606
TFQVLGNLYSEGDCTYLK	18	Unmodified	_TFQVLGNLYSEGDCTYLK_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	1055.0091552734375	2	1054.50388	2106.99321	0.81001	0.00085416	1.0569	0.0011145	1.8669	0.0019687	1055.0068535470207	21.529	0.90031	21.529	21.279	22.179	0					23	8	5	0	0	0	6.5303E-06	2	16259	16259;16288		193.51	159.32	1	40353000			2530	521	1465	1537	3404;3405	3404		9606
TFTDCFNCLPIAAIVDEK	18	Unmodified	_TFTDCFNCLPIAAIVDEK_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_10	5	1057.50048828125	2	1057.50028	2112.98601	0.45407	0.00048018	-0.48278	-0.00051054	-0.028708	-3.0359E-05	1058.001321896806	23.195	0.60954	23.195	22.942	23.551	0					19	8	5	0	0	0	0	3	19170	19170;19217;19531		324.48	291.25	1	52492000			2531	286;212;287	1466	1538	3406;3407;3408	3406		9606
TFTDCFNCLPIAAIVDEK	18	Unmodified	_TFTDCFNCLPIAAIVDEK_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_7	2	1057.503173828125	2	1057.50028	2112.98601	0.40677	0.00043016	-0.091874	-9.7157E-05	0.3149	0.000333	1058.0017412202508	23.187	0.4243	23.187	22.99	23.414	0					12	5	4	0	0	0	0	2	18783	18783;18844		271.64	248.53	1	13885000			2532	286;212;287	1466	1538	3409;3410	3409		9606
TFTDCFNCLPIAAIVDEK	18	Unmodified	_TFTDCFNCLPIAAIVDEK_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_8	3	1058.0009765625	2	1057.50028	2112.98601	0.83718	0.00088532	-0.57079	-0.00060361	0.26639	0.00028171	1058.0013857110246	23.199	1.5612	23.199	22.72	24.281	0					75	19	6	0	0	0	2.3092E-72	5	18160	18127;18160;18243;19313;19352		197.38	173.56	1	457640000			2533	286;212;287	1466	1538	3411;3412;3413;3414;3415	3412		9606
TFTDCFNCLPIAAIVDEK	18	Unmodified	_TFTDCFNCLPIAAIVDEK_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_8	3	705.3357543945312	3	705.335947	2112.98601	0.70127	0.00049463	0.19513	0.00013763	0.89641	0.00063227	705.6705476174224	23.199	0.37173	23.199	22.953	23.325	0					18	4	6	0	0	0	3.1304E-45	2	18559	18559;18619		165.66	146.24	1	40779000			2534	286;212;287	1466	1538	3416;3417	3416		9606
TFTDCFNCLPIAAIVDEK	18	Unmodified	_TFTDCFNCLPIAAIVDEK_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_9	4	1058.002685546875	2	1057.50028	2112.98601	0.045356	4.7964E-05	-0.026171	-2.7676E-05	0.019185	2.0288E-05	1058.0020048966494	23.217	1.1044	23.217	22.713	23.817	0					50	15	6	0	0	0	7.0772E-06	3	18240	18240;18286;19200		149.57	129.73	1	272210000			2535	286;212;287	1466	1538	3418;3419;3420	3418		9606
TFTDCFNCLPIAAIVDEK	18	Unmodified	_TFTDCFNCLPIAAIVDEK_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_9	4	705.6708374023438	3	705.335947	2112.98601	0.97424	0.00068717	-0.5615	-0.00039605	0.41274	0.00029112	705.6699310670837	23.217	0.60054	23.217	22.86	23.46	0					20	8	4	0	0	0	3.7082E-24	3	18717	18588;18653;18717		152.32	127.19	1	23191000			2536	286;212;287	1466	1538	3421;3422;3423	3423		9606
TFYNQAIMSSK	11	Oxidation (M)	_TFYNQAIM(Oxidation (M))SSK_	TFYNQAIM(1)SSK	TFYNQAIM(120)SSK	0	1	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_10	5	653.31103515625	2	653.31082	1304.60709	-0.78376	-0.00051204	1.2245	0.0008	0.44076	0.00028796	653.311666301255	16.832	0.36017	16.832	16.727	17.087	0					9	5	2	0	0	0	0.020538	1	9443	9443		123.11	102.41	1	97531000			2537	567	1467	1539	3424	3424	407	9606
TFYNQAIMSSK	11	Oxidation (M)	_TFYNQAIM(Oxidation (M))SSK_	TFYNQAIM(1)SSK	TFYNQAIM(120)SSK	0	1	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	653.3112182617188	2	653.31082	1304.60709	0.80678	0.00052708	-0.18997	-0.00012411	0.61681	0.00040297	653.3106708098031	16.878	1.4267	16.878	16.648	18.075	0					22	14	2	0	0	0	0.027934	1	8982	8982		118.03	106.67	1	292210000			2538	567	1467	1539	3425	3425	407	9606
TFYNQAIMSSK	11	Oxidation (M)	_TFYNQAIM(Oxidation (M))SSK_	TFYNQAIM(1)SSK	TFYNQAIM(110)SSK	0	1	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MSMS	DP1141_9	4	653.3111572265625	2	653.31082	1304.60709	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.889	1	16.889	16.389	17.389	0								0	0	0	0.0077566	1	8932	8932		110.53	85.658	1				2539	567	1467	1539	3426	3426	407	9606
TFYNQAIMSSK	11	Unmodified	_TFYNQAIMSSK_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	645.3138427734375	2	645.313363	1288.61217	0.97544	0.00062947	-0.27515	-0.00017756	0.70029	0.00045191	645.3132067391675	17.925	0.70091	17.925	17.674	18.375	0					10	6	2	0	0	0	0.011616	1	10841	10841		88.496	67.032	1	302240000			2540	567	1467	1540	3427	3427		9606
TGAIVDVPVGEELLGR	16	Unmodified	_TGAIVDVPVGEELLGR_			0	0	0	P25705	P25705	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	812.9655151367188	2	812.948869	1623.88319	0.84271	0.00068508	-0.078401	-6.3736E-05	0.7643	0.00062134	812.9489232675356	21.028	0.40011	21.028	20.778	21.178	0					7	3	3	0	0	0	0.0032358	1	15349	15349		180.24	134.48	1	25819000			2541	187	1468	1541	3428	3428		9606
TGEEDKKINEELESQYQQSMDSK	23	Oxidation (M)	_TGEEDKKINEELESQYQQSM(Oxidation (M))DSK_	TGEEDKKINEELESQYQQSM(1)DSK	TGEEDKKINEELESQYQQSM(150)DSK	0	1	2	O00193	O00193	O00193	SMAP	Small acidic protein	MULTI-MSMS	DP1141_10	5	911.7465209960938	3	911.411626	2731.21305	-0.28129	-0.00025637	0.39232	0.00035756	0.11102	0.00010119	911.7463961154815	17.237	0.40057	17.237	17.087	17.488	0					5	3	2	0	0	0	1.5207E-08	1	10273	10273		145.73	119.1	1	16892000			2542	32	1469	1542	3429	3429	30	9606
TGLREEHLACFGHVR	15	Unmodified	_TGLREEHLACFGHVR_			0	0	1	Q96F63	Q96F63	Q96F63	CCDC97	Coiled-coil domain-containing protein 97	MULTI-SECPEP	DP1141_9	4	445.7143249511719	4	446.227057	1780.87912	-0.36021	-0.00016074	0.36684	0.00016369	0.0066283	2.9577E-06	446.47804934221716	16.208	0.4857	16.208	15.872	16.358	0					11	4	5	0	0	0	0.025246	1	7773	7773		60.937	42.114	1	147260000			2543	510	1470	1543	3430	3430		9606
TGTAEMSSILEER	13	Oxidation (M)	_TGTAEM(Oxidation (M))SSILEER_	TGTAEM(1)SSILEER	TGTAEM(130)SSILEER	0	1	0	P25705	P25705	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_10	5	720.3333740234375	2	720.337763	1438.66097	0.98789	0.00071162	-3.6496	-0.0026289	-2.6617	-0.0019173	720.8368585967991	16.646	0.26657	16.646	16.46	16.727	0					6	3	2	0	0	0	0.0043778	1	9039	9039		125.23	64.397	1	19810000			2544	187	1471	1544	3431	3431	163	9606
TGTTGQSGAESGTTEPSAR	19	Unmodified	_TGTTGQSGAESGTTEPSAR_			0	0	0	Q7Z5P9	Q7Z5P9	Q7Z5P9	MUC19	Mucin-19	MULTI-MSMS	DP1141_10	5	897.912109375	2	897.908658	1793.80276	0.74072	0.0006651	2.4902	0.002236	3.231	0.0029011	897.9111994455127	20.126	0.59994	20.126	19.776	20.376	0					13	5	4	0	0	0	0.0079404	1	14677	14677		89.992	49.265	1	573520000			2545	452	1472	1545	3432	3432		9606
TGTTGQSGAESGTTEPSAR	19	Unmodified	_TGTTGQSGAESGTTEPSAR_			0	0	0	Q7Z5P9	Q7Z5P9	Q7Z5P9	MUC19	Mucin-19	MULTI-MSMS	DP1141_7	2	898.412841796875	2	897.908658	1793.80276	0.56435	0.00050673	1.9482	0.0017493	2.5125	0.002256	897.9107382135978	20.1	0.60073	20.1	19.85	20.451	0					13	5	4	0	0	0	0.0001162	1	14205	14205		103.11	78.041	1	330470000			2546	452	1472	1545	3433	3433		9606
TGTTGQSGAESGTTEPSAR	19	Unmodified	_TGTTGQSGAESGTTEPSAR_			0	0	0	Q7Z5P9	Q7Z5P9	Q7Z5P9	MUC19	Mucin-19	MULTI-MSMS	DP1141_8	3	897.9120483398438	2	897.908658	1793.80276	0.4055	0.0003641	2.2642	0.0020331	2.6697	0.0023972	897.9110166419082	20.126	0.40018	20.126	19.877	20.277	0					10	3	4	0	0	0	0.0025269	1	14090	14090		95.854	47.739	1	382080000			2547	452	1472	1545	3434	3434		9606
TGTTGQSGAESGTTEPSAR	19	Unmodified	_TGTTGQSGAESGTTEPSAR_			0	0	0	Q7Z5P9	Q7Z5P9	Q7Z5P9	MUC19	Mucin-19	MULTI-MSMS	DP1141_9	4	897.9116821289062	2	897.908658	1793.80276	1.0575	0.00094954	1.4904	0.0013382	2.5478	0.0022877	898.4117663903983	20.186	0.49797	20.186	19.739	20.237	0					14	4	5	0	0	0	1.9945E-05	1	14040	14040		114.21	67.253	1	46470000			2548	452	1472	1545	3435	3435		9606
TGVVPQLVK	9	Unmodified	_TGVVPQLVK_			0	0	0	P52292	P52292	P52292	KPNA2	Importin subunit alpha-1	MULTI-MSMS	DP1141_8	3	471.3334045410156	2	470.794935	939.575317	0.34559	0.0001627	-1.6942	-0.00079764	-1.3486	-0.00063494	470.7949631395477	17.48	0.30073	17.48	17.273	17.574	0					4	2	2	0	0	0	0.019317	1	10013	10013		84.916	40.799	1	17148000			2549	264	1473	1546	3436	3436		9606
THEDIEAQIR	10	Unmodified	_THEDIEAQIR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_10	5	404.5512390136719	3	404.538681	1210.59421	0.42377	0.00017143	-0.15294	-6.1871E-05	0.27083	0.00010956	404.53856666515236	15.24	0.40814	15.24	14.96	15.368	0					7	4	3	0	0	0	3.5194E-30	2	6837	6837;6856		148.94	108.94	1	44863000			2550	78	1474	1547	3437;3438	3437		9606
THEDIEAQIR	10	Unmodified	_THEDIEAQIR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_10	5	606.3046264648438	2	606.304384	1210.59421	0.15663	9.4964E-05	0.20845	0.00012638	0.36508	0.00022135	606.3045534461932	15.24	0.41272	15.24	15.12	15.533	0					9	4	4	0	0	0	0.0026981	2	6854	6854;6862		141.2	112.03	1	101030000			2551	78	1474	1547	3439;3440	3439		9606
THEDIEAQIR	10	Unmodified	_THEDIEAQIR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_6	1	606.833984375	2	606.304384	1210.59421	0.13767	8.3473E-05	0.63367	0.0003842	0.77135	0.00046767	606.3048445497868	15.358	0.50033	15.358	14.908	15.408	0					8	4	3	0	0	0	2.9993E-05	1	5882	5882		152.11	126.37	1	10110000			2552	78	1474	1547	3441	3441		9606
THEDIEAQIR	10	Unmodified	_THEDIEAQIR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	404.53887939453125	3	404.538681	1210.59421	-0.34806	-0.00014081	0.76584	0.00030981	0.41778	0.00016901	404.5390070844182	15.26	0.40227	15.26	15.109	15.512	0					8	3	3	0	0	0	0.0026894	1	6596	6596		93.111	70.39	1	254940000			2553	78	1474	1547	3442	3442		9606
THEDIEAQIR	10	Unmodified	_THEDIEAQIR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	404.5841064453125	3	404.538681	1210.59421	0.66412	0.00026866	-0.5191	-0.00021	0.14502	5.8665E-05	404.5384466640773	15.32	0.49969	15.32	14.972	15.472	0					6	4	2	0	0	0	1.806E-30	1	6420	6420		150.27	107.18	1	60420000			2554	78	1474	1547	3443	3443		9606
THEDIEAQIR	10	Unmodified	_THEDIEAQIR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_9	4	606.3046264648438	2	606.304384	1210.59421	-0.032111	-1.9469E-05	0.073533	4.4583E-05	0.041422	2.5114E-05	606.3041984428355	15.324	0.89031	15.324	15.075	15.965	0					13	8	3	0	0	0	0.020157	1	6376	6376		84.615	63.108	1	65032000			2555	78	1474	1547	3444	3444		9606
THEDIEAQIR	10	Unmodified	_THEDIEAQIR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_9	4	404.5387878417969	3	404.538681	1210.59421	0.31483	0.00012736	0.13488	5.4566E-05	0.44971	0.00018193	404.53863359559057	15.324	0.58409	15.324	14.887	15.471	0					12	5	3	0	0	0	0.0019971	1	6406	6406		90.108	53.684	1	34311000			2556	78	1474	1547	3445	3445		9606
THNLEPYFESFINNLR	16	Unmodified	_THNLEPYFESFINNLR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_10	5	665.6651000976562	3	665.330402	1992.96938	0.20191	0.00013433	0.44758	0.00029779	0.64949	0.00043212	665.665135973239	22.695	0.50683	22.695	22.435	22.942	0					13	5	4	0	0	0	7.0782E-06	2	18517	18384;18517		127.3	113.35	1	8009800		+	2557	102	1475	1548	3446;3447	3447		9606
THNLEPYFESFINNLR	16	Unmodified	_THNLEPYFESFINNLR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_7	2	665.6649780273438	3	665.330402	1992.96938	0.26601	0.00017698	0.18861	0.00012549	0.45462	0.00030247	665.6647279476094	22.703	0.67135	22.703	22.319	22.99	0					29	8	5	0	0	0	5.3544E-288	6	18047	17915;17946;18047;18063;18375;18470		230.96	212.28	1	101620000		+	2558	102	1475	1548	3448;3449;3450;3451;3452;3453	3450		9606
THNLEPYFESFINNLR	16	Unmodified	_THNLEPYFESFINNLR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_7	2	997.9931640625	2	997.491964	1992.96938	0.47279	0.0004716	-0.61819	-0.00061664	-0.1454	-0.00014503	997.992919546921	22.703	0.36724	22.703	22.486	22.853	0					7	4	3	0	0	0	3.0591E-100	1	18049	18049		211.38	172.2	1	26288000		+	2559	102	1475	1548	3454	3454		9606
THNLEPYFESFINNLR	16	Unmodified	_THNLEPYFESFINNLR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MSMS	DP1141_8	3	665.3308715820312	3	665.330402	1992.96938	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.748	1	22.748	22.248	23.248	0								0	0	0	0.0069801	1	17917	17917		105.39	69.621	1			+	2560	102	1475	1548	3455	3455		9606
THNLEPYFESFINNLR	16	Unmodified	_THNLEPYFESFINNLR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_9	4	665.9994506835938	3	665.330402	1992.96938	1.1201	0.00074525	-0.29654	-0.0001973	0.82359	0.00054796	665.6645553138897	22.697	0.65595	22.697	22.283	22.939	0					14	8	3	0	0	0	0.00066191	2	17933	17933;17979		133.86	110.79	1	20232000		+	2561	102	1475	1548	3456;3457	3456		9606
THNLEPYFESFINNLR	16	Unmodified	_THNLEPYFESFINNLR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_9	4	997.994384765625	2	997.491964	1992.96938	0.32084	0.00032004	0.18934	0.00018886	0.51018	0.0005089	997.491985000461	22.697	0.19732	22.697	22.582	22.779	0					4	2	2	0	0	0	1.3246E-21	1	18001	18001		169.09	146.06	1	4654400		+	2562	102	1475	1548	3458	3458		9606
THNLEPYFESFINNLRR	17	Unmodified	_THNLEPYFESFINNLRR_			0	0	1	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_7	2	538.9653930664062	4	538.274898	2149.07049	0.39112	0.00021053	0.0030468	1.64E-06	0.39417	0.00021217	538.5256123324054	21.9	0.3983	21.9	21.55	21.948	0					7	3	3	0	0	0	0.0014607	1	16800	16800		127.57	106.21	1	9698300		+	2563	102	1476	1549	3459	3459		9606
THNLEPYFESFINNLRR	17	Unmodified	_THNLEPYFESFINNLRR_			0	0	1	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_7	2	717.3858642578125	3	717.364105	2149.07049	0.58543	0.00041997	0.0063115	4.5276E-06	0.59174	0.00042449	717.6986111011582	21.9	1.0915	21.9	21.15	22.241	0					19	10	4	0	0	0	0.00023335	1	16819	16819		119.54	93.987	1	41344000		+	2564	102	1476	1549	3460	3460		9606
THNLEPYFESFINNLRR	17	Unmodified	_THNLEPYFESFINNLRR_			0	0	1	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_8	3	717.6997680664062	3	717.364105	2149.07049	0.25433	0.00018245	0.61875	0.00044387	0.87308	0.00062632	717.6987632715369	21.929	0.50035	21.929	21.479	21.979	0					10	4	3	0	0	0	0.00023511	1	16636	16636		108.34	72.308	1	6814300		+	2565	102	1476	1549	3461	3461		9606
THSDQFLVAFK	11	Unmodified	_THSDQFLVAFK_			0	0	0	P36542	P36542	P36542	ATP5C1	ATP synthase subunit gamma, mitochondrial	MSMS	DP1141_9	4	646.80517578125	2	646.83532	1291.65609	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.656	1	18.656	18.156	19.156	0								0	0	0	7.617400000000001E-70	1	11791	11791		188.91	130.68	1				2566	210	1477	1550	3462	3462		9606
THVTHHPLSDHEATLR	16	Unmodified	_THVTHHPLSDHEATLR_			0	0	0	P10321	P10321	P10321	HLA-C	HLA class I histocompatibility antigen, Cw-7 alpha chain	MULTI-MSMS	DP1141_9	4	463.4868469238281	4	463.486862	1849.91834	-0.19807	-9.1804E-05	0.68505	0.00031751	0.48697	0.00022571	463.738064374764	13.731	0.78973	13.731	13.204	13.994	0					21	10	3	0	0	0	0.013929	1	3790	3790		58.723	0	1	1232300			2567	137	1478	1551	3463	3463		9606
TIAECLADELINAAK	15	Unmodified	_TIAECLADELINAAK_			0	0	0	P46782	P46782	P46782	RPS5	40S ribosomal protein S5;40S ribosomal protein S5, N-terminally processed	MULTI-MSMS	DP1141_10	5	816.4197998046875	2	816.419088	1630.82362	0.6105	0.00049843	-0.23956	-0.00019558	0.37094	0.00030285	816.4189786855515	23.439	0.54153	23.439	23.088	23.629	0					11	7	3	0	0	0	4.2076999999999997E-100	4	19577	19506;19551;19577;19584		246.56	208.85	1	33499000			2568	237	1479	1552	3464;3465;3466;3467	3466		9606
TIAEQLAEK	9	Unmodified	_TIAEQLAEK_			0	0	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-MSMS	DP1141_6	1	501.7762145996094	2	501.776939	1001.53933	-0.095889	-4.8115E-05	-0.44988	-0.00022574	-0.54577	-0.00027385	501.7770834327064	16.455	0.60028	16.455	15.905	16.505	0					6	5	2	0	0	0	5.4008E-05	1	7723	7723		147.29	45.962	1	18560000			2569	445	1480	1553	3468	3468		9606
TIAFLLPMFR	10	Unmodified	_TIAFLLPMFR_			0	0	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-MSMS	DP1141_7	2	604.8466796875	2	604.846645	1207.67874	0.58682	0.00035494	-0.36805	-0.00022262	0.21877	0.00013232	604.8464027673643	23.978	0.435	23.978	23.808	24.243	0					10	5	3	0	0	0	3.2244E-21	1	19956	19956		174.27	134.2	1	17460000			2570	445	1481	1554	3469	3469		9606
TIAFLLPMFR	10	Unmodified	_TIAFLLPMFR_			0	0	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-MSMS	DP1141_8	3	604.7476196289062	2	604.846645	1207.67874	0.44113	0.00026682	-0.15098	-9.1322E-05	0.29015	0.00017549	604.8463479411296	23.976	0.23898	23.976	23.783	24.022	0					6	2	3	0	0	0	0.0064905	1	19727	19727		120.46	79.028	1	1446400			2571	445	1481	1554	3470	3470		9606
TIAFLLPMFR	10	Oxidation (M)	_TIAFLLPM(Oxidation (M))FR_	TIAFLLPM(1)FR	TIAFLLPM(110)FR	0	1	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MSMS	DP1141_7	2	612.8442993164062	2	612.844102	1223.67365	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.63	1	22.63	22.13	23.13	0								0	0	0	0.0082303	1	17928	17928		110.81	70.74	1				2572	445	1481	1555	3471	3471	330	9606
TIAFLLPMFR	10	Oxidation (M)	_TIAFLLPM(Oxidation (M))FR_	TIAFLLPM(1)FR	TIAFLLPM(83)FR	0	1	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-SECPEP	DP1141_8	3	612.3429565429688	2	612.844102	1223.67365	0.52098	0.00031928	-0.19705	-0.00012076	0.32393	0.00019852	613.345358269216	22.61	0.79365	22.61	22.079	22.872	0					10	8	2	0	0	0	0.03269	1	17593	17593		83.265	61.817	1	5756200			2573	445	1481	1555	3472	3472	330	9606
TIAQDYGVLK	10	Unmodified	_TIAQDYGVLK_			0	0	0	Q06830	Q06830	Q06830	PRDX1	Peroxiredoxin-1	MULTI-SECPEP	DP1141_10	5	554.6228637695312	2	554.305864	1106.59717	0.22919	0.00012704	0.17648	9.7825E-05	0.40567	0.00022487	554.306042703712	18.063	0.59957	18.063	17.688	18.287	0					11	5	4	0	0	0	0.0049522	1	11367	11367		112.41	73.605	1	45050000			2574	348	1482	1556	3473	3473		9606
TICSHVQNMIK	11	Oxidation (M)	_TICSHVQNM(Oxidation (M))IK_	TICSHVQNM(1)IK	TICSHVQNM(67)IK	0	1	0	P32969	P32969	P32969	RPL9	60S ribosomal protein L9	MULTI-MSMS	DP1141_10	5	450.2556457519531	3	449.55669	1345.64824	-0.35831	-0.00016108	0.028792	1.2944E-05	-0.32951	-0.00014814	449.5568879326837	14.769	0.34494	14.769	14.539	14.884	0					9	4	4	0	0	0	0.02012	1	5948	5948		66.92	44.359	1	80038000			2575	203	1483	1557	3474	3474	173	9606
TIDEGDADEVTK	12	Unmodified	_TIDEGDADEVTK_			0	0	0	Q7LBC6	Q7LBC6	Q7LBC6	KDM3B	Lysine-specific demethylase 3B	MULTI-MSMS	DP1141_7	2	646.8203735351562	2	646.796254	1291.57796	-0.39832	-0.00025763	1.5008	0.00097071	1.1025	0.00071308	646.7970345430437	15.359	0.40227	15.359	15.109	15.512	0					5	3	2	0	0	0	0.0040107	1	6575	6575		120.63	89.833	1	43982000			2576	447	1484	1558	3475	3475		9606
TIDEGDADEVTK	12	Unmodified	_TIDEGDADEVTK_			0	0	0	Q7LBC6	Q7LBC6	Q7LBC6	KDM3B	Lysine-specific demethylase 3B	MULTI-MSMS	DP1141_9	4	646.8024291992188	2	646.796254	1291.57796	0.97152	0.00062838	-0.53407	-0.00034544	0.43745	0.00028294	646.7961500035159	15.324	0.29691	15.324	15.174	15.471	0					4	2	2	0	0	0	0.0026578	1	6423	6423		123.79	83.069	1	4399000			2577	447	1484	1558	3476	3476		9606
TIDGILLLIER	11	Unmodified	_TIDGILLLIER_			0	0	0	Q13619;Q13620	Q13619	Q13619	CUL4A;CUL4B	Cullin-4A;Cullin-4B	MULTI-MSMS	DP1141_7	2	628.837646484375	2	628.384645	1254.75474	0.26066	0.00016379	-1.6678	-0.001048	-1.4072	-0.00088424	628.3833003024062	23.978	0.80663	23.978	23.357	24.164	0					22	10	3	0	0	0	1.6585E-14	2	19415	19415;19448		167.12	138.91	1	4558100			2578	378	1485	1559	3477;3478	3477		9606
TIEYLQPNPASR	12	Unmodified	_TIEYLQPNPASR_			0	0	0	Q99962;Q99961	Q99962	Q99962	SH3GL2;SH3GL1	Endophilin-A1;Endophilin-A2	MSMS	DP1141_6	1	694.82568359375	2	694.862066	1387.70958	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.579	1	17.579	17.079	18.079	0								0	0	0	0.023367	1	9575	9575		107.79	64.346	1				2579	534	1486	1560	3479	3479		9606
TIGGGDDSFNTFFSETGAGK	20	Unmodified	_TIGGGDDSFNTFFSETGAGK_			0	0	0	P68363;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;Q71U36	P68363	TUBA1B;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_10	5	1004.5362548828125	2	1004.45016	2006.88576	0.56724	0.00056976	-0.335	-0.00033649	0.23224	0.00023327	1004.9512963543347	21.226	0.48323	21.226	21.076	21.559	0					7	4	2	0	0	0	1.3808E-131	1	16301	16301		225.32	205.22	1	71075000			2580	321;442	1487	1561	3480	3480		9606
TIGGGDDSFNTFFSETGAGK	20	Unmodified	_TIGGGDDSFNTFFSETGAGK_			0	0	0	P68363;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;Q71U36	P68363	TUBA1B;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MSMS	DP1141_7	2	1004.5384521484375	2	1004.45016	2006.88576	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.256	1	21.256	20.756	21.756	0								0	0	0	8.2732E-166	1	15888	15888		214.48	177.95	1				2581	321;442	1487	1561	3481	3481		9606
TIGGGDDSFNTFFSETGAGK	20	Unmodified	_TIGGGDDSFNTFFSETGAGK_			0	0	0	P68363;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;Q71U36	P68363	TUBA1B;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_8	3	1004.5369262695312	2	1004.45016	2006.88576	0.55572	0.0005582	0.32172	0.00032316	0.87745	0.00088135	1004.9518414898587	21.228	0.50131	21.228	21.078	21.579	0					18	4	6	0	0	0	1.5571999999999998E-256	3	15760	15760;15798;15799		254.1	233.25	1	613890000			2582	321;442	1487	1561	3482;3483;3484	3482		9606
TIGGGDDSFNTFFSETGAGK	20	Unmodified	_TIGGGDDSFNTFFSETGAGK_			0	0	0	P68363;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;Q71U36	P68363	TUBA1B;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_9	4	1004.9524536132812	2	1004.45016	2006.88576	0.15022	0.00015089	0.55799	0.00056047	0.7082	0.00071136	1004.9521318770068	21.192	0.70164	21.192	20.837	21.538	0					16	6	5	0	0	0	1.5071E-49	2	15807	15807;15856		188.63	167.23	1	25103000			2583	321;442	1487	1561	3485;3486	3485		9606
TILQGSSEGTGLSALLPQPK	20	Unmodified	_TILQGSSEGTGLSALLPQPK_			0	0	0	Q92733	Q92733	Q92733	PRCC	Proline-rich protein PRCC	MULTI-MSMS	DP1141_8	3	999.0498657226562	2	999.049312	1996.08407	0.51984	0.00051935	0.71602	0.00071534	1.2359	0.0012347	999.5513419017454	21.128	0.30017	21.128	20.878	21.178	0					4	2	2	0	0	0	0.00010609	1	15547	15547		139.64	100.05	1	11980000			2584	492	1488	1562	3487	3487		9606
TINLYPLTNYTFGTK	15	Unmodified	_TINLYPLTNYTFGTK_			0	0	0	O43809	O43809	O43809	NUDT21	Cleavage and polyadenylation specificity factor subunit 5	MULTI-MSMS	DP1141_10	5	873.4594116210938	2	873.45907	1744.90359	0.52279	0.00045664	0.031553	2.756E-05	0.55435	0.0004842	873.4590465094558	21.809	0.49949	21.809	21.659	22.159	0					11	4	3	0	0	0	3.3903999999999994E-21	3	17274	17218;17274;17285		168.83	117.81	1	70014000			2585	61	1489	1563	3488;3489;3490	3489		9606
TIPNDPGFVVTLSNR	15	Unmodified	_TIPNDPGFVVTLSNR_			0	0	0	Q93009	Q93009	Q93009	USP7	Ubiquitin carboxyl-terminal hydrolase 7	MULTI-MSMS	DP1141_7	2	815.4341430664062	2	815.433387	1628.85222	0.62852	0.00051251	0.19485	0.00015889	0.82337	0.0006714	815.4336678871977	19.9	0.60064	19.9	19.75	20.351	0					10	5	3	0	0	0	0.022056	1	14055	14055		68.44	54.431	1	20051000			2586	501	1490	1564	3491	3491		9606
TIQFVDWCPTGFK	13	Unmodified	_TIQFVDWCPTGFK_			0	0	0	Q71U36;P0DPH8;P0DPH7;Q6PEY2	Q71U36	Q71U36	TUBA1A;TUBA3E	Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_8	3	800.4595336914062	2	799.887226	1597.7599	0.70388	0.00056303	0.63775	0.00051013	1.3416	0.0010732	799.8874495069845	21.829	0.59989	21.829	21.579	22.179	0					17	5	4	0	0	0	9.7594E-116	4	16453	16346;16453;16555;16569		224.75	148.58	1	32121000			2587	442	1491	1565	3492;3493;3494;3495	3493		9606
TIQFVDWCPTGFK	13	Unmodified	_TIQFVDWCPTGFK_			0	0	0	Q71U36;P0DPH8;P0DPH7;Q6PEY2	Q71U36	Q71U36	TUBA1A;TUBA3E	Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_9	4	800.0206909179688	2	799.887226	1597.7599	0.08784	7.0262E-05	0.68222	0.0005457	0.77006	0.00061596	799.8878386005476	21.782	0.47999	21.782	21.639	22.119	0					7	4	3	0	0	0	3.8537999999999994E-21	1	16511	16511		172.56	103.71	1	29627000			2588	442	1491	1565	3496	3496		9606
TIQVENSHLILTGAGALNK	19	Unmodified	_TIQVENSHLILTGAGALNK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	660.7037353515625	3	660.368856	1978.08474	0.61421	0.00040561	0.16262	0.00010739	0.77683	0.000513	660.703244370292	18.855	1.2012	18.855	18.604	19.806	0					27	11	5	0	0	0	5.9019E-06	2	11640	11606;11640		106.31	74.004	1	132350000			2589	367	1492	1566	3497;3498	3498		9606
TIQVENSHLILTGAGALNK	19	Unmodified	_TIQVENSHLILTGAGALNK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	990.5520629882812	2	990.049646	1978.08474	0.15636	0.0001548	0.78159	0.00077381	0.93794	0.00092861	990.5517956207818	18.847	0.50087	18.847	18.604	19.105	0					13	4	5	0	0	0	4.2989000000000005E-221	2	11650	11650;11702		277.94	236.25	1	32764000			2590	367	1492	1566	3499;3500	3499		9606
TISTMKVMQFQGMKR	15	2 Oxidation (M)	_TISTMKVM(Oxidation (M))QFQGM(Oxidation (M))KR_	TISTM(0.134)KVM(0.866)QFQGM(1)KR	TISTM(-8.1)KVM(8.1)QFQGM(38)KR	0	2	2	Q99538	Q99538	Q99538	LGMN	Legumain	MSMS	DP1141_8	3	909.4603271484375	2	909.457167	1816.89978	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.393	1	22.393	21.893	22.893	0								0	0	0	0.035652	1	17371	17371		56.404	13.687	3				2591	527	1493	1567	3501	3501	380;381	9606
TITLEVEPSDTIENVK	16	Unmodified	_TITLEVEPSDTIENVK_			0	0	0	P62987;P62979;P0CG47;P0CG48	P62987	P62987	UBA52;RPS27A;UBB;UBC	Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Polyubiquitin-B;Ubiquitin;Polyubiquitin-C;Ubiquitin	MULTI-MSMS	DP1141_10	5	894.7493286132812	2	894.467289	1786.92002	0.84511	0.00075592	-0.019885	-1.7786E-05	0.82522	0.00073814	894.4671042211518	19.426	0.49909	19.426	19.077	19.576	0					7	4	3	0	0	0	1.1857E-100	2	13727	13727;13761		215.72	160.53	1	22274000			2592	134	1494	1568	3502;3503	3502		9606
TITLEVEPSDTIENVK	16	Unmodified	_TITLEVEPSDTIENVK_			0	0	0	P62987;P62979;P0CG47;P0CG48	P62987	P62987	UBA52;RPS27A;UBB;UBC	Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Polyubiquitin-B;Ubiquitin;Polyubiquitin-C;Ubiquitin	MULTI-MSMS	DP1141_6	1	894.4070434570312	2	894.467289	1786.92002	0.38126	0.00034102	0.33595	0.0003005	0.71721	0.00064152	894.9691238769966	19.456	0.50038	19.456	19.105	19.606	0					5	4	2	0	0	0	4.7604E-120	2	12690	12690;12749		225.15	182.43	1	76313000			2593	134	1494	1568	3504;3505	3504		9606
TITLEVEPSDTIENVK	16	Unmodified	_TITLEVEPSDTIENVK_			0	0	0	P62987;P62979;P0CG47;P0CG48	P62987	P62987	UBA52;RPS27A;UBB;UBC	Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Polyubiquitin-B;Ubiquitin;Polyubiquitin-C;Ubiquitin	MULTI-MSMS	DP1141_8	3	894.079345703125	2	894.467289	1786.92002	0.57069	0.00051046	1.0871	0.00097239	1.6578	0.0014828	894.970456234524	19.426	0.30078	19.426	19.275	19.576	0					4	2	2	0	0	0	1.7557E-162	2	13053	13053;13158		238.98	186.7	1	29630000			2594	134	1494	1568	3506;3507	3506		9606
TIVQLENEIYQIK	13	Unmodified	_TIVQLENEIYQIK_			0	0	0	O75934	O75934	O75934	BCAS2	Pre-mRNA-splicing factor SPF27	MULTI-MSMS	DP1141_10	5	796.4429931640625	2	795.940513	1589.86647	0.82811	0.00065912	0.49684	0.00039546	1.3249	0.0010546	796.4424563247554	21.326	0.38307	21.326	21.176	21.559	0					9	3	4	0	0	0	0.035343	1	16560	16560		71.03	37.07	1	18365000			2595	83	1495	1569	3508	3508		9606
TKDHTLVQTIAR	12	Unmodified	_TKDHTLVQTIAR_			0	0	1	Q14684	Q14684	Q14684	RRP1B	Ribosomal RNA processing protein 1 homolog B	MULTI-SECPEP	DP1141_7	2	462.2405090332031	3	461.596531	1381.76776	0.04675	2.158E-05	0.2391	0.00011037	0.28585	0.00013195	461.93081696513514	15.059	0.50106	15.059	14.708	15.21	0					5	4	2	0	0	0	0.013297	1	6198	6198		103.14	54.394	1	13067000			2596	390	1496	1570	3509	3509		9606
TKEAVLLLK	9	Unmodified	_TKEAVLLLK_			0	0	1	P36578	P36578	P36578	RPL4	60S ribosomal protein L4	MULTI-SECPEP	DP1141_9	4	507.2566223144531	2	507.831517	1013.64848	-0.23885	-0.00012129	0.53799	0.00027321	0.29915	0.00015192	507.831771309431	16.598	0.23434	16.598	16.458	16.693	0					4	2	2	0	0	0	0.03032	1	8398	8398		123.86	64.707	1	23420000			2597	211	1497	1571	3510	3510		9606
TKTPGPGAQSALR	13	Unmodified	_TKTPGPGAQSALR_			0	0	1	P62263	P62263	P62263	RPS14	40S ribosomal protein S14	MULTI-MSMS	DP1141_10	5	428.57379150390625	3	428.573726	1282.69935	0.26609	0.00011404	0.012538	5.3735E-06	0.27862	0.00011941	428.573733985141	13.904	0.40406	13.904	13.624	14.028	0					11	7	2	0	0	0	1.6127E-20	2	4655	4584;4655		167.22	137.88	1	8385600			2598	291	1498	1572	3511;3512	3512		9606
TKYEHELALR	10	Unmodified	_TKYEHELALR_			0	0	1	CON__P08779;P08779	CON__P08779	CON__P08779	KRT16	Keratin, type I cytoskeletal 16	MULTI-MSMS	DP1141_9	4	420.56298828125	3	420.562938	1258.66699	0.49383	0.00020769	-0.46004	-0.00019348	0.033785	1.4209E-05	420.56278139935455	15.224	0.59303	15.224	14.98	15.573	0					12	5	3	0	0	0	0.01064	2	6189	6023;6189		141.91	124.19	1	93995000		+	2599	16	1499	1573	3513;3514	3514		9606
TLATDILMGVLK	12	Oxidation (M)	_TLATDILM(Oxidation (M))GVLK_	TLATDILM(1)GVLK	TLATDILM(94)GVLK	0	1	0	O43143	O43143	O43143	DHX15	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15	MULTI-MSMS	DP1141_7	2	645.871337890625	2	645.870514	1289.72647	0.0057985	3.7451E-06	0.74893	0.00048371	0.75473	0.00048746	645.8710554922346	23.161	0.28823	23.161	22.99	23.278	0					7	3	3	0	0	0	0.033097	1	18739	18739		94.409	72.559	1	12702000			2600	54	1500	1574	3515	3515	49	9606
TLGSSDTQQLR	11	Unmodified	_TLGSSDTQQLR_			0	0	0	Q9BRD0	Q9BRD0	Q9BRD0	BUD13	BUD13 homolog	MULTI-MSMS	DP1141_9	4	603.2808227539062	2	603.309666	1204.60478	0.070573	4.2577E-05	2.1603	0.0013033	2.2309	0.0013459	603.310947553306	15.247	0.69295	15.247	14.98	15.673	0					11	6	3	0	0	0	0.0055637	1	6105	6105		112.75	71.3	1	29778000			2601	537	1501	1575	3516	3516		9606
TLLDIDNTR	9	Unmodified	_TLLDIDNTR_			0	0	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-SECPEP	DP1141_6	1	530.27001953125	2	530.785296	1059.55604	1.1012	0.00058453	-0.68715	-0.00036473	0.4141	0.0002198	530.7849594727502	18.257	0.79999	18.257	18.005	18.805	0					18	7	5	0	0	0	1.2498E-36	1	10762	10762		206.09	119.29	1	171730000		+	2602	19	1502	1576	3517	3517		9606
TLLDIDNTR	9	Unmodified	_TLLDIDNTR_			0	0	0	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-MSMS	DP1141_9	4	530.8040771484375	2	530.785296	1059.55604	0.34397	0.00018257	0.44455	0.00023596	0.78852	0.00041854	530.7854994823396	18.287	0.80019	18.287	18.037	18.837	0					12	7	2	0	0	0	1.3267000000000001E-20	1	11163	11163		171.73	100.35	1	215640000		+	2603	19	1502	1576	3518	3518		9606
TLLEGEESR	9	Unmodified	_TLLEGEESR_			0	0	0	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_10	5	516.939697265625	2	517.261653	1032.50875	0.45652	0.00023614	-0.28855	-0.00014925	0.16797	8.6885E-05	517.2615139207269	15.826	0.45724	15.826	15.609	16.066	0					13	4	4	0	0	0	0.010083	1	7656	7656		98.582	62.964	1	43057000		+	2604	102	1503	1577	3519	3519		9606
TLLEGEESR	9	Unmodified	_TLLEGEESR_			0	0	0	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_6	1	517.261962890625	2	517.261653	1032.50875	0.065563	3.3913E-05	0.33929	0.0001755	0.40485	0.00020942	517.261783228776	15.846	0.79224	15.846	15.613	16.405	0					17	7	3	0	0	0	1.8484E-08	3	6728	6728;6737;6947		156.51	107.95	1	128840000		+	2605	102	1503	1577	3520;3521;3522	3520		9606
TLLEGEESR	9	Unmodified	_TLLEGEESR_			0	0	0	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_7	2	517.2618408203125	2	517.261653	1032.50875	0.037039	1.9159E-05	0.29643	0.00015333	0.33347	0.00017249	517.2617643086744	15.765	0.90527	15.765	15.309	16.215	0					16	8	3	0	0	0	0.0010685	1	7403	7403		128.61	95.715	1	390770000		+	2606	102	1503	1577	3523	3523		9606
TLLEGEESR	9	Unmodified	_TLLEGEESR_			0	0	0	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_8	3	517.238037109375	2	517.261653	1032.50875	0.23257	0.0001203	-0.078357	-4.0531E-05	0.15422	7.977E-05	517.2615699592776	15.826	0.89486	15.826	15.575	16.469	0					14	8	3	0	0	0	1.3916E-20	2	7165	7165;7285		171.53	125.85	1	157450000		+	2607	102	1503	1577	3524;3525	3524		9606
TLLEGEESR	9	Unmodified	_TLLEGEESR_			0	0	0	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_9	4	517.2619018554688	2	517.261653	1032.50875	0.10562	5.4635E-05	0.033889	1.7529E-05	0.13951	7.2165E-05	517.2616382582615	15.822	0.78535	15.822	15.573	16.358	0					13	7	2	0	0	0	0.00050388	1	7160	7160		143.73	111.8	1	321310000		+	2608	102	1503	1577	3526	3526		9606
TLLWTELFR	9	Unmodified	_TLLWTELFR_			0	0	0	O00217	O00217	O00217	NDUFS8	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial	MULTI-MSMS	DP1141_10	5	590.2980346679688	2	589.832049	1177.64954	0.85662	0.00050526	2.1652	0.0012771	3.0218	0.0017824	590.3360417274314	23.719	0.37147	23.719	23.479	23.851	0					6	4	2	0	0	0	0.010037	1	19842	19842		98.629	67.326	1	1703800			2609	33	1504	1578	3527	3527		9606
TLMNLGGLAVAR	12	Oxidation (M)	_TLM(Oxidation (M))NLGGLAVAR_	TLM(1)NLGGLAVAR	TLM(100)NLGGLAVAR	0	1	0	P37802	P37802	P37802	TAGLN2	Transgelin-2	MULTI-MSMS	DP1141_10	5	616.3450927734375	2	616.344997	1230.67544	-0.23065	-0.00014216	0.36306	0.00022377	0.1324	8.1607E-05	616.345219620718	18.637	0.69	18.637	18.487	19.177	0					13	6	4	0	0	0	0.029452	1	12491	12491		101.65	68.268	1	190570000			2610	213	1505	1579	3528	3528	179	9606
TLNDMRQEYEQLIAK	15	Oxidation (M)	_TLNDM(Oxidation (M))RQEYEQLIAK_	TLNDM(1)RQEYEQLIAK	TLNDM(56)RQEYEQLIAK	0	1	1	CON__P35527;P35527	CON__P35527	CON__P35527	KRT9	Keratin, type I cytoskeletal 9	MULTI-SECPEP	DP1141_7	2	622.9738159179688	3	623.312131	1866.91456	0.22476	0.0001401	-0.1634	-0.00010185	0.061355	3.8244E-05	623.3120865647214	18.359	0.50039	18.359	17.949	18.449	0					13	4	5	0	0	0	0.029541	1	11451	11451		56.46	9.4224	1	92249000		+	2611	19	1506	1580	3529	3529	23	9606
TLRDPSLPLLELQDIMTSVSGR	22	Oxidation (M)	_TLRDPSLPLLELQDIM(Oxidation (M))TSVSGR_	TLRDPSLPLLELQDIM(1)TSVSGR	TLRDPSLPLLELQDIM(120)TSVSGR	0	1	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	820.4415283203125	3	819.772101	2456.29447	1.0015	0.000821	-0.38362	-0.00031448	0.61788	0.00050652	820.106169420256	22.108	0.43924	22.108	21.865	22.304	0					20	6	5	0	0	0	8.3402E-07	4	16676	16556;16569;16676;16757		130.16	98.806	1	6330900			2612	367	1507	1581	3530;3531;3532;3533	3532	265	9606
TLRDPSLPLLELQDIMTSVSGR	22	Oxidation (M)	_TLRDPSLPLLELQDIM(Oxidation (M))TSVSGR_	TLRDPSLPLLELQDIM(1)TSVSGR	TLRDPSLPLLELQDIM(140)TSVSGR	0	1	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	820.1068725585938	3	819.772101	2456.29447	0.6655	0.00054556	-0.077436	-6.348E-05	0.58807	0.00048208	820.4405684338356	22.17	0.65026	22.17	21.75	22.4	0					13	6	3	0	0	0	1.2513E-07	2	17279	17148;17279		140.2	110.38	1	29840000			2613	367	1507	1581	3534;3535	3535	265	9606
TLTAVHDAILEDLVFPSEIVGK	22	Unmodified	_TLTAVHDAILEDLVFPSEIVGK_			0	0	0	P62081	P62081	P62081	RPS7	40S ribosomal protein S7	MULTI-MSMS	DP1141_10	5	790.0997924804688	3	789.765052	2366.27333	0.74993	0.00059227	-0.018408	-1.4538E-05	0.73152	0.00057773	790.0994378938634	23.265	0.21824	23.265	23.151	23.369	0					4	2	2	0	0	0	0.0054195	1	19430	19430		60.325	37.672	1	6079900			2614	285	1508	1582	3536	3536		9606
TLTEPRTNLK	10	Unmodified	_TLTEPRTNLK_			0	0	1	O00481	O00481	O00481	BTN3A1	Butyrophilin subfamily 3 member A1	MULTI-SECPEP	DP1141_7	2	586.7755126953125	2	586.83532	1171.65609	0.80539	0.00047263	-1.6046	-0.00094164	-0.79922	-0.00046901	586.8338904266573	21.996	0.69596	21.996	21.45	22.146	0					10	6	2	0	0	0	0.014654	1	16295	16295		94.114	26.134	1	7022400			2615	37	1509	1583	3537	3537		9606
TLTNYAARTKSLDMEIQALK	20	Oxidation (M)	_TLTNYAARTKSLDM(Oxidation (M))EIQALK_	TLTNYAARTKSLDM(1)EIQALK	TLTNYAARTKSLDM(43)EIQALK	0	1	2		REV__Q8NEY4	REV__Q8NEY4			MULTI-MSMS	DP1141_7	2	457.4451904296875	5	457.446083	2282.19403	0.81293	0.00037187	-2.9524	-0.0013506	-2.1395	-0.00097871	457.44483458961776	13.908	0.43062	13.908	13.78	14.21	0					9	4	4	0	0	0	0.035947	1	4529	4529		42.633	17.84	1	7022100	+		2616	628	1510	1584	3538	3538	431	9606
TLVSTVGSMVFNEGEAQR	18	Oxidation (M)	_TLVSTVGSM(Oxidation (M))VFNEGEAQR_	TLVSTVGSM(1)VFNEGEAQR	TLVSTVGSM(75)VFNEGEAQR	0	1	0	Q9P2E9	Q9P2E9	Q9P2E9	RRBP1	Ribosome-binding protein 1	MULTI-SECPEP	DP1141_9	4	971.4656372070312	2	970.972747	1939.93094	0.46288	0.00044944	-1.9266	-0.0018706	-1.4637	-0.0014212	971.4724328723997	20.486	0.60015	20.486	20.237	20.837	0					11	5	4	0	0	0	0.034842	1	15100	15100		74.611	38.164	1	88599000			2617	585	1511	1585	3539	3539	413	9606
TLYGFGG	7	Unmodified	_TLYGFGG_			0	0	0	P62805	P62805	P62805	HIST1H4A	Histone H4	MULTI-MSMS	DP1141_10	5	714.3411254882812	1	714.345717	713.338441	1.7305	0.0012362	-0.88926	-0.00063524	0.84126	0.00060095	714.3449770315282	20.226	0.99933	20.226	19.976	20.975	0					14	9	2	0	0	0	1.962E-09	2	14816	14765;14816		143.88	143.88	1	132400000			2618	303	1512	1586	3540;3541	3541		9606
TMIISPER	8	Unmodified	_TMIISPER_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	473.7550354003906	2	473.754953	945.495352	0.81056	0.00038401	-0.55804	-0.00026437	0.25252	0.00011963	473.75466869565054	16.694	0.32318	16.694	16.415	16.738	0					6	3	2	0	0	0	0.0049658	2	8653	8653;8789		116.88	66.181	1	46858000			2619	78	1513	1587	3542;3543	3542		9606
TMIISPER	8	Oxidation (M)	_TM(Oxidation (M))IISPER_	TM(1)IISPER	TM(85)IISPER	0	1	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MSMS	DP1141_8	3	481.5825500488281	2	481.75241	961.490267	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.333	1	15.333	14.833	15.833	0								0	0	0	0.02727	1	6447	6447		85.064	49.184	1				2620	78	1513	1588	3544	3544	73	9606
TNAENEFVTIK	11	Unmodified	_TNAENEFVTIK_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-SECPEP	DP1141_10	5	632.6151733398438	2	633.322242	1264.62993	-1.0197	-0.00064577	3.0327	0.0019206	2.013	0.0012749	633.3240444134086	17.793	0.50003	17.793	17.387	17.887	0					9	4	3	0	0	0	0.028693	1	10952	10952		85.533	44.104	1	12447000		+	2621	102	1514	1589	3545	3545		9606
TNAENEFVTIKK	12	Unmodified	_TNAENEFVTIKK_			0	0	1	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_6	1	466.2498779296875	3	465.248908	1392.72489	0.1222	5.6852E-05	0.085833	3.9934E-05	0.20803	9.6786E-05	465.2491905871947	16.155	0.60125	16.155	15.804	16.405	0					14	5	4	0	0	0	0.0085474	1	7151	7151		85.672	39.295	1	487200000		+	2622	102	1515	1590	3546	3546		9606
TNAENEFVTIKK	12	Unmodified	_TNAENEFVTIKK_			0	0	1	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-SECPEP	DP1141_7	2	465.7705078125	3	465.248908	1392.72489	0.75592	0.00035169	-0.50532	-0.0002351	0.25059	0.00011659	465.24866741822643	16.165	0.60007	16.165	15.815	16.415	0					10	5	3	0	0	0	0.010823	1	7885	7885		120.03	70.844	1	414240000		+	2623	102	1515	1590	3547	3547		9606
TNAENEFVTIKK	12	Unmodified	_TNAENEFVTIKK_			0	0	1	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_9	4	465.1845703125	3	465.248908	1392.72489	-0.1434	-6.6716E-05	0.60786	0.0002828	0.46446	0.00021609	465.2493242808867	16.108	0.58584	16.108	15.872	16.458	0					14	5	4	0	0	0	1.4907999999999999E-52	1	7730	7730		193.15	130.62	1	298180000		+	2624	102	1515	1590	3548	3548		9606
TNVVTMPTAHPR	12	Oxidation (M)	_TNVVTM(Oxidation (M))PTAHPR_	TNVVTM(1)PTAHPR	TNVVTM(75)PTAHPR	0	1	0	Q13428	Q13428	Q13428	TCOF1	Treacle protein	MULTI-MSMS	DP1141_7	2	447.231201171875	3	447.231083	1338.67142	0.59579	0.00026646	-0.32388	-0.00014485	0.27191	0.00012161	447.23098572690634	13.478	1.2373	13.478	12.624	13.861	0					19	12	3	0	0	0	0.0090182	2	3827	3827;3952		74.698	58.606	1	2551600			2625	373	1516	1591	3549;3550	3549	297	9606
TPAQYDASELK	11	Unmodified	_TPAQYDASELK_			0	0	0	P07355;A6NMY6	P07355	P07355	ANXA2;ANXA2P2	Annexin A2;Putative annexin A2-like protein	MULTI-SECPEP	DP1141_9	4	611.2976684570312	2	611.801143	1221.58773	-0.17589	-0.00010761	0.51311	0.00031392	0.33722	0.00020631	611.8014794490331	16.108	0.29275	16.108	15.965	16.258	0					4	2	2	0	0	0	6.3284E-08	1	7583	7583		161.19	121.64	1	19409000			2626	3	1517	1592	3551	3551		9606
TPCNAGTFSQPEK	13	Unmodified	_TPCNAGTFSQPEK_			0	0	0	O43684	O43684	O43684	BUB3	Mitotic checkpoint protein BUB3	MULTI-MSMS	DP1141_9	4	718.5972290039062	2	718.827366	1435.64018	0.84731	0.00060907	0.66907	0.00048094	1.5164	0.00109	718.8271322845669	15.192	0.38713	15.192	14.887	15.274	0					9	3	4	0	0	0	0.005002	1	6127	6127		110.93	76.746	1	10987000			2627	59	1518	1593	3552	3552		9606
TPGPGAQSALR	11	Unmodified	_TPGPGAQSALR_			0	0	0	P62263	P62263	P62263	RPS14	40S ribosomal protein S14	MULTI-MSMS	DP1141_10	5	527.7858276367188	2	527.78563	1053.55671	0.065032	3.4323E-05	0.22609	0.00011933	0.29112	0.00015365	527.7857442233911	14.769	0.49997	14.769	14.539	15.039	0					16	6	4	0	0	0	8.4351E-53	3	5889	5847;5889;5976		195.57	167.69	1	224690000			2628	291	1519	1594	3553;3554;3555	3554		9606
TPLGPLSSR	9	Unmodified	_TPLGPLSSR_			0	0	0	Q01167	Q01167	Q01167	FOXK2	Forkhead box protein K2	MULTI-MSMS	DP1141_8	3	464.2664794921875	2	464.266542	926.51853	-0.1199	-5.5664E-05	-0.034883	-1.6195E-05	-0.15478	-7.1859E-05	464.26658110226805	16.669	0.45487	16.669	16.276	16.731	0					11	4	4	0	0	0	0.0050352	1	8690	8690		111.74	76.245	1	32216000			2629	339	1520	1595	3556	3556		9606
TPSPAAEDAREPEAK	15	Unmodified	_TPSPAAEDAREPEAK_			0	0	1	Q92797	Q92797	Q92797	SYMPK	Symplekin	MULTI-MSMS	DP1141_7	2	523.5897827148438	3	523.589881	1567.74781	0.36482	0.00019102	-0.36245	-0.00018977	0.0023699	1.2409E-06	523.5896685668877	13.74	0.43372	13.74	13.428	13.861	0					10	4	3	0	0	0	0.0050892	1	4177	4177		143.56	115.24	1	8556600			2630	494	1521	1596	3557	3557		9606
TPTQTNGSNVPFKPR	15	Unmodified	_TPTQTNGSNVPFKPR_			0	0	1	P78347	P78347	P78347	GTF2I	General transcription factor II-I	MULTI-MSMS	DP1141_7	2	549.5018920898438	3	548.621516	1642.84272	-0.27783	-0.00015242	1.1611	0.00063698	0.88324	0.00048456	548.6222340597941	15.252	0.40052	15.252	14.909	15.309	0					9	3	4	0	0	0	0.0078678	1	6375	6375		117.48	87.303	1	9720300			2631	327	1522	1597	3558	3558		9606
TPTSSPASSPLVAK	14	Unmodified	_TPTSSPASSPLVAK_			0	0	0	Q14684	Q14684	Q14684	RRP1B	Ribosomal RNA processing protein 1 homolog B	MULTI-MSMS	DP1141_10	5	671.8646240234375	2	671.864274	1341.714	0.11246	7.5557E-05	0.49114	0.00032998	0.6036	0.00040553	671.8645506979024	15.658	0.32087	15.658	15.46	15.781	0					8	3	3	0	0	0	1.14E-135	4	7463	7277;7463;7495;7542		231.07	156.69	1	64440000			2632	390	1523	1598	3559;3560;3561;3562	3560		9606
TPTSSPASSPLVAK	14	Unmodified	_TPTSSPASSPLVAK_			0	0	0	Q14684	Q14684	Q14684	RRP1B	Ribosomal RNA processing protein 1 homolog B	MULTI-MSMS	DP1141_8	3	671.8836059570312	2	671.864274	1341.714	0.50404	0.00033865	-0.018613	-1.2505E-05	0.48543	0.00032614	671.8641973354682	15.726	0.30347	15.726	15.472	15.776	0					4	2	2	0	0	0	0.017775	1	6890	6890		79.659	20.506	1	7698800			2633	390	1523	1598	3563	3563		9606
TPVEEVPAAIAPFQGR	16	Unmodified	_TPVEEVPAAIAPFQGR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	841.4501342773438	2	841.449037	1680.88352	1.0736	0.00090335	-0.70086	-0.00058974	0.37271	0.00031361	841.4483862980817	19.856	0.5845	19.856	19.506	20.09	0					12	5	3	0	0	0	1.0189E-239	2	13292	13292;13322		254.07	201.83	1	223170000			2634	402	1524	1599	3564;3565	3564		9606
TPVEEVPAAIAPFQGR	16	Unmodified	_TPVEEVPAAIAPFQGR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_7	2	841.4495239257812	2	841.449037	1680.88352	0.49713	0.00041831	0.22394	0.00018843	0.72107	0.00060675	841.4491377564359	19.8	0.4	19.8	19.65	20.05	0					9	3	4	0	0	0	0.0018492	2	13874	13874;13877		121.08	93.214	1	192720000			2635	402	1524	1599	3566;3567	3566		9606
TPVEPEVAIHR	11	Unmodified	_TPVEPEVAIHR_			0	0	0	P60866	P60866	P60866	RPS20	40S ribosomal protein S20	MULTI-MSMS	DP1141_10	5	416.5630798339844	3	416.562938	1246.66699	0.37501	0.00015621	0.055227	2.3005E-05	0.43023	0.00017922	416.56289568067166	15.736	0.41295	15.736	15.46	15.873	0					7	4	3	0	0	0	0.0027291	1	7697	7697		106.16	73.1	1	40910000			2636	279	1525	1600	3568	3568		9606
TQDENPVVHFFK	12	Unmodified	_TQDENPVVHFFK_			0	0	0	P02686	P02686	P02686	MBP	Myelin basic protein	MULTI-MSMS	DP1141_7	2	487.5771789550781	3	487.577136	1459.70958	0.019404	9.4608E-06	0.22816	0.00011124	0.24756	0.00012071	487.5771879061238	19	0.50041	19	18.65	19.15	0					7	4	2	0	0	0	0.010734	1	12592	12592		80.318	47.841	1	18766000			2637	99	1526	1601	3569	3569		9606
TQGVPAVLK	9	Unmodified	_TQGVPAVLK_			0	0	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-MSMS	DP1141_7	2	456.77947998046875	2	456.779285	911.544017	0.72624	0.00033173	-0.66602	-0.00030422	0.060217	2.7506E-05	456.77897817370416	16.465	0.72986	16.465	15.914	16.644	0					9	7	2	0	0	0	0.028801	1	8390	8390		76.478	39.777	1	73850000			2638	259	1527	1602	3570	3570		9606
TQLSLLPR	8	Unmodified	_TQLSLLPR_			0	0	0	Q15020	Q15020	Q15020	SART3	Squamous cell carcinoma antigen recognized by T-cells 3	MULTI-MSMS	DP1141_7	2	464.2850341796875	2	464.284734	926.554916	0.34327	0.00015938	0.32067	0.00014888	0.66394	0.00030826	464.28502185146715	18.6	0.901	18.6	18.249	19.15	0					11	8	3	0	0	0	1.4826E-05	1	11900	11900		139.68	76.532	1	37600000			2639	398	1528	1603	3571	3571		9606
TQSRPGGPPNPPGPSPK	17	Unmodified	_TQSRPGGPPNPPGPSPK_			0	0	1	O95785	O95785	O95785	WIZ	Protein Wiz	MULTI-SECPEP	DP1141_7	2	557.2930908203125	3	557.625149	1669.85362	0.44631	0.00024887	0.013817	7.7049E-06	0.46013	0.00025658	557.6252595277471	14.079	0.68208	14.079	13.528	14.21	0					11	7	2	0	0	0	0.022083	1	4513	4513		79.837	54.963	1	9787600			2640	94	1529	1604	3572	3572		9606
TRLEQEIATYR	11	Unmodified	_TRLEQEIATYR_			0	0	1	CON__P02533;P02533;CON__Q6IFX2;CON__P19012;CON__A2A4G1;P19012;CON__Q04695;Q04695;CON__Q9QWL7;CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8	CON__P02533;CON__Q04695;CON__P08779	CON__P08779	KRT14;KRT15;KRT17;KRT16	Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 15;Keratin, type I cytoskeletal 17;Keratin, type I cytoskeletal 16	MULTI-MSMS	DP1141_9	4	460.9042663574219	3	460.580769	1378.72048	-0.31376	-0.00014451	0.53538	0.00024659	0.22162	0.00010207	460.5810516168355	17.588	0.29998	17.588	17.338	17.638	0					4	2	2	0	0	0	0.018326	1	10077	10077		95.273	70.42	1	62955000		+	2641	16;9;21	1530	1605	3573	3573		9606
TRLEQEIATYR	11	Unmodified	_TRLEQEIATYR_			0	0	1	CON__P02533;P02533;CON__Q6IFX2;CON__P19012;CON__A2A4G1;P19012;CON__Q04695;Q04695;CON__Q9QWL7;CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8	CON__P02533;CON__Q04695;CON__P08779	CON__P08779	KRT14;KRT15;KRT17;KRT16	Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 15;Keratin, type I cytoskeletal 17;Keratin, type I cytoskeletal 16	MULTI-MSMS	DP1141_9	4	690.3677368164062	2	690.367515	1378.72048	0.18858	0.00013019	-0.063993	-4.4178E-05	0.12459	8.6012E-05	690.3675095834878	17.584	0.29998	17.584	17.338	17.638	0					12	2	6	0	0	0	1.1483000000000001E-20	1	10120	10120		172.17	113.02	1	114080000		+	2642	16;9;21	1530	1605	3574	3574		9606
TSAAQAIHPGCGFLSENMEFAELCK	25	Oxidation (M)	_TSAAQAIHPGCGFLSENM(Oxidation (M))EFAELCK_	TSAAQAIHPGCGFLSENM(1)EFAELCK	TSAAQAIHPGCGFLSENM(130)EFAELCK	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	929.0059204101562	3	928.752383	2783.23532	0.25561	0.0002374	-0.042785	-3.9737E-05	0.21283	0.00019766	929.087170648142	20.007	0.39985	20.007	19.777	20.176	0					9	3	4	0	0	0	1.1452E-11	1	13848	13848		130.72	111.51	1	36735000			2643	521	1531	1606	3575	3575	378	9606
TSASIGSLCADAR	13	Unmodified	_TSASIGSLCADAR_			0	0	0	P60201	P60201	P60201	PLP1	Myelin proteolipid protein	MULTI-MSMS	DP1141_10	5	654.3133544921875	2	654.814258	1307.61396	-0.7664	-0.00050185	1.0081	0.00066013	0.24171	0.00015827	654.8151379394101	16.884	0.20625	16.884	16.727	16.933	0					7	3	3	0	0	0	0.004381	1	9453	9453		117.14	89.123	1	90933000			2644	276	1532	1607	3576	3576		9606
TSASIGSLCADAR	13	Unmodified	_TSASIGSLCADAR_			0	0	0	P60201	P60201	P60201	PLP1	Myelin proteolipid protein	MULTI-MSMS	DP1141_6	1	654.312744140625	2	654.814258	1307.61396	-0.13507	-8.8444E-05	0.59762	0.00039133	0.46255	0.00030289	654.8146350066434	16.909	0.47434	16.909	16.729	17.204	0					11	5	4	0	0	0	0	3	8512	8512;8571;8580		279.77	240.47	1	73355000			2645	276	1532	1607	3577;3578;3579	3577		9606
TSASIGSLCADAR	13	Unmodified	_TSASIGSLCADAR_			0	0	0	P60201	P60201	P60201	PLP1	Myelin proteolipid protein	MULTI-MSMS	DP1141_7	2	654.8146362304688	2	654.814258	1307.61396	0.19678	0.00012886	0.32574	0.0002133	0.52253	0.00034216	654.8145681362203	16.896	0.21517	16.896	16.738	16.953	0					8	2	4	0	0	0	3.8401E-98	2	9138	9138;9158		218.11	191.15	1	94177000			2646	276	1532	1607	3580;3581	3580		9606
TSASIGSLCADAR	13	Unmodified	_TSASIGSLCADAR_			0	0	0	P60201	P60201	P60201	PLP1	Myelin proteolipid protein	MULTI-MSMS	DP1141_9	4	654.814697265625	2	654.814258	1307.61396	0.94381	0.00061802	-0.70186	-0.00045959	0.24194	0.00015843	654.8137764616299	16.884	0.51765	16.884	16.62	17.138	0					13	6	4	0	0	0	2.1019E-233	3	8965	8939;8965;8986		255.19	197.64	1	71706000			2647	276	1532	1607	3582;3583;3584	3583		9606
TSASIILR	8	Unmodified	_TSASIILR_			0	0	0	P17987	P17987	P17987	TCP1	T-complex protein 1 subunit alpha	MULTI-SECPEP	DP1141_9	4	431.2284851074219	2	430.763635	859.512717	0.28179	0.00012138	-0.65711	-0.00028306	-0.37533	-0.00016168	430.7633342863537	16.886	0.26403	16.886	16.693	16.957	0					5	3	2	0	0	0	0.002243	1	8893	8893		124.59	58.791	1	9026400			2648	165	1533	1608	3585	3585		9606
TSEEEKNGSEELVEK	15	Unmodified	_TSEEEKNGSEELVEK_			0	0	1	Q9H0C8	Q9H0C8	Q9H0C8	ILKAP	Integrin-linked kinase-associated serine/threonine phosphatase 2C	MULTI-SECPEP	DP1141_9	4	569.5921020507812	3	569.935494	1706.78465	0.14366	8.1878E-05	0.31047	0.00017695	0.45414	0.00025883	569.935606558913	14.28	0.21025	14.28	14.178	14.388	0					8	2	4	0	0	0	3.0382E-05	1	4719	4719		122.33	93.548	1	6255200			2649	552	1534	1609	3586	3586		9606
TSEEEKNGSEELVEKK	16	Unmodified	_TSEEEKNGSEELVEKK_			0	0	2	Q9H0C8	Q9H0C8	Q9H0C8	ILKAP	Integrin-linked kinase-associated serine/threonine phosphatase 2C	MULTI-MSMS	DP1141_9	4	612.6348266601562	3	612.633815	1834.87962	-0.15657	-9.5921E-05	0.1201	7.3574E-05	-0.036476	-2.2346E-05	612.6343050967499	13.537	0.46762	13.537	13.204	13.672	0					9	5	2	0	0	0	0.025506	1	3681	3681		84.508	54.4	1	504700			2650	552	1535	1610	3587	3587		9606
TSIAIDTIINQK	12	Unmodified	_TSIAIDTIINQK_			0	0	0	P25705	P25705	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	658.8829345703125	2	658.874642	1315.73473	0.9975	0.00065723	-1.8948	-0.0012484	-0.89728	-0.0005912	658.874463623691	19.377	0.3004	19.377	19.175	19.476	0					4	2	2	0	0	0	0	1	12914	12914		271.26	204.99	1	10006000			2651	187	1536	1611	3588	3588		9606
TSPASLDFPESQK	13	Unmodified	_TSPASLDFPESQK_			0	0	0	Q96JM3	Q96JM3	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	MULTI-MSMS	DP1141_7	2	704.8598022460938	2	703.843539	1405.67252	0.92652	0.00065213	-1.0507	-0.00073954	-0.12419	-8.7412E-05	703.8432768600646	17.699	0.49956	17.699	17.45	17.949	0					9	4	3	0	0	0	0.0061576	1	10330	10330		91.469	50.389	1	18218000			2652	514	1537	1612	3589	3589		9606
TSQNSELNNMQDLVEDYKK	19	Oxidation (M)	_TSQNSELNNM(Oxidation (M))QDLVEDYKK_	TSQNSELNNM(1)QDLVEDYKK	TSQNSELNNM(120)QDLVEDYKK	0	1	1	CON__P35908v2;CON__P35908;P35908	CON__P35908v2	CON__P35908v2	KRT2	Keratin, type II cytoskeletal 2 epidermal	MULTI-MSMS	DP1141_6	1	758.3519287109375	3	758.018112	2271.03251	-0.5738	-0.00043495	0.35966	0.00027263	-0.21414	-0.00016232	758.3531866297893	16.914	0.47434	16.914	16.729	17.204	0					15	5	4	0	0	0	2.1039E-05	2	8517	8517;8579		119.51	91.395	1	40000000		+	2653	20	1538	1613	3590;3591	3590	25	9606
TSQNSELNNMQDLVEDYKK	19	Oxidation (M)	_TSQNSELNNM(Oxidation (M))QDLVEDYKK_	TSQNSELNNM(1)QDLVEDYKK	TSQNSELNNM(90)QDLVEDYKK	0	1	1	CON__P35908v2;CON__P35908;P35908	CON__P35908v2	CON__P35908v2	KRT2	Keratin, type II cytoskeletal 2 epidermal	MULTI-MSMS	DP1141_7	2	758.35302734375	3	758.018112	2271.03251	1.0389	0.00078748	-0.51856	-0.00039308	0.52031	0.0003944	758.3521556075331	16.89	0.21517	16.89	16.738	16.953	0					10	2	5	0	0	0	0.0025635	1	9147	9147		89.669	70.35	1	86101000		+	2654	20	1538	1613	3592	3592	25	9606
TSQNSELNNMQDLVEDYKK	19	Oxidation (M)	_TSQNSELNNM(Oxidation (M))QDLVEDYKK_	TSQNSELNNM(1)QDLVEDYKK	TSQNSELNNM(56)QDLVEDYKK	0	1	1	CON__P35908v2;CON__P35908;P35908	CON__P35908v2	CON__P35908v2	KRT2	Keratin, type II cytoskeletal 2 epidermal	MULTI-MSMS	DP1141_9	4	758.0186157226562	3	758.018112	2271.03251	0.71474	0.00054178	-0.13606	-0.00010314	0.57867	0.00043864	758.0179993138764	16.9	0.26403	16.9	16.693	16.957	0					9	3	4	0	0	0	0.020384	1	8996	8996		55.907	34.005	1	18740000		+	2655	20	1538	1613	3593	3593	25	9606
TSSGDASSLSIEETNKLR	18	Unmodified	_TSSGDASSLSIEETNKLR_			0	0	1	O43290	O43290	O43290	SART1	U4/U6.U5 tri-snRNP-associated protein 1	MULTI-SECPEP	DP1141_7	2	632.8489379882812	3	632.316598	1893.92796	0.43482	0.00027495	-0.015895	-1.0051E-05	0.41893	0.0002649	632.3168412674015	16.903	0.21517	16.903	16.738	16.953	0					6	2	3	0	0	0	0.00021983	1	9191	9191		98.421	70.655	1	22029000			2656	57	1539	1614	3594	3594		9606
TSTAPAASPNVR	12	Unmodified	_TSTAPAASPNVR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_10	5	586.3070678710938	2	586.306926	1170.5993	0.67253	0.00039431	-0.048735	-2.8574E-05	0.62379	0.00036574	586.3069037792533	13.8	0.25159	13.8	13.624	13.875	0					7	4	2	0	0	0	0.020435	1	4513	4513		79.974	50.2	1	1913900			2657	142	1540	1615	3595	3595		9606
TSTAPAASPNVR	12	Unmodified	_TSTAPAASPNVR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	586.3070678710938	2	586.306926	1170.5993	0.84898	0.00049777	-0.19741	-0.00011574	0.65158	0.00038203	586.3068141437165	13.775	0.48081	13.775	13.488	13.968	0					15	5	3	0	0	0	0.007179	3	3691	3691;3775;3926		90.108	62.779	1	2050700			2658	142	1540	1615	3596;3597;3598	3596		9606
TSTAPAASPNVR	12	Unmodified	_TSTAPAASPNVR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	586.3071899414062	2	586.306926	1170.5993	0.88415	0.00051838	-0.52282	-0.00030653	0.36133	0.00021185	586.3065757422636	13.74	0.51933	13.74	13.428	13.947	0					15	5	4	0	0	0	1.4342E-05	2	4072	4072;4168		150.35	99.546	1	17871000			2659	142	1540	1615	3599;3600	3599		9606
TSTTSSMVASAEQPR	15	Oxidation (M)	_TSTTSSM(Oxidation (M))VASAEQPR_	TSTTSSM(1)VASAEQPR	TSTTSSM(120)VASAEQPR	0	1	0	Q6NXS1;P41236	Q6NXS1	Q6NXS1	PPP1R2P3;PPP1R2	Protein phosphatase inhibitor 2-like protein 3;Protein phosphatase inhibitor 2	MULTI-MSMS	DP1141_10	5	784.8652954101562	2	784.864676	1567.7148	0.41532	0.00032597	-0.37177	-0.00029179	0.043542	3.4175E-05	784.8645387743695	14.247	0.57203	14.247	14.028	14.6	0					20	8	5	0	0	0	0.026803	2	5163	5163;5176		116.01	83.793	1	89660000			2660	224	1541	1616	3601;3602	3601	183	9606
TSTTSSMVASAEQPR	15	Oxidation (M)	_TSTTSSM(Oxidation (M))VASAEQPR_	TSTTSSM(1)VASAEQPR	TSTTSSM(63)VASAEQPR	0	1	0	Q6NXS1;P41236	Q6NXS1	Q6NXS1	PPP1R2P3;PPP1R2	Protein phosphatase inhibitor 2-like protein 3;Protein phosphatase inhibitor 2	MULTI-MSMS	DP1141_10	5	523.5789794921875	3	523.578876	1567.7148	0.27711	0.00014509	-0.17648	-9.2403E-05	0.10063	5.2685E-05	523.5788721919745	14.247	0.2492	14.247	14.09	14.339	0					8	3	3	0	0	0	0.008722	1	5259	5259		63.29	39.834	1	7757300			2661	224	1541	1616	3603	3603	183	9606
TSTTSSMVASAEQPR	15	Oxidation (M)	_TSTTSSM(Oxidation (M))VASAEQPR_	TSTTSSM(1)VASAEQPR	TSTTSSM(130)VASAEQPR	0	1	0	Q6NXS1;P41236	Q6NXS1	Q6NXS1	PPP1R2P3;PPP1R2	Protein phosphatase inhibitor 2-like protein 3;Protein phosphatase inhibitor 2	MULTI-MSMS	DP1141_9	4	784.8650512695312	2	784.864676	1567.7148	0.73078	0.00057356	0.045915	3.6037E-05	0.7767	0.0006096	784.8647199492545	14.28	0.27421	14.28	14.114	14.388	0					9	3	3	0	0	0	0.019045	1	4715	4715		133.05	109.53	1	20276000			2662	224	1541	1616	3604	3604	183	9606
TTAARPTFEPAR	12	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))TTAARPTFEPAR_			1	0	1	Q9P013	Q9P013	Q9P013	CWC15	Spliceosome-associated protein CWC15 homolog	MULTI-MSMS	DP1141_10	5	680.3544921875	2	680.354408	1358.69426	0.34303	0.00023338	-0.23759	-0.00016165	0.10544	7.1737E-05	680.3543274763622	16.606	0.18863	16.606	16.46	16.649	0					6	2	3	0	0	0	0.0032852	1	9033	9033		116.55	52.73	1	20778000			2663	581	1542	1617	3605	3605		9606
TTAARPTFEPAR	12	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))TTAARPTFEPAR_			1	0	1	Q9P013	Q9P013	Q9P013	CWC15	Spliceosome-associated protein CWC15 homolog	MULTI-MSMS	DP1141_9	4	680.354736328125	2	680.354408	1358.69426	-0.15715	-0.00010692	2.5677	0.001747	2.4106	0.0016401	680.3549323963675	16.535	0.43461	16.535	16.258	16.693	0					10	4	4	0	0	0	0.0034747	1	8533	8533		104.82	48.392	1	23895000			2664	581	1542	1617	3606	3606		9606
TTAENEFVMLKK	12	Oxidation (M)	_TTAENEFVM(Oxidation (M))LKK_	TTAENEFVM(1)LKK	TTAENEFVM(55)LKK	0	1	1	CON__P13647;P13647	CON__P13647	CON__P13647	KRT5	Keratin, type II cytoskeletal 5	MSMS	DP1141_6	1	476.2464599609375	3	476.246399	1425.71737	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.688	1	16.688	16.188	17.188	0								0	0	0	0.034624	1	8120	8120		55.258	20.181	1			+	2665	18	1543	1618	3607	3607	17	9606
TTAENEFVMLKK	12	Oxidation (M)	_TTAENEFVM(Oxidation (M))LKK_	TTAENEFVM(1)LKK	TTAENEFVM(64)LKK	0	1	1	CON__P13647;P13647	CON__P13647	CON__P13647	KRT5	Keratin, type II cytoskeletal 5	MSMS	DP1141_8	3	476.2342224121094	3	476.246399	1425.71737	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.616	1	16.616	16.116	17.116	0								0	0	0	0.030494	1	8547	8547		63.864	26.308	1			+	2666	18	1543	1618	3608	3608	17	9606
TTAENEFVMLKK	12	Oxidation (M)	_TTAENEFVM(Oxidation (M))LKK_	TTAENEFVM(1)LKK	TTAENEFVM(80)LKK	0	1	1	CON__P13647;P13647	CON__P13647	CON__P13647	KRT5	Keratin, type II cytoskeletal 5	MULTI-SECPEP	DP1141_9	4	476.2342529296875	3	476.246399	1425.71737	0.35878	0.00017087	0.55522	0.00026442	0.914	0.00043529	476.24620781850996	16.613	0.53442	16.613	16.158	16.693	0					10	5	3	0	0	0	0.0047261	1	8454	8454		80.245	34.416	1	16209000		+	2667	18	1543	1618	3609	3609	17	9606
TTASEPVEQSEATSK	15	Unmodified	_TTASEPVEQSEATSK_			0	0	0	Q15007	Q15007	Q15007	WTAP	Pre-mRNA-splicing regulator WTAP	MULTI-MSMS	DP1141_9	4	783.0271606445312	2	782.870482	1563.72641	0.74248	0.00058126	0.027758	2.1731E-05	0.77024	0.000603	782.8707424780789	13.947	0.1834	13.947	13.81	13.994	0					4	2	2	0	0	0	0.0028658	2	4235	4235;4271		139.76	97.424	1	1623700			2668	397	1544	1619	3610;3611	3610		9606
TTDGYLLR	8	Unmodified	_TTDGYLLR_			0	0	0	P61247	P61247	P61247	RPS3A	40S ribosomal protein S3a	MSMS	DP1141_9	4	470.23309326171875	2	469.750724	937.486896	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.279	1	17.279	16.779	17.779	0								0	0	0	0.021931	1	9571	9571		115.46	30.099	1				2669	280	1545	1620	3612	3612		9606
TTHFVEGGDAGNREDQINR	19	Unmodified	_TTHFVEGGDAGNREDQINR_			0	0	1	P18124	P18124	P18124	RPL7	60S ribosomal protein L7	MULTI-MSMS	DP1141_10	5	705.8359375	3	705.998262	2114.97296	0.87368	0.00061682	-0.18766	-0.00013249	0.68603	0.00048433	706.3324468436432	14.924	0.46296	14.924	14.736	15.199	0					7	5	2	0	0	0	0.019822	1	6170	6170		117.13	78.136	1	150150000			2670	167	1546	1621	3613	3613		9606
TTHFVEGGDAGNREDQINR	19	Unmodified	_TTHFVEGGDAGNREDQINR_			0	0	1	P18124	P18124	P18124	RPL7	60S ribosomal protein L7	MULTI-MSMS	DP1141_10	5	530.0009765625	4	529.750516	2114.97296	0.014081	7.4593E-06	0.45805	0.00024265	0.47213	0.00025011	530.0014387629154	14.924	0.46296	14.924	14.736	15.199	0					14	5	3	0	0	0	0.022873	1	6255	6255		112.12	85.756	1	245750000			2671	167	1546	1621	3614	3614		9606
TTLTAAITK	9	Unmodified	_TTLTAAITK_			0	0	0	P49411	P49411	P49411	TUFM	Elongation factor Tu, mitochondrial	MULTI-MSMS	DP1141_9	4	460.2372131347656	2	460.276575	918.538597	-0.42711	-0.00019659	0.78249	0.00036016	0.35537	0.00016357	460.2768964808477	16.283	0.29993	16.283	16.058	16.358	0					4	2	2	0	0	0	0.006255	1	7844	7844		115.49	82.001	1	3163500			2672	247	1547	1622	3615	3615		9606
TTPDVIFVFGFR	12	Unmodified	_TTPDVIFVFGFR_			0	0	0	P62847	P62847	P62847	RPS24	40S ribosomal protein S24	MULTI-MSMS	DP1141_10	5	699.8751220703125	2	699.874445	1397.73434	1.1074	0.00077506	-0.28392	-0.00019871	0.82351	0.00057635	699.8742443128449	23.402	0.25066	23.402	23.301	23.551	0					10	3	4	0	0	0	0.0020935	2	19572	19572;19580		128.6	86.004	1	44835000			2673	307	1548	1623	3616;3617	3616		9606
TTPSYVAFTDTER	13	Unmodified	_TTPSYVAFTDTER_			0	0	0	P0DMV8;P0DMV9;P34931;P11142;P54652;P17066;P48741	P0DMV8;P11142;P17066	P0DMV8	HSPA1A;HSPA1B;HSPA1L;HSPA8;HSPA2;HSPA6;HSPA7	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like;Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2;Heat shock 70 kDa protein 6;Putative heat shock 70 kDa protein 7	MULTI-MSMS	DP1141_10	5	744.354736328125	2	744.354271	1486.69399	0.48323	0.00035969	0.2526	0.00018802	0.73582	0.00054771	744.3544360329203	18.437	0.49947	18.437	18.087	18.587	0					7	4	2	0	0	0	4.1576E-09	1	12011	12011		155.53	130.74	1	258460000			2674	135;140;161	1549	1624	3618	3618		9606
TTPSYVAFTDTER	13	Unmodified	_TTPSYVAFTDTER_			0	0	0	P0DMV8;P0DMV9;P34931;P11142;P54652;P17066;P48741	P0DMV8;P11142;P17066	P0DMV8	HSPA1A;HSPA1B;HSPA1L;HSPA8;HSPA2;HSPA6;HSPA7	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like;Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2;Heat shock 70 kDa protein 6;Putative heat shock 70 kDa protein 7	MULTI-MSMS	DP1141_8	3	744.35498046875	2	744.354271	1486.69399	0.9781	0.00072806	0.19213	0.00014302	1.1702	0.00087107	744.3545941322473	18.425	0.80086	18.425	18.075	18.876	0					15	7	3	0	0	0	0.0040319	1	11340	11340		119.34	91.564	1	2320100000			2675	135;140;161	1549	1624	3619	3619		9606
TTPSYVAFTDTER	13	Unmodified	_TTPSYVAFTDTER_			0	0	0	P0DMV8;P0DMV9;P34931;P11142;P54652;P17066;P48741	P0DMV8;P11142;P17066	P0DMV8	HSPA1A;HSPA1B;HSPA1L;HSPA8;HSPA2;HSPA6;HSPA7	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like;Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2;Heat shock 70 kDa protein 6;Putative heat shock 70 kDa protein 7	MULTI-MSMS	DP1141_9	4	744.8712158203125	2	744.354271	1486.69399	0.49144	0.00036581	0.11186	8.3265E-05	0.60331	0.00044907	744.3542889156965	18.387	0.50029	18.387	18.137	18.637	0					8	4	3	0	0	0	0.00065851	1	11339	11339		136.49	95.765	1	122300000			2676	135;140;161	1549	1624	3620	3620		9606
TTQQIDLQGPGPWGFR	16	Acetyl (Protein N-term)	_(Acetyl (Protein N-term))TTQQIDLQGPGPWGFR_			1	0	0	O00151	O00151	O00151	PDLIM1	PDZ and LIM domain protein 1	MULTI-MSMS	DP1141_9	4	922.4674072265625	2	921.9603	1841.90605	0.99476	0.00091713	0.66674	0.0006147	1.6615	0.0015318	922.4623748585897	22.89	0.35421	22.89	22.713	23.067	0					6	4	2	0	0	0	1.1833E-06	2	18281	18281;18380		185.25	114.1	1	3446100			2677	31	1550	1625	3621;3622	3621		9606
TTTAAAVASTGPSSR	15	Unmodified	_TTTAAAVASTGPSSR_			0	0	0	P27816	P27816	P27816	MAP4	Microtubule-associated protein 4	MULTI-SECPEP	DP1141_7	2	689.3316650390625	2	689.352062	1376.68957	0.7683	0.00052963	0.27588	0.00019018	1.0442	0.00071981	689.3523810002006	14.358	0.59834	14.358	14.21	14.809	0					6	5	2	0	0	0	0.0079628	1	5074	5074		104.94	43.724	1	7158000			2678	192	1551	1626	3623	3623		9606
TTVEYLIK	8	Unmodified	_TTVEYLIK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	483.8031005859375	2	483.778951	965.543348	1.057	0.00051137	-0.70004	-0.00033867	0.35699	0.00017271	483.7788099418149	18.055	1.0002	18.055	17.905	18.905	0					18	9	4	0	0	0	0.013455	1	10401	10401		90.777	54.897	1	1093400000			2679	367	1552	1627	3624	3624		9606
TTVQQEPLESGAK	13	Unmodified	_TTVQQEPLESGAK_			0	0	0	P49750	P49750	P49750	YLPM1	YLP motif-containing protein 1	MSMS	DP1141_6	1	694.2988891601562	2	694.356813	1386.69907	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.01	1	15.01	14.51	15.51	0								0	0	0	4.5795E-10	1	5431	5431		150.1	88.51	1				2680	250	1553	1628	3625	3625		9606
TVAIHSDVDASSVHVK	16	Unmodified	_TVAIHSDVDASSVHVK_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_6	1	417.22125244140625	4	416.970514	1663.85295	-0.028422	-1.1851E-05	0.19887	8.2923E-05	0.17045	7.1071E-05	417.2212852297087	15.358	0.49978	15.358	15.209	15.708	0					10	4	4	0	0	0	0.032314	1	6126	6126		46.324	19.595	1	16162000			2681	110	1554	1629	3626	3626		9606
TVAIHSDVDASSVHVK	16	Unmodified	_TVAIHSDVDASSVHVK_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_8	3	555.625	3	555.624926	1663.85295	0.48144	0.0002675	0.42284	0.00023494	0.90428	0.00050244	555.624836900523	15.42	0.60405	15.42	15.172	15.776	0					18	5	5	0	0	0	3.3614E-06	1	6606	6606		153.2	127.08	1	257480000			2682	110	1554	1629	3627	3627		9606
TVAIHSDVDASSVHVK	16	Unmodified	_TVAIHSDVDASSVHVK_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_9	4	555.8245849609375	3	555.624926	1663.85295	0.65888	0.00036609	-0.57374	-0.00031879	0.085133	4.7302E-05	555.6245438497768	15.419	0.39861	15.419	15.174	15.573	0					6	3	2	0	0	0	0.016448	1	6370	6370		67.846	48.242	1	17621000			2683	110	1554	1629	3628	3628		9606
TVAIYSEQDTGQMHR	15	Oxidation (M)	_TVAIYSEQDTGQM(Oxidation (M))HR_	TVAIYSEQDTGQM(1)HR	TVAIYSEQDTGQM(86)HR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_10	5	584.7747192382812	3	584.605426	1750.79445	0.41024	0.00023983	-0.1635	-9.5582E-05	0.24674	0.00014425	584.6054086877173	15.24	0.32893	15.24	15.039	15.368	0					11	3	5	0	0	0	0.0033533	2	6760	6683;6760		86.467	65.009	1	53293000			2684	142	1555	1630	3629;3630	3630	145	9606
TVAIYSEQDTGQMHR	15	Oxidation (M)	_TVAIYSEQDTGQM(Oxidation (M))HR_	TVAIYSEQDTGQM(1)HR	TVAIYSEQDTGQM(110)HR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	584.605712890625	3	584.605426	1750.79445	0.38926	0.00022756	0.12947	7.5689E-05	0.51873	0.00030325	584.6056319595285	15.358	0.79632	15.358	15.108	15.905	0					13	7	2	0	0	0	0.0016911	1	5968	5968		105.99	64.154	1	24515000			2685	142	1555	1630	3631	3631	145	9606
TVAIYSEQDTGQMHR	15	Oxidation (M)	_TVAIYSEQDTGQM(Oxidation (M))HR_	TVAIYSEQDTGQM(1)HR	TVAIYSEQDTGQM(94)HR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	584.60595703125	3	584.605426	1750.79445	0.2067	0.00012084	0.44019	0.00025734	0.6469	0.00037818	584.6058339965084	15.26	1.0051	15.26	15.009	16.014	0					20	9	3	0	0	0	0.0014883	2	6595	6383;6595		94.09	78.45	1	607800000			2686	142	1555	1630	3632;3633	3633	145	9606
TVAIYSEQDTGQMHR	15	Oxidation (M)	_TVAIYSEQDTGQM(Oxidation (M))HR_	TVAIYSEQDTGQM(1)HR	TVAIYSEQDTGQM(99)HR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	876.4052124023438	2	876.4045	1750.79445	-0.040004	-3.506E-05	0.67138	0.0005884	0.63138	0.00055334	876.4051534172595	15.26	0.50468	15.26	15.109	15.614	0					11	4	4	0	0	0	0.011849	1	6603	6603		99.5	75.672	1	100660000			2687	142	1555	1630	3634	3634	145	9606
TVAIYSEQDTGQMHR	15	Oxidation (M)	_TVAIYSEQDTGQM(Oxidation (M))HR_	TVAIYSEQDTGQM(1)HR	TVAIYSEQDTGQM(56)HR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	584.6055908203125	3	584.605426	1750.79445	0.49013	0.00028653	0.1325	7.7459E-05	0.62262	0.00036399	584.6055853859538	15.32	0.60333	15.32	15.072	15.675	0					8	5	2	0	0	0	0.017363	1	6594	6594		56.29	39.212	1	100860000			2688	142	1555	1630	3635	3635	145	9606
TVAIYSEQDTGQMHR	15	Oxidation (M)	_TVAIYSEQDTGQM(Oxidation (M))HR_	TVAIYSEQDTGQM(1)HR	TVAIYSEQDTGQM(120)HR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_9	4	584.297607421875	3	584.605426	1750.79445	0.63988	0.00037408	0.099129	5.7951E-05	0.73901	0.00043203	584.939719005312	15.324	0.49784	15.324	15.075	15.573	0					7	4	2	0	0	0	0.00070394	1	6313	6313		123.02	92.885	1	29936000			2689	142	1555	1630	3636	3636	145	9606
TVAIYSEQDTGQMHR	15	Unmodified	_TVAIYSEQDTGQMHR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	579.3125610351562	3	579.273787	1734.79953	0.64843	0.00037562	-0.0058945	-3.4145E-06	0.64253	0.0003722	579.2738081275068	16.155	0.8246	16.155	15.905	16.729	0					9	8	2	0	0	0	0.0040006	1	7209	7209		120.6	100.91	1	79654000			2690	142	1555	1631	3637	3637		9606
TVAIYSEQDTGQMHR	15	Unmodified	_TVAIYSEQDTGQMHR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	579.3340454101562	3	579.273787	1734.79953	0.80814	0.00046813	-0.60217	-0.00034882	0.20597	0.00011931	579.2735806402804	16.165	0.82342	16.165	15.914	16.738	0					14	8	4	0	0	0	0.00047918	2	7823	7823;7968		163.51	139.42	1	240510000			2691	142	1555	1631	3638;3639	3638		9606
TVAIYSEQDTGQMHR	15	Unmodified	_TVAIYSEQDTGQMHR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	579.9238891601562	3	579.273787	1734.79953	-0.18415	-0.00010667	0.65833	0.00038135	0.47418	0.00027468	579.2741692794681	16.126	0.30036	16.126	15.976	16.276	0					6	2	3	0	0	0	0.0010683	1	7716	7716		155.66	132.78	1	120940000			2692	142	1555	1631	3640	3640		9606
TVANLLSGK	9	Unmodified	_TVANLLSGK_			0	0	0	Q13428	Q13428	Q13428	TCOF1	Treacle protein	MULTI-SECPEP	DP1141_7	2	451.2107238769531	2	451.768917	901.523281	0.60321	0.00027251	-0.32485	-0.00014676	0.27836	0.00012576	451.76884248255953	17.499	0.39996	17.499	17.249	17.649	0					5	3	2	0	0	0	0.0023994	1	10121	10121		113.66	45.276	1	18277000			2693	373	1556	1632	3641	3641		9606
TVAVWDSETGER	12	Unmodified	_TVAVWDSETGER_			0	0	0	Q96DI7	Q96DI7	Q96DI7	SNRNP40	U5 small nuclear ribonucleoprotein 40 kDa protein	MULTI-MSMS	DP1141_9	4	675.348388671875	2	675.320231	1348.62591	0.25903	0.00017493	0.63572	0.00042931	0.89475	0.00060424	675.320618635134	17.588	0.40012	17.588	17.437	17.837	0					5	3	2	0	0	0	5.4162E-06	1	10095	10095		152.97	106.51	1	7334200			2694	505	1557	1633	3642	3642		9606
TVCQIPLMKEMLK	13	2 Oxidation (M)	_TVCQIPLM(Oxidation (M))KEM(Oxidation (M))LK_	TVCQIPLM(1)KEM(1)LK	TVCQIPLM(51)KEM(51)LK	0	2	1	Q9C037	Q9C037	Q9C037	TRIM4	E3 ubiquitin-protein ligase TRIM4	MULTI-SECPEP	DP1141_7	2	541.3059692382812	3	541.615329	1621.82416	0.24614	0.00013331	-2.3564	-0.0012762	-2.1102	-0.0011429	541.6144285915503	17.999	0.50013	17.999	17.649	18.149	0					7	4	3	0	0	0	0.029885	1	10929	10929		50.786	24.804	1	43949000			2695	548	1558	1634	3643	3643	394;395	9606
TVDPTEAAQAGGLDEDGKGPEQNPAEHKPSVIVTR	35	Unmodified	_TVDPTEAAQAGGLDEDGKGPEQNPAEHKPSVIVTR_			0	0	2	Q6PJG2	Q6PJG2	Q6PJG2	ELMSAN1	ELM2 and SANT domain-containing protein 1	MULTI-MSMS	DP1141_8	3	723.8734130859375	5	723.560396	3612.7656	0.0059667	4.3172E-06	-0.35433	-0.00025638	-0.34836	-0.00025206	723.7609333513934	16.923	0.34167	16.923	16.731	17.073	0					6	3	2	0	0	0	2.1132E-06	1	9014	9014		48.831	34.125	1	18268000			2696	432	1559	1635	3644	3644		9606
TVEGAGSIAAATGFVK	16	Unmodified	_TVEGAGSIAAATGFVK_			0	0	0	P37840	P37840	P37840	SNCA	Alpha-synuclein	MULTI-SECPEP	DP1141_10	5	739.3682861328125	2	739.896106	1477.77766	1.1977	0.00088615	-0.22496	-0.00016645	0.9727	0.0007197	739.8957373254025	19.227	0.49913	19.227	18.977	19.476	0					8	4	3	0	0	0	1.1492E-23	1	13198	13198		152.96	127.57	1	12377000			2697	214	1560	1636	3645	3645		9606
TVEGVLIVHEHR	12	Unmodified	_TVEGVLIVHEHR_			0	0	0	O43809	O43809	O43809	NUDT21	Cleavage and polyadenylation specificity factor subunit 5	MULTI-MSMS	DP1141_10	5	463.5929870605469	3	463.593009	1387.7572	0.097552	4.5225E-05	0.13018	6.035E-05	0.22773	0.00010557	463.5931038852256	16.016	0.67902	16.016	15.781	16.46	0					20	6	5	0	0	0	0.0021812	1	8020	8020		145.23	97.332	1	219400000			2698	61	1561	1637	3646	3646		9606
TVEGVLIVHEHR	12	Unmodified	_TVEGVLIVHEHR_			0	0	0	O43809	O43809	O43809	NUDT21	Cleavage and polyadenylation specificity factor subunit 5	MULTI-MSMS	DP1141_10	5	694.8861694335938	2	694.885875	1387.7572	0.80647	0.00056041	-0.1212	-8.4222E-05	0.68527	0.00047618	694.8858159306437	16.016	0.2846	16.016	15.781	16.066	0					6	2	3	0	0	0	0.0049663	1	8090	8090		113.93	78.415	1	28474000			2699	61	1561	1637	3647	3647		9606
TVELSIPADPANLDSEAK	18	Unmodified	_TVELSIPADPANLDSEAK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	935.9778442382812	2	935.475645	1868.93674	0.14492	0.00013557	0.12273	0.00011481	0.26764	0.00025037	935.4757856501539	19.856	0.785	19.856	19.506	20.291	0					24	7	5	0	0	0	5.3779E-58	4	13200	12876;13200;13230;13556		192.4	148.44	1	542160000			2700	367	1562	1638	3648;3649;3650;3651	3649		9606
TVELSIPADPANLDSEAK	18	Unmodified	_TVELSIPADPANLDSEAK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_8	3	934.9484252929688	2	935.475645	1868.93674	0.28235	0.00026413	0.43374	0.00040576	0.7161	0.00066989	935.4760351905003	19.827	0.40059	19.827	19.576	19.976	0					5	3	2	0	0	0	3.6253E-10	1	13629	13629		124.07	101.75	1	58918000			2701	367	1562	1638	3652	3652		9606
TVELSIPADPANLDSEAK	18	Unmodified	_TVELSIPADPANLDSEAK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_9	4	935.9773559570312	2	935.475645	1868.93674	0.76681	0.00071733	-0.40033	-0.0003745	0.36648	0.00034284	935.475214063497	19.888	0.39824	19.888	19.639	20.037	0					9	3	4	0	0	0	0.00060658	1	13703	13703		145.1	109.43	1	42960000			2702	367	1562	1638	3653	3653		9606
TVFAEHISDECKR	13	Unmodified	_TVFAEHISDECKR_			0	0	1	P39023	P39023	P39023	RPL3	60S ribosomal protein L3	MULTI-MSMS	DP1141_6	1	531.2687377929688	3	531.255957	1590.74604	0.19408	0.0001031	-0.19216	-0.00010208	0.0019181	1.019E-06	531.2559285646375	15.358	0.30195	15.358	15.209	15.51	0					6	2	3	0	0	0	0.0023489	1	6010	6010		119.74	87.128	1	8300600			2703	219	1563	1639	3654	3654		9606
TVGATALPR	9	Unmodified	_TVGATALPR_			0	0	0	P50990	P50990	P50990	CCT8	T-complex protein 1 subunit theta	MULTI-MSMS	DP1141_8	3	443.2612609863281	2	443.261259	884.507966	0.28729	0.00012734	-0.18646	-8.2648E-05	0.10083	4.4695E-05	443.2611216364384	15.42	0.403	15.42	15.172	15.575	0					5	3	2	0	0	0	0.007402	1	6754	6754		101.33	38.863	1	51512000			2704	257	1564	1640	3655	3655		9606
TVGIVGNQPK	10	Unmodified	_TVGIVGNQPK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_10	5	506.90008544921875	2	506.792924	1011.57129	0.20942	0.00010613	0.29321	0.0001486	0.50263	0.00025473	506.79303329838683	14.995	0.56157	14.995	14.806	15.368	0					12	6	3	0	0	0	0.0041685	1	6254	6254		124.08	52.203	1	17082000			2705	111	1565	1641	3656	3656		9606
TVGIVGNQPK	10	Unmodified	_TVGIVGNQPK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_6	1	506.7929992675781	2	506.792924	1011.57129	-0.41817	-0.00021193	0.79127	0.00040101	0.3731	0.00018909	506.7932758156007	14.958	0.50039	14.958	14.808	15.309	0					9	4	3	0	0	0	0.0050757	1	5513	5513		113.5	72.272	1	7608700			2706	111	1565	1641	3657	3657		9606
TVGIVGNQPK	10	Unmodified	_TVGIVGNQPK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	506.9010925292969	2	506.792924	1011.57129	0.71979	0.00036478	-0.23679	-0.00012	0.483	0.00024478	506.79275371930214	14.932	0.59804	14.932	14.772	15.37	0					14	5	3	0	0	0	0.0053888	3	5911	5911;5984;6132		122.18	73.079	1	54680000			2707	111	1565	1641	3658;3659;3660	3658		9606
TVGIVGNQPK	10	Unmodified	_TVGIVGNQPK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-SECPEP	DP1141_9	4	506.93255615234375	2	506.792924	1011.57129	0.0022523	1.1415E-06	0.87604	0.00044397	0.87829	0.00044511	506.7933864440768	14.933	0.67593	14.933	14.795	15.471	0					12	6	3	0	0	0	0.022718	1	5836	5836		76.774	18.544	1	8216500			2708	111	1565	1641	3661	3661		9606
TVINYDVAR	9	Unmodified	_TVINYDVAR_			0	0	0	Q86XP3	Q86XP3	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	MULTI-MSMS	DP1141_7	2	525.7827758789062	2	525.782556	1049.55056	0.3824	0.00020106	-0.045821	-2.4092E-05	0.33658	0.00017697	525.7824931510837	16.903	0.41104	16.903	16.738	17.149	0					11	4	4	0	0	0	0.0047811	1	9134	9134		110.12	48.158	1	233170000			2709	460	1566	1642	3662	3662		9606
TVLDPVTGDLSDTR	14	Unmodified	_TVLDPVTGDLSDTR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	744.8072509765625	2	744.880652	1487.74675	-0.063094	-4.6998E-05	0.93077	0.00069332	0.86768	0.00064632	744.8813301459307	18.855	0.5008	18.855	18.705	19.205	0					8	4	2	0	0	0	2.8241999999999997E-157	4	11605	11605;11758;11794;12181		236.69	185.25	1	168850000			2710	402	1567	1643	3663;3664;3665;3666	3663		9606
TVLDPVTGDLSDTR	14	Unmodified	_TVLDPVTGDLSDTR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_7	2	745.342041015625	2	744.880652	1487.74675	0.34186	0.00025464	0.30926	0.00023036	0.65111	0.000485	744.8809941884639	18.9	0.7006	18.9	18.65	19.35	0					13	6	3	0	0	0	2.2515999999999998E-40	1	12251	12251		184.36	135.3	1	202920000			2711	402	1567	1643	3667	3667		9606
TVLIMELINNVAK	13	Oxidation (M)	_TVLIM(Oxidation (M))ELINNVAK_	TVLIM(1)ELINNVAK	TVLIM(84)ELINNVAK	0	1	0	P06576	P06576	P06576	ATP5B	ATP synthase subunit beta, mitochondrial	MULTI-SECPEP	DP1141_10	5	737.8700561523438	2	737.420902	1472.82725	0.96956	0.00071497	-0.5955	-0.00043913	0.37406	0.00027584	737.4207106288727	22.309	0.48994	22.309	21.859	22.349	0					7	4	3	0	0	0	0.030763	1	17744	17744		83.869	40.218	1	4579200			2712	118	1568	1644	3668	3668	103	9606
TVNATGSSAAPGSSDKPSDPR	21	Unmodified	_TVNATGSSAAPGSSDKPSDPR_			0	0	1	Q9UPT8	Q9UPT8	Q9UPT8	ZC3H4	Zinc finger CCCH domain-containing protein 4	MULTI-MSMS	DP1141_8	3	667.9882202148438	3	667.987252	2000.93993	0.30903	0.00020643	0.23117	0.00015442	0.54021	0.00036085	667.9874094585209	13.849	0.30828	13.849	13.66	13.968	0					9	3	4	0	0	0	0.025495	1	4306	4306		51.31	27.257	1	8514700			2713	606	1569	1645	3669	3669		9606
TVQTAVFLYSLYK	13	Unmodified	_TVQTAVFLYSLYK_			0	0	0	Q14839	Q14839	Q14839	CHD4	Chromodomain-helicase-DNA-binding protein 4	MSMS	DP1141_7	2	766.8983154296875	2	766.921592	1531.82863	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.051	1	22.051	21.551	22.551	0								0	0	0	0.017602	1	17051	17051		118.9	83.727	1				2714	394	1570	1646	3670	3670		9606
TVTAAGAENIQQK	13	Unmodified	_TVTAAGAENIQQK_			0	0	0	Q29RF7	Q29RF7	Q29RF7	PDS5A	Sister chromatid cohesion protein PDS5 homolog A	MULTI-MSMS	DP1141_7	2	666.3333129882812	2	665.851698	1329.68884	0.033125	2.2056E-05	0.38909	0.00025908	0.42222	0.00028113	666.353162701538	14.658	0.30041	14.658	14.508	14.809	0					4	2	2	0	0	0	0.00065698	1	5627	5627		136.52	74.75	1	4920400			2715	415	1571	1647	3671	3671		9606
TVTAMDVVYALK	12	Unmodified	_TVTAMDVVYALK_			0	0	0	P62805	P62805	P62805	HIST1H4A	Histone H4	MULTI-MSMS	DP1141_10	5	655.85546875	2	655.854864	1309.69517	-0.032076	-2.1037E-05	0.88863	0.00058281	0.85656	0.00056178	655.8554838809458	21.326	0.48323	21.326	21.076	21.559	0					9	4	3	0	0	0	0.0050333	1	16469	16469		112.71	70.52	1	92975000			2716	303	1572	1648	3672	3672		9606
TVTAMDVVYALK	12	Unmodified	_TVTAMDVVYALK_			0	0	0	P62805	P62805	P62805	HIST1H4A	Histone H4	MULTI-MSMS	DP1141_6	1	656.6566162109375	2	655.854864	1309.69517	0.7458	0.00048914	-0.033691	-2.2096E-05	0.71211	0.00046704	655.8549820949562	21.335	0.33624	21.335	21.046	21.383	0					7	3	3	0	0	0	0.0044173	2	15423	15423;15477		119.68	90.984	1	7373000			2717	303	1572	1648	3673;3674	3673		9606
TVTAMDVVYALKR	13	Oxidation (M)	_TVTAM(Oxidation (M))DVVYALKR_	TVTAM(1)DVVYALKR	TVTAM(150)DVVYALKR	0	1	1	P62805	P62805	P62805	HIST1H4A	Histone H4	MSMS	DP1141_10	5	494.93780517578125	3	494.937676	1481.7912	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.929	1	18.929	18.429	19.429	0								0	0	0	8.3407E-10	1	12804	12804		145.23	118.99	1				2718	303	1573	1649	3675	3675	237	9606
TVTNAVVTVPAYFNDSQR	18	Unmodified	_TVTNAVVTVPAYFNDSQR_			0	0	0	P11142	P11142	P11142	HSPA8	Heat shock cognate 71 kDa protein	MULTI-MSMS	DP1141_8	3	992.0048217773438	2	991.502529	1980.9905	0.52422	0.00051977	0.05254	5.2094E-05	0.57676	0.00057186	991.5025367970238	19.926	0.70112	19.926	19.375	20.076	0					14	6	4	0	0	0	1.6201E-295	2	13752	13702;13752		315.43	254.79	1	145410000			2719	140	1574	1650	3676;3677	3677		9606
TVVLDLLR	8	Unmodified	_TVVLDLLR_			0	0	0	O00763	O00763	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	464.9454040527344	2	464.794935	927.575317	0.70173	0.00032616	-0.18445	-8.5729E-05	0.51729	0.00024043	464.79483464811193	20.732	0.28653	20.732	20.485	20.772	0					4	2	2	0	0	0	0.018358	1	14450	14450		101.28	42.303	1	4962000			2720	40	1575	1651	3678	3678		9606
TWNDPSVQQDIK	12	Unmodified	_TWNDPSVQQDIK_			0	0	0	P11021	P11021	P11021	HSPA5	78 kDa glucose-regulated protein	MULTI-MSMS	DP1141_8	3	715.8633422851562	2	715.849155	1429.68376	0.30005	0.00021479	0.27526	0.00019704	0.57531	0.00041183	715.8492064895702	17.524	0.40012	17.524	17.374	17.774	0					5	3	2	0	0	0	3.4811E-09	1	10098	10098		173.64	137.26	1	67834000			2721	139	1576	1652	3679	3679		9606
TYMDVMREQHLTKEER	16	2 Oxidation (M)	_TYM(Oxidation (M))DVM(Oxidation (M))REQHLTKEER_	TYM(1)DVM(1)REQHLTKEER	TYM(60)DVM(60)REQHLTKEER	0	2	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	525.4989624023438	4	525.247757	2096.96192	0.39548	0.00020772	-0.086825	-4.5604E-05	0.30865	0.00016212	525.498582894384	14.134	0.54709	14.134	13.861	14.408	0					10	5	4	0	0	0	0.0097677	1	4774	4774		59.634	44.38	1	19939000			2722	78	1577	1653	3680	3680	74;75	9606
TYMDVMREQHLTKEER	16	2 Oxidation (M)	_TYM(Oxidation (M))DVM(Oxidation (M))REQHLTKEER_	TYM(1)DVM(1)REQHLTKEER	TYM(60)DVM(60)REQHLTKEER	0	2	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	699.995361328125	3	699.994584	2096.96192	1.1969	0.00083785	-1.0661	-0.00074626	0.13084	9.1584E-05	699.9935559087547	14.094	0.36168	14.094	13.947	14.309	0					9	3	4	0	0	0	0.011808	1	4791	4791		59.634	29.098	1	6814300			2723	78	1577	1653	3681	3681	74;75	9606
TYMDVMREQHLTKEER	16	2 Oxidation (M)	_TYM(Oxidation (M))DVM(Oxidation (M))REQHLTKEER_	TYM(1)DVM(1)REQHLTKEER	TYM(49)DVM(49)REQHLTKEER	0	2	2	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	525.9213256835938	4	525.247757	2096.96192	-0.16436	-8.6327E-05	0.19188	0.00010078	0.027521	1.4455E-05	525.4986545090443	14.131	0.29972	14.131	13.968	14.268	0					10	3	4	0	0	0	0.021085	1	4583	4583		49.066	27.015	1	12054000			2724	78	1577	1653	3682	3682	74;75	9606
TYPGVMHSSCPQEMAAVK	18	2 Oxidation (M)	_TYPGVM(Oxidation (M))HSSCPQEM(Oxidation (M))AAVK_	TYPGVM(1)HSSCPQEM(1)AAVK	TYPGVM(76)HSSCPQEM(76)AAVK	0	2	0	O95372	O95372	O95372	LYPLA2	Acyl-protein thioesterase 2	MULTI-MSMS	DP1141_10	5	676.3020629882812	3	675.633999	2023.88017	0.11206	7.5708E-05	-0.26843	-0.00018136	-0.15637	-0.00010565	675.9683904749473	14.924	0.53208	14.924	14.667	15.199	0					20	6	5	0	0	0	0.0038902	2	6136	6136;6226		75.97	66.913	1	75463000			2725	90	1578	1654	3683;3684	3683	78;79	9606
TYPGVMHSSCPQEMAAVK	18	Oxidation (M)	_TYPGVMHSSCPQEM(Oxidation (M))AAVK_	TYPGVM(0.479)HSSCPQEM(0.521)AAVK	TYPGVM(-0.37)HSSCPQEM(0.37)AAVK	0	1	0	O95372	O95372	O95372	LYPLA2	Acyl-protein thioesterase 2	MULTI-MSMS	DP1141_10	5	670.3030395507812	3	670.302361	2007.88525	0.12902	8.6483E-05	0.19838	0.00013298	0.32741	0.00021946	670.6371897639174	15.796	0.73332	15.796	15.533	16.266	0					21	7	4	0	0	0	0.023328	1	7957	7957		52.254	33.392	2	26584000			2726	90	1578	1655	3685	3685	78;79	9606
TYQAIKDFNR	10	Unmodified	_TYQAIKDFNR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	628.8154296875	2	628.325119	1254.63569	0.70334	0.00044193	-0.13955	-8.7686E-05	0.56379	0.00035424	628.3250242143304	16.155	0.50022	16.155	16.005	16.505	0					9	4	3	0	0	0	0.014964	1	7240	7240		131.52	102.79	1	164310000			2727	367	1579	1656	3686	3686		9606
TYQAIKDFNR	10	Unmodified	_TYQAIKDFNR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	419.2633361816406	3	419.219172	1254.63569	0.15913	6.6712E-05	0.66964	0.00028072	0.82877	0.00034744	419.2194475721603	16.155	0.79224	16.155	15.613	16.405	0					11	7	3	0	0	0	0.022859	1	7255	7255		84.213	53.82	1	97627000			2728	367	1579	1656	3687	3687		9606
TYQGSYGFR	9	Unmodified	_TYQGSYGFR_			0	0	0	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MULTI-SECPEP	DP1141_10	5	539.8216552734375	2	539.751256	1077.48796	-0.54205	-0.00029257	0.95567	0.00051582	0.41361	0.00022325	539.7516824977146	16.893	0.29023	16.893	16.797	17.087	0					9	4	3	0	0	0	0.0011922	1	9501	9501		143.89	143.89	1	31102000			2729	104	1580	1657	3688	3688		9606
TYQGSYGFR	9	Unmodified	_TYQGSYGFR_			0	0	0	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MULTI-MSMS	DP1141_8	3	539.7513427734375	2	539.751256	1077.48796	0.33677	0.00018177	-0.075575	-4.0792E-05	0.26119	0.00014098	539.751129820414	16.878	0.4419	16.878	16.731	17.173	0					11	4	4	0	0	0	0.010269	1	9062	9062		90.37	72.108	1	240750000			2730	104	1580	1657	3689	3689		9606
TYQGSYGFR	9	Unmodified	_TYQGSYGFR_			0	0	0	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MULTI-MSMS	DP1141_9	4	539.7515258789062	2	539.751256	1077.48796	0.57778	0.00031186	-0.013839	-7.4696E-06	0.56394	0.00030439	539.7511859174741	16.906	0.44533	16.906	16.693	17.138	0					14	5	5	0	0	0	3.5656E-06	2	8961	8961;8972		153.78	130.01	1	186420000			2731	104	1580	1657	3690;3691	3690		9606
TYSYLTPDLWK	11	Unmodified	_TYSYLTPDLWK_			0	0	0	P15880	P15880	P15880	RPS2	40S ribosomal protein S2	MULTI-MSMS	DP1141_9	4	693.8113403320312	2	693.850635	1385.68672	0.27452	0.00019048	0.84931	0.0005893	1.1238	0.00077977	693.8508325328272	21.288	0.40055	21.288	21.037	21.438	0					8	3	3	0	0	0	0.0062642	3	15677	15677;15710;15865		123.21	83.955	1	9975300			2732	155	1581	1658	3692;3693;3694	3692		9606
TYTDELTPIESAVSVFK	17	Unmodified	_TYTDELTPIESAVSVFK_			0	0	0	O75489	O75489	O75489	NDUFS3	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial	MULTI-MSMS	DP1141_10	5	950.4820556640625	2	950.482939	1898.95133	0.47169	0.00044833	-0.40764	-0.00038746	0.064041	6.087E-05	950.4828631845544	22.836	0.34207	22.836	22.6	22.942	0					5	3	2	0	0	0	0.010769	1	18776	18776		107.53	84.517	1	3245100			2733	77	1582	1659	3695	3695		9606
VAALQNLVK	9	Unmodified	_VAALQNLVK_			0	0	0	Q14974	Q14974	Q14974	KPNB1	Importin subunit beta-1	MULTI-SECPEP	DP1141_7	2	477.5857849121094	2	478.300384	954.586216	0.59424	0.00028423	-0.029395	-1.406E-05	0.56485	0.00027017	478.3003448231661	17.799	0.39989	17.799	17.549	17.949	0					6	3	2	0	0	0	0.019419	1	10598	10598		89.369	30.554	1	15937000			2734	395	1583	1660	3696	3696		9606
VACIGAWHPAR	11	Unmodified	_VACIGAWHPAR_			0	0	0	P39023;Q92901	P39023	P39023	RPL3;RPL3L	60S ribosomal protein L3;60S ribosomal protein L3-like	MULTI-MSMS	DP1141_6	1	618.8834228515625	2	619.316574	1236.6186	0.38642	0.00023931	0.66484	0.00041175	1.0513	0.00065106	619.3170994109369	16.663	0.22432	16.663	16.505	16.729	0					4	2	2	0	0	0	0.023646	1	8106	8106		69.628	31.541	1	2535900			2735	219	1584	1661	3697	3697		9606
VACIGAWHPAR	11	Unmodified	_VACIGAWHPAR_			0	0	0	P39023;Q92901	P39023	P39023	RPL3;RPL3L	60S ribosomal protein L3;60S ribosomal protein L3-like	MULTI-MSMS	DP1141_6	1	413.2137756347656	3	413.213475	1236.6186	-0.20452	-8.4511E-05	0.9868	0.00040776	0.78228	0.00032325	413.21384900650327	16.67	0.22432	16.67	16.505	16.729	0					8	2	4	0	0	0	0.0039883	1	8124	8124		98.044	67.877	1	16422000			2736	219	1584	1661	3698	3698		9606
VADMALHYANK	11	Oxidation (M)	_VADM(Oxidation (M))ALHYANK_	VADM(1)ALHYANK	VADM(78)ALHYANK	0	1	0	P50990	P50990	P50990	CCT8	T-complex protein 1 subunit theta	MULTI-MSMS	DP1141_9	4	416.7251892089844	3	416.872895	1247.59686	0.3373	0.00014061	-0.21171	-8.8258E-05	0.12559	5.2353E-05	416.87269095786735	14.678	0.241	14.678	14.473	14.714	0					4	2	2	0	0	0	0.0069762	1	5323	5323		77.533	39.817	1	7163000			2737	257	1585	1662	3699	3699	206	9606
VAEIPFNSTNK	11	Unmodified	_VAEIPFNSTNK_			0	0	0	P13637;P50993;Q13733;P54707	P13637	P13637	ATP1A3;ATP1A2;ATP1A4;ATP12A	Sodium/potassium-transporting ATPase subunit alpha-3;Sodium/potassium-transporting ATPase subunit alpha-2;Sodium/potassium-transporting ATPase subunit alpha-4;Potassium-transporting ATPase alpha chain 2	MULTI-SECPEP	DP1141_9	4	610.036865234375	2	610.319502	1218.62445	-0.12639	-7.7137E-05	2.1709	0.001325	2.0446	0.0012478	610.3213169899778	17.188	0.48081	17.188	16.957	17.437	0					5	4	2	0	0	0	0.010114	1	9338	9338		101.65	26.434	1	11219000			2738	147	1586	1663	3700	3700		9606
VAFGSLAANGPTTLVDK	17	Unmodified	_VAFGSLAANGPTTLVDK_			0	0	0	Q9UKX7	Q9UKX7	Q9UKX7	NUP50	Nuclear pore complex protein Nup50	MULTI-SECPEP	DP1141_8	3	830.7298583984375	2	830.948869	1659.88319	0.86359	0.0007176	-0.12401	-0.00010305	0.73958	0.00061455	831.4501239409379	19.726	0.30066	19.726	19.576	19.877	0					4	2	2	0	0	0	0.023808	1	13491	13491		78.615	35.112	1	12454000			2739	600	1587	1664	3701	3701		9606
VAISNPPQR	9	Unmodified	_VAISNPPQR_			0	0	0	Q15020	Q15020	Q15020	SART3	Squamous cell carcinoma antigen recognized by T-cells 3	MULTI-MSMS	DP1141_7	2	491.2423400878906	2	491.277441	980.540328	0.31312	0.00015383	0.33584	0.00016499	0.64896	0.00031882	491.2775388653407	14.358	0.28779	14.358	14.121	14.408	0					4	2	2	0	0	0	0.0056523	1	5026	5026		113.7	67.978	1	2240000			2740	398	1588	1665	3702	3702		9606
VAPAQPSEEGPGR	13	Unmodified	_VAPAQPSEEGPGR_			0	0	0	P23588	P23588	P23588	EIF4B	Eukaryotic translation initiation factor 4B	MULTI-MSMS	DP1141_8	3	647.8236694335938	2	647.822941	1293.63133	0.64173	0.00041573	-0.68558	-0.00044413	-0.043842	-2.8402E-05	647.8227644153902	14.086	0.38389	14.086	13.884	14.268	0					7	4	2	0	0	0	0.00033678	1	4600	4600		142	124.63	1	8077600			2741	184	1589	1666	3703	3703		9606
VAPEEHPVLLTEAPLNPK	18	Unmodified	_VAPEEHPVLLTEAPLNPK_			0	0	0	P60709;P63261	P60709;P63261	P60709	ACTB;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	MULTI-MSMS	DP1141_9	4	652.3609619140625	3	652.026319	1953.05713	0.82881	0.0005404	-0.098472	-6.4207E-05	0.73033	0.0004762	652.0261770010072	18.387	0.40031	18.387	18.037	18.437	0					11	3	5	0	0	0	0.031387	1	11372	11372		57.197	14.25	1	92714000			2742	277;318	1590	1667	3704	3704		9606
VAPSKWEAVDESELEAQAVTTSK	23	Unmodified	_VAPSKWEAVDESELEAQAVTTSK_			0	0	1	O15042	O15042	O15042	U2SURP	U2 snRNP-associated SURP motif-containing protein	MULTI-SECPEP	DP1141_7	2	825.428466796875	3	825.746498	2474.21766	0.28749	0.00023739	-0.089803	-7.4154E-05	0.19768	0.00016324	826.0808064735335	19.2	0.30053	19.2	18.95	19.25	0					6	2	3	0	0	0	6.9711E-19	1	12718	12718		118.08	99.456	1	36951000			2743	49	1591	1668	3705	3705		9606
VAPSWPESHSSADSASLAK	19	Unmodified	_VAPSWPESHSSADSASLAK_			0	0	0	Q7LBC6	Q7LBC6	Q7LBC6	KDM3B	Lysine-specific demethylase 3B	MULTI-MSMS	DP1141_7	2	642.8438110351562	3	642.977916	1925.91192	0.2899	0.0001864	-0.149	-9.5804E-05	0.1409	9.0594E-05	643.3119918048984	16.694	0.43828	16.694	16.515	16.953	0					6	5	2	0	0	0	0.010012	1	8829	8829		92.307	68.818	1	40890000			2744	447	1592	1669	3706	3706		9606
VASDSPKPALTLQQGQEFSAGGQNAENLCQFFK	33	Unmodified	_VASDSPKPALTLQQGQEFSAGGQNAENLCQFFK_			0	0	1	Q69YH5	Q69YH5	Q69YH5	CDCA2	Cell division cycle-associated protein 2	MSMS	DP1141_7	2	1189.9080810546875	3	1189.91061	3566.71	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.939	1	20.939	20.439	21.439	0								0	0	0	0.017906	1	15424	15424		48.085	33.709	1				2745	429	1593	1670	3707	3707		9606
VASGCLDINSSVK	13	Unmodified	_VASGCLDINSSVK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_10	5	675.8052368164062	2	675.340109	1348.66566	0.071321	4.8166E-05	-0.069934	-4.7229E-05	0.0013867	9.3651E-07	675.3399555066387	16.752	0.20573	16.752	16.591	16.797	0					6	2	3	0	0	0	3.4919E-52	2	9214	9214;9280		190.57	129.74	1	42513000			2746	111	1594	1671	3708;3709	3708		9606
VASGCLDINSSVK	13	Unmodified	_VASGCLDINSSVK_			0	0	0	P05166	P05166	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	674.9542846679688	2	675.340109	1348.66566	0.27419	0.00018517	0.18652	0.00012596	0.46071	0.00031114	675.3403173539137	16.732	0.33793	16.732	16.562	16.9	0					8	3	3	0	0	0	6.0607E-97	2	8789	8789;8832		212.72	165.12	1	47567000			2747	111	1594	1671	3710;3711	3710		9606
VASIQGRPQDTKPGVK	16	Unmodified	_VASIQGRPQDTKPGVK_			0	0	2	Q96EV2	Q96EV2	Q96EV2	RBM33	RNA-binding protein 33	MULTI-MSMS	DP1141_8	3	560.9848022460938	3	560.984566	1679.93187	-0.19521	-0.00010951	1.035	0.00058064	0.83982	0.00047113	560.9850158495003	13.548	0.35744	13.548	13.372	13.729	0					10	4	3	0	0	0	0.021189	1	3824	3824		73.022	42.964	1	2793900			2748	507	1595	1672	3712	3712		9606
VASLEESEGNKQDLK	15	Unmodified	_VASLEESEGNKQDLK_			0	0	1	Q07065	Q07065	Q07065	CKAP4	Cytoskeleton-associated protein 4	MULTI-MSMS	DP1141_8	3	549.7738647460938	3	549.612575	1645.81589	0.67893	0.00037315	-0.08358	-4.5937E-05	0.59535	0.00032721	549.9468557811907	14.822	0.52789	14.822	14.445	14.972	0					10	5	4	0	0	0	0.01315	1	5628	5628		160.56	101.33	1	15642000			2749	351	1596	1673	3713	3713		9606
VASSPVMVSNPATR	14	Oxidation (M)	_VASSPVM(Oxidation (M))VSNPATR_	VASSPVM(1)VSNPATR	VASSPVM(120)VSNPATR	0	1	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MULTI-MSMS	DP1141_6	1	716.3671264648438	2	716.366658	1430.71876	0.56262	0.00040305	0.19365	0.00013872	0.75627	0.00054177	716.3670877316686	15.758	0.59636	15.758	15.408	16.005	0					13	5	4	0	0	0	0.019627	2	6659	6470;6659		119.45	84.694	1	6480500			2750	259	1597	1674	3714;3715	3715	209	9606
VASSPVMVSNPATR	14	Oxidation (M)	_VASSPVM(Oxidation (M))VSNPATR_	VASSPVM(1)VSNPATR	VASSPVM(110)VSNPATR	0	1	0	P51610	P51610	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	MSMS	DP1141_7	2	716.36669921875	2	716.366658	1430.71876	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.814	1	15.814	15.314	16.314	0								0	0	0	0.0031133	1	7318	7318		113.61	76.053	1				2751	259	1597	1674	3716	3716	209	9606
VATVSLPR	8	Unmodified	_VATVSLPR_			0	0	0	CON__P00761	CON__P00761	CON__P00761			MULTI-MSMS	DP1141_10	5	421.7308349609375	2	421.758352	841.502152	0.38428	0.00016207	-0.8737	-0.00036849	-0.48942	-0.00020642	421.75833642730805	16.51	2.6056	16.51	15.781	18.387	0					54	29	4	0	0	0	7.4653E-14	7	8163	7937;8163;8255;8360;8762;8863;9148		162.31	64.833	1	9802800000		+	2752	8	1598	1675	3717;3718;3719;3720;3721;3722;3723	3718		
VATVSLPR	8	Unmodified	_VATVSLPR_			0	0	0	CON__P00761	CON__P00761	CON__P00761			MSMS	DP1141_6	1	421.7583923339844	2	421.758352	841.502152	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.192	1	16.192	15.692	16.692	0								0	0	0	0.035006	1	7285	7285		120.62	36.377	1			+	2753	8	1598	1675	3724	3724		
VATVSLPR	8	Unmodified	_VATVSLPR_			0	0	0	CON__P00761	CON__P00761	CON__P00761			MSMS	DP1141_6	1	421.7586975097656	2	421.758352	841.502152	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.261	1	16.261	15.761	16.761	0								0	0	0	9.7061E-08	1	7404	7404		147.69	56.708	1			+	2754	8	1598	1675	3725	3725		
VATVSLPR	8	Unmodified	_VATVSLPR_			0	0	0	CON__P00761	CON__P00761	CON__P00761			MSMS	DP1141_6	1	421.8941650390625	2	421.758352	841.502152	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.566	1	16.566	16.066	17.066	0								0	0	0	0.011147	1	7918	7918		133.81	52.516	1			+	2755	8	1598	1675	3726	3726		
VATVSLPR	8	Unmodified	_VATVSLPR_			0	0	0	CON__P00761	CON__P00761	CON__P00761			MULTI-MSMS	DP1141_7	2	421.7584228515625	2	421.758352	841.502152	0.61942	0.00026125	-1.1011	-0.00046439	-0.48165	-0.00020314	421.7582202476705	16.465	2.0344	16.465	15.714	17.749	0					59	21	5	0	0	0	1.7149E-09	5	8229	7934;8069;8229;8398;8782		157.21	71.849	1	10105000000		+	2756	8	1598	1675	3727;3728;3729;3730;3731	3729		
VATVSLPR	8	Unmodified	_VATVSLPR_			0	0	0	CON__P00761	CON__P00761	CON__P00761			MULTI-MSMS	DP1141_8	3	421.7585144042969	2	421.758352	841.502152	-0.11789	-4.9722E-05	-0.28744	-0.00012123	-0.40533	-0.00017095	421.7585444551032	16.513	1.6981	16.513	15.876	17.574	0					46	17	5	0	0	0	6.285E-21	5	8065	7809;7921;8065;8242;8662		172.03	64.714	1	7452399999.999999		+	2757	8	1598	1675	3732;3733;3734;3735;3736	3734		
VATVSLPR	8	Unmodified	_VATVSLPR_			0	0	0	CON__P00761	CON__P00761	CON__P00761			MULTI-MSMS	DP1141_9	4	422.5450439453125	2	421.758352	841.502152	0.15774	6.6528E-05	-0.55846	-0.00023554	-0.40072	-0.00016901	421.75843963842493	16.508	2.2644	16.508	15.772	18.037	0					53	24	5	0	0	0	1.0237E-05	5	8049	8049;8147;8301;8515;8829		143.11	54.464	1	9593700000		+	2758	8	1598	1675	3737;3738;3739;3740;3741	3737		
VATWFNQPAR	10	Unmodified	_VATWFNQPAR_			0	0	0	P26373	P26373	P26373	RPL13	60S ribosomal protein L13	MULTI-MSMS	DP1141_10	5	595.3094482421875	2	595.309272	1188.60399	0.78347	0.00046641	-0.33741	-0.00020086	0.44607	0.00026555	595.3090851616469	18.637	0.38965	18.637	18.387	18.777	0					5	3	2	0	0	0	0.0026424	1	12495	12495		127.46	74.676	1	89572000			2759	188	1599	1676	3742	3742		9606
VAVCDIPPR	9	Unmodified	_VAVCDIPPR_			0	0	0	Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	Q13509	Q13509	TUBB3;TUBB1	Tubulin beta-3 chain;Tubulin beta-1 chain	MULTI-MSMS	DP1141_8	3	513.7737426757812	2	513.773677	1025.5328	0.2715	0.00013949	-1.0189	-0.00052347	-0.74738	-0.00038398	513.773546585799	15.89	0.70165	15.89	15.575	16.276	0					12	6	3	0	0	0	0.0047407	2	7470	7384;7470		109.86	82.732	1	8345500			2760	376	1600	1677	3743;3744	3744		9606
VAYVSFGPHAGK	12	Unmodified	_VAYVSFGPHAGK_			0	0	0	P50914	P50914	P50914	RPL14	60S ribosomal protein L14	MULTI-MSMS	DP1141_10	5	412.2102355957031	3	411.552262	1231.63496	0.3436	0.00014141	-0.086494	-3.5597E-05	0.25711	0.00010581	411.5521387881181	16.687	0.26657	16.687	16.46	16.727	0					9	3	3	0	0	0	0.0027099	2	9119	9119;9154		110.84	93.099	1	49493000			2761	256	1601	1678	3745;3746	3745		9606
VCNPIITK	8	Unmodified	_VCNPIITK_			0	0	0	P11142	P11142	P11142	HSPA8	Heat shock cognate 71 kDa protein	MULTI-MSMS	DP1141_8	3	472.7654113769531	2	472.76532	943.516088	0.34653	0.00016383	-0.34972	-0.00016534	-0.0031895	-1.5079E-06	472.7651495882573	15.726	0.60507	15.726	15.271	15.876	0					10	5	3	0	0	0	0.014512	1	7085	7085		90.37	18.992	1	201790000			2762	140	1602	1679	3747	3747		9606
VDDEPMDVDKGPGSTK	16	Oxidation (M)	_VDDEPM(Oxidation (M))DVDKGPGSTK_	VDDEPM(1)DVDKGPGSTK	VDDEPM(140)DVDKGPGSTK	0	1	1	Q13123	Q13123	Q13123	IK	Protein Red	MULTI-MSMS	DP1141_8	3	569.592041015625	3	569.257691	1704.75125	-0.42816	-0.00024373	0.81132	0.00046185	0.38316	0.00021812	569.2581930630386	14.196	0.3853	14.196	13.968	14.354	0					10	4	3	0	0	0	0.0055416	1	4768	4768		137.21	102.76	1	12576000			2763	368	1603	1680	3748	3748	289	9606
VDDEPMDVDKGPGSTK	16	Oxidation (M)	_VDDEPM(Oxidation (M))DVDKGPGSTK_	VDDEPM(1)DVDKGPGSTK	VDDEPM(84)DVDKGPGSTK	0	1	1	Q13123	Q13123	Q13123	IK	Protein Red	MULTI-MSMS	DP1141_9	4	569.9264526367188	3	569.257691	1704.75125	0.12923	7.3567E-05	0.27174	0.00015469	0.40097	0.00022826	569.5918786156324	14.199	0.43522	14.199	13.877	14.312	0					12	6	4	0	0	0	0.015643	1	4639	4639		83.856	55.423	1	4213700			2764	368	1603	1680	3749	3749	289	9606
VDLLNQEIEFLK	12	Unmodified	_VDLLNQEIEFLK_			0	0	0	CON__P35908v2;CON__P35908;P35908	CON__P35908v2	CON__P35908v2	KRT2	Keratin, type II cytoskeletal 2 epidermal	MULTI-MSMS	DP1141_6	1	731.4057006835938	2	730.903399	1459.79225	0.70886	0.00051811	0.052187	3.8143E-05	0.76105	0.00055625	730.9033386061044	22.336	0.16207	22.336	22.202	22.365	0					4	2	2	0	0	0	5.6349E-96	1	17036	17036		211.86	158.18	1	20299000		+	2765	20	1604	1681	3750	3750		9606
VDLLNQEIEFLK	12	Unmodified	_VDLLNQEIEFLK_			0	0	0	CON__P35908v2;CON__P35908;P35908	CON__P35908v2	CON__P35908v2	KRT2	Keratin, type II cytoskeletal 2 epidermal	MULTI-MSMS	DP1141_7	2	730.9039916992188	2	730.903399	1459.79225	0.35884	0.00026228	0.36729	0.00026846	0.72614	0.00053073	730.9036397210862	22.35	0.42609	22.35	22.146	22.572	0					9	4	4	0	0	0	1.3437999999999998E-52	2	17512	17512;17530		194.94	129.63	1	72153000		+	2766	20	1604	1681	3751;3752	3751		9606
VDLLNQEIEFLK	12	Unmodified	_VDLLNQEIEFLK_			0	0	0	CON__P35908v2;CON__P35908;P35908	CON__P35908v2	CON__P35908v2	KRT2	Keratin, type II cytoskeletal 2 epidermal	MULTI-SECPEP	DP1141_9	4	731.3814697265625	2	730.903399	1459.79225	0.37034	0.00027068	0.28486	0.0002082	0.65519	0.00047888	730.9036074315912	22.314	0.22466	22.314	22.205	22.43	0					4	2	2	0	0	0	3.7659000000000005E-30	1	17348	17348		190.57	136.97	1	23911000		+	2767	20	1604	1681	3753	3753		9606
VDNEFLNMLLDK	12	Oxidation (M)	_VDNEFLNM(Oxidation (M))LLDK_	VDNEFLNM(1)LLDK	VDNEFLNM(79)LLDK	0	1	0	Q8IX01	Q8IX01	Q8IX01	SUGP2	SURP and G-patch domain-containing protein 2	MULTI-SECPEP	DP1141_7	2	734.4168090820312	2	733.863417	1465.71228	0.45461	0.00033362	0.63206	0.00046384	1.0867	0.00079746	734.3651000939418	22.195	0.29327	22.195	21.948	22.241	0					4	2	2	0	0	0	0.008566	1	17036	17036		78.903	38.966	1	13357000			2768	464	1605	1682	3754	3754	345	9606
VDNSSLTGESEPQTR	15	Unmodified	_VDNSSLTGESEPQTR_			0	0	0	P05023;P13637;P50993;P20648	P05023;P13637;P20648	P13637	ATP1A1;ATP1A3;ATP1A2;ATP4A	Sodium/potassium-transporting ATPase subunit alpha-1;Sodium/potassium-transporting ATPase subunit alpha-3;Sodium/potassium-transporting ATPase subunit alpha-2;Potassium-transporting ATPase alpha chain 1	MULTI-MSMS	DP1141_6	1	810.3794555664062	2	810.379005	1618.74346	-0.13418	-0.00010873	0.67493	0.00054695	0.54075	0.00043822	810.3795788442571	15.259	0.30002	15.259	15.108	15.408	0					8	2	4	0	0	0	0.00013139	2	5963	5963;5983		147.24	104.9	1	19515000			2769	147;106;172	1606	1683	3755;3756	3755		9606
VDNSSLTGESEPQTR	15	Unmodified	_VDNSSLTGESEPQTR_			0	0	0	P05023;P13637;P50993;P20648	P05023;P13637;P20648	P13637	ATP1A1;ATP1A3;ATP1A2;ATP4A	Sodium/potassium-transporting ATPase subunit alpha-1;Sodium/potassium-transporting ATPase subunit alpha-3;Sodium/potassium-transporting ATPase subunit alpha-2;Potassium-transporting ATPase alpha chain 1	MSMS	DP1141_8	3	810.3793334960938	2	810.379005	1618.74346	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.377	1	15.377	14.877	15.877	0								0	0	0	0.01468	1	6521	6521		105.14	63.856	1				2770	147;106;172	1606	1683	3757	3757		9606
VDNSSLTGESEPQTR	15	Unmodified	_VDNSSLTGESEPQTR_			0	0	0	P05023;P13637;P50993;P20648	P05023;P13637;P20648	P13637	ATP1A1;ATP1A3;ATP1A2;ATP4A	Sodium/potassium-transporting ATPase subunit alpha-1;Sodium/potassium-transporting ATPase subunit alpha-3;Sodium/potassium-transporting ATPase subunit alpha-2;Potassium-transporting ATPase alpha chain 1	MULTI-MSMS	DP1141_9	4	810.3792724609375	2	810.379005	1618.74346	0.098133	7.9525E-05	0.47522	0.00038511	0.57335	0.00046463	810.3792771856323	15.224	0.29666	15.224	15.075	15.372	0					6	2	3	0	0	0	0.0015406	2	6364	6275;6364		135.04	86.044	1	9075900			2771	147;106;172	1606	1683	3758;3759	3759		9606
VDPVYIHLAER	11	Unmodified	_VDPVYIHLAER_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MSMS	DP1141_6	1	437.9067687988281	3	437.906705	1310.69829	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.167	1	18.167	17.667	18.667	0								0	0	0	0.0044866	1	10535	10535		110.08	67.741	1				2772	367	1607	1684	3760	3760		9606
VDSGIQPGSDISIYYDPMISK	21	Oxidation (M)	_VDSGIQPGSDISIYYDPM(Oxidation (M))ISK_	VDSGIQPGSDISIYYDPM(1)ISK	VDSGIQPGSDISIYYDPM(96)ISK	0	1	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_6	1	1151.5538330078125	2	1151.05139	2300.08823	0.15503	0.00017844	0.22445	0.00025836	0.37948	0.0004368	1151.5532483917846	20.438	0.2911	20.438	20.291	20.582	0					8	2	4	0	0	0	0.0032515	1	14270	14270		96.489	60.68	1	7753700			2773	110	1608	1685	3761	3761	99	9606
VDSQYPPVQR	10	Unmodified	_VDSQYPPVQR_			0	0	0	P49790	P49790	P49790	NUP153	Nuclear pore complex protein Nup153	MULTI-MSMS	DP1141_7	2	595.29443359375	2	594.80402	1187.59349	0.14358	8.5404E-05	0.59714	0.00035518	0.74073	0.00044059	594.8040561075314	15.16	0.50249	15.16	15.009	15.512	0					6	4	2	0	0	0	0.03039	1	6189	6189		75.738	45.663	1	12607000			2774	252	1609	1686	3762	3762		9606
VDWQENDFSK	10	Unmodified	_VDWQENDFSK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	634.2835693359375	2	634.283117	1266.55168	1.4253	0.00090406	-0.81346	-0.00051596	0.61187	0.0003881	634.2826186094785	18.155	0.69953	18.155	18.005	18.705	0					12	6	3	0	0	0	0.0021007	3	10680	10563;10680;11257		131.11	109.81	1	258090000			2775	367	1610	1687	3763;3764;3765	3764		9606
VDWQENDFSKR	11	Unmodified	_VDWQENDFSKR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	475.54608154296875	3	475.224874	1422.65279	0.15175	7.2117E-05	0.72472	0.0003444	0.87647	0.00041652	475.22517753717443	17.153	0.37987	17.153	16.824	17.204	0					5	4	2	0	0	0	0.0034286	1	8804	8804		114.89	70.28	1	65969000			2776	367	1611	1688	3766	3766		9606
VDWQENDFSKR	11	Unmodified	_VDWQENDFSKR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	475.59442138671875	3	475.224874	1422.65279	0.77613	0.00036884	-0.44895	-0.00021335	0.32719	0.00015549	475.2246593394544	17.099	0.35683	17.099	16.892	17.249	0					5	3	2	0	0	0	0.0047577	1	9452	9452		100.88	73.729	1	42034000			2777	367	1611	1688	3767	3767		9606
VEAKPEVQSQPPR	13	Unmodified	_VEAKPEVQSQPPR_			0	0	1	Q9UN86	Q9UN86	Q9UN86	G3BP2	Ras GTPase-activating protein-binding protein 2	MSMS	DP1141_8	3	488.9320068359375	3	488.93169	1463.77324	NaN	NaN	NaN	NaN	NaN	NaN	NaN	13.631	1	13.631	13.131	14.131	0								0	0	0	1.7321E-15	1	3917	3917		169.58	98.895	1				2778	604	1612	1689	3768	3768		9606
VEAKPEVQSQPPR	13	Unmodified	_VEAKPEVQSQPPR_			0	0	1	Q9UN86	Q9UN86	Q9UN86	G3BP2	Ras GTPase-activating protein-binding protein 2	MSMS	DP1141_8	3	488.9319763183594	3	488.93169	1463.77324	NaN	NaN	NaN	NaN	NaN	NaN	NaN	13.696	1	13.696	13.196	14.196	0								0	0	0	0.012233	1	4002	4002		114.87	52.402	1				2779	604	1612	1689	3769	3769		9606
VEAKPEVQSQPPR	13	Unmodified	_VEAKPEVQSQPPR_			0	0	1	Q9UN86	Q9UN86	Q9UN86	G3BP2	Ras GTPase-activating protein-binding protein 2	MULTI-MSMS	DP1141_9	4	489.26654052734375	3	488.93169	1463.77324	0.097825	4.783E-05	-0.13618	-6.6581E-05	-0.038352	-1.8751E-05	488.93175466379034	13.564	0.5115	13.564	13.299	13.81	0					11	6	2	0	0	0	0.0021585	2	3698	3698;3724		132.5	79.489	1	1337100			2780	604	1612	1689	3770;3771	3770		9606
VEEQEPELTSTPNFVVEVIK	20	Unmodified	_VEEQEPELTSTPNFVVEVIK_			0	0	0	Q07021	Q07021	Q07021	C1QBP	Complement component 1 Q subcomponent-binding protein, mitochondrial	MULTI-MSMS	DP1141_10	5	1144.5908203125	2	1144.08883	2286.16311	0.53909	0.00061677	-0.1147	-0.00013122	0.4244	0.00048555	1144.5902636235112	21.609	0.29986	21.609	21.459	21.759	0					10	2	5	0	0	0	4.4995E-19	2	16996	16996;17010		166.64	113.27	1	47665000			2781	350	1613	1690	3772;3773	3772		9606
VEEQEPELTSTPNFVVEVIKNDDGKK	26	Unmodified	_VEEQEPELTSTPNFVVEVIKNDDGKK_			0	0	2	Q07021	Q07021	Q07021	C1QBP	Complement component 1 Q subcomponent-binding protein, mitochondrial	MULTI-MSMS	DP1141_10	5	736.875732421875	4	736.875104	2943.47131	1.1731	0.00086446	-0.99743	-0.00073498	0.17571	0.00012948	737.3751026471624	20.426	0.69975	20.426	19.776	20.476	0					19	6	5	0	0	0	4.2987E-14	2	15043	15043;15118		146.45	128.15	1	54746000			2782	350	1614	1691	3774;3775	3774		9606
VEGPGSLGLEESGSR	15	Unmodified	_VEGPGSLGLEESGSR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_10	5	737.36328125	2	737.362627	1472.7107	0.18278	0.00013477	0.27266	0.00020105	0.45544	0.00033582	737.3628648889635	17.438	0.50051	17.438	17.087	17.588	0					13	4	4	0	0	0	3.7126E-100	2	10407	10407;10556		215.04	183.75	1	248720000			2783	365	1615	1692	3776;3777	3776		9606
VEGPGSLGLEESGSR	15	Unmodified	_VEGPGSLGLEESGSR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_6	1	737.3634643554688	2	737.362627	1472.7107	0.20923	0.00015428	0.20954	0.00015451	0.41877	0.00030879	737.3628160149697	17.455	0.40126	17.455	17.204	17.605	0					9	3	3	0	0	0	1.6861E-100	1	9399	9399		216.91	181.26	1	119820000			2784	365	1615	1692	3778	3778		9606
VEGPGSLGLEESGSR	15	Unmodified	_VEGPGSLGLEESGSR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_7	2	737.36279296875	2	737.362627	1472.7107	0.55915	0.00041229	0.1424	0.000105	0.70155	0.0005173	737.3628344806099	17.499	0.40028	17.499	17.149	17.549	0					7	3	3	0	0	0	0.0069436	1	10123	10123		113.61	77.084	1	38936000			2785	365	1615	1692	3779	3779		9606
VEGPGSLGLEESGSR	15	Unmodified	_VEGPGSLGLEESGSR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	737.3842163085938	2	737.362627	1472.7107	0.63696	0.00046967	0.011448	8.4413E-06	0.6484	0.00047811	737.3627257122148	17.424	0.60134	17.424	17.073	17.674	0					15	5	4	0	0	0	6.9998E-42	2	9663	9663;9860		188.27	143.63	1	1060399999.9999999			2786	365	1615	1692	3780;3781	3780		9606
VEGPGSLGLEESGSR	15	Unmodified	_VEGPGSLGLEESGSR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	737.3630981445312	2	737.362627	1472.7107	0.40561	0.00029908	0.20679	0.00015248	0.6124	0.00045156	737.3628189468477	17.487	0.59036	17.487	17.047	17.638	0					14	5	5	0	0	0	1.9328E-83	2	9838	9838;9906		205.56	175.17	1	247690000			2787	365	1615	1692	3782;3783	3782		9606
VEGRPGASLPPLDLQALEK	19	Unmodified	_VEGRPGASLPPLDLQALEK_			0	0	1	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	664.34521484375	3	664.037107	1989.08949	0.25134	0.0001669	0.43027	0.00028571	0.6816	0.00045261	664.3717036893495	19.9	0.50042	19.9	19.75	20.251	0					20	4	6	0	0	0	1.7961E-06	2	13950	13950;14204		149.42	103.56	1	880280000			2788	142	1616	1693	3784;3785	3784		9606
VEGRPGASLPPLDLQALEK	19	Unmodified	_VEGRPGASLPPLDLQALEK_			0	0	1	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	995.552734375	2	995.552022	1989.08949	0.48645	0.00048428	0.29151	0.00029022	0.77796	0.0007745	995.5521990132005	19.9	0.40025	19.9	19.75	20.15	0					9	3	3	0	0	0	0.0040329	2	14031	14031;14038		127.05	82.433	1	87928000			2789	142	1616	1693	3786;3787	3786		9606
VEGRPGASLPPLDLQALEK	19	Unmodified	_VEGRPGASLPPLDLQALEK_			0	0	1	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	664.844482421875	3	664.037107	1989.08949	0.72414	0.00048085	0.1197	7.9482E-05	0.84383	0.00056034	664.3715198730728	19.926	0.39985	19.926	19.777	20.176	0					11	3	4	0	0	0	0.00047366	1	13800	13800		142.72	107.42	1	297320000			2790	142	1616	1693	3788	3788		9606
VEGRPGASLPPLDLQALEK	19	Unmodified	_VEGRPGASLPPLDLQALEK_			0	0	1	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_9	4	664.3720092773438	3	664.037107	1989.08949	1.0909	0.00072438	-0.42889	-0.0002848	0.66198	0.00043958	664.3712690892894	19.888	0.69776	19.888	19.539	20.237	0					17	6	5	0	0	0	0.026039	1	13852	13852		89.913	71.549	1	57818000			2791	142	1616	1693	3789	3789		9606
VEGTEPTTAFNLFVGNLNFNK	21	Unmodified	_VEGTEPTTAFNLFVGNLNFNK_			0	0	0	P19338	P19338	P19338	NCL	Nucleolin	MULTI-MSMS	DP1141_7	2	1157.083251953125	2	1156.58151	2311.14846	0.3932	0.00045477	0.11096	0.00012834	0.50416	0.00058311	1157.083157952977	23.395	0.20246	23.395	23.278	23.481	0					8	2	4	0	0	0	3.2351E-38	1	19160	19160		223.03	202.19	1	11635000			2792	171	1617	1694	3790	3790		9606
VEILANDQGNR	11	Unmodified	_VEILANDQGNR_			0	0	0	P17066;P48741	P17066	P17066	HSPA6;HSPA7	Heat shock 70 kDa protein 6;Putative heat shock 70 kDa protein 7	MULTI-MSMS	DP1141_8	3	614.8182373046875	2	614.817658	1227.62076	0.47502	0.00029205	-0.25785	-0.00015853	0.21717	0.00013352	614.817942716895	15.625	0.50561	15.625	15.37	15.876	0					11	4	4	0	0	0	1.0939999999999999E-66	2	6939	6888;6939		203.29	0	1	1958999999.9999998			2793	161	1618	1695	3791;3792	3792		9606
VEILANDQGNR	11	Unmodified	_VEILANDQGNR_			0	0	0	P17066;P48741	P17066	P17066	HSPA6;HSPA7	Heat shock 70 kDa protein 6;Putative heat shock 70 kDa protein 7	MULTI-SECPEP	DP1141_9	4	614.314453125	2	614.817658	1227.62076	0.10221	6.2843E-05	0.067179	4.1303E-05	0.16939	0.00010415	614.8177493464569	15.623	0.40086	15.623	15.372	15.772	0					8	3	3	0	0	0	9.8613E-44	1	6778	6778		208.03	0	1	145630000			2794	161	1618	1695	3793	3793		9606
VEITPESILSALSK	14	Unmodified	_VEITPESILSALSK_			0	0	0	Q5VT52	Q5VT52	Q5VT52	RPRD2	Regulation of nuclear pre-mRNA domain-containing protein 2	MULTI-MSMS	DP1141_7	2	743.9225463867188	2	743.921789	1485.82903	0.58825	0.00043761	0.22247	0.0001655	0.81072	0.00060311	743.921919231701	23.692	0.3934	23.692	23.414	23.808	0					9	4	3	0	0	0	5.2623999999999996E-67	3	19544	19491;19544;19577		187.31	159.13	1	49804000			2795	424	1619	1696	3794;3795;3796	3795		9606
VEQATKPSFESGR	13	Unmodified	_VEQATKPSFESGR_			0	0	1	P38159	P38159	P38159	RBMX	RNA-binding motif protein, X chromosome;RNA-binding motif protein, X chromosome, N-terminally processed	MSMS	DP1141_9	4	478.91864013671875	3	479.244045	1434.71031	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.365	1	14.365	13.865	14.865	0								0	0	0	0.012895	1	4830	4830		107.99	59.554	1				2796	215	1620	1697	3797	3797		9606
VEQTETPEMMEAR	13	2 Oxidation (M)	_VEQTETPEM(Oxidation (M))M(Oxidation (M))EAR_	VEQTETPEM(1)M(1)EAR	VEQTETPEM(96)M(96)EAR	0	2	0	P52701	P52701	P52701	MSH6	DNA mismatch repair protein Msh6	MSMS	DP1141_6	1	791.8406372070312	2	791.839813	1581.66507	NaN	NaN	NaN	NaN	NaN	NaN	NaN	13.874	1	13.874	13.374	14.374	0								0	0	0	0.0087584	1	3903	3903		96.229	72.625	1				2797	268	1621	1698	3798	3798	222;223	9606
VETQFQNGHYDK	12	Unmodified	_VETQFQNGHYDK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	489.2285461425781	3	489.228395	1464.66336	-0.2988	-0.00014618	0.62042	0.00030352	0.32162	0.00015734	489.2291028077813	14.758	1.1042	14.758	14.509	15.613	0					20	10	4	0	0	0	0.0011899	1	5078	5078		129.34	70.144	1	220560000			2798	367	1622	1699	3799	3799		9606
VETQFQNGHYDK	12	Unmodified	_VETQFQNGHYDK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_7	2	488.9185485839844	3	489.228395	1464.66336	0.04158	2.0342E-05	0.79484	0.00038886	0.83642	0.0004092	489.2287631034232	14.687	0.60114	14.687	14.508	15.109	0					9	5	3	0	0	0	0.0045723	1	5607	5607		89.189	40.108	1	9026900			2799	367	1622	1699	3800	3800		9606
VEVEEDGQLK	10	Unmodified	_VEVEEDGQLK_			0	0	0	O75190;Q8NHS0;P25686	O75190	O75190	DNAJB6;DNAJB8;DNAJB2	DnaJ homolog subfamily B member 6;DnaJ homolog subfamily B member 8;DnaJ homolog subfamily B member 2	MULTI-SECPEP	DP1141_10	5	572.7811889648438	2	573.287868	1144.56118	0.58149	0.00033336	1.167	0.00066903	1.7485	0.0010024	573.7904293207062	15.696	0.50119	15.696	15.28	15.781	0					6	5	2	0	0	0	0.029843	1	7505	7505		101.54	42.625	1	4199300			2800	70	1623	1700	3801	3801		9606
VEVGTEVTDYR	11	Unmodified	_VEVGTEVTDYR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	634.9859619140625	2	634.311874	1266.6092	0.6741	0.00042759	-0.56155	-0.0003562	0.11254	7.1389E-05	634.3119470109499	17.153	0.3693	17.153	16.935	17.304	0					7	3	3	0	0	0	3.9705E-30	3	8944	8873;8944;9030		175.91	113.45	1	1093300000			2801	367	1624	1701	3802;3803;3804	3803		9606
VEVYPVELLLVR	12	Unmodified	_VEVYPVELLLVR_			0	0	0	P51784	P51784	P51784	USP11	Ubiquitin carboxyl-terminal hydrolase 11	MULTI-MSMS	DP1141_7	2	715.0281982421875	2	714.926677	1427.8388	0.49644	0.00035492	0.080111	5.7273E-05	0.57655	0.00041219	714.9267826037792	23.394	0.28267	23.394	23.198	23.481	0					8	3	3	0	0	0	0.0028627	2	19060	19060;19114		120.45	63.537	1	8962500			2802	260	1625	1702	3805;3806	3805		9606
VEYLDDRNTFR	11	Unmodified	_VEYLDDRNTFR_			0	0	1	P04637	P04637	P04637	TP53	Cellular tumor antigen p53	MSMS	DP1141_9	4	713.8936157226562	2	714.349323	1426.68409	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.175	1	17.175	16.675	17.675	0								0	0	0	1.7984E-06	1	9403	9403		116.52	62.761	1				2803	104	1626	1703	3807	3807		9606
VFDYSEYWEGAR	12	Unmodified	_VFDYSEYWEGAR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MSMS	DP1141_6	1	761.3363647460938	2	761.335881	1520.65721	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.915	1	20.915	20.415	21.415	0								0	0	0	0.020081	1	14821	14821		104.43	86.099	1				2804	142	1627	1704	3808	3808		9606
VFDYSEYWEGAR	12	Unmodified	_VFDYSEYWEGAR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	761.3367919921875	2	761.335881	1520.65721	1.0436	0.00079451	0.19139	0.00014572	1.235	0.00094023	761.3360276039513	20.8	0.4994	20.8	20.551	21.05	0					12	4	5	0	0	0	3.1773999999999996E-66	2	15370	15370;15373		200.56	171.85	1	144700000			2805	142	1627	1704	3809;3810	3809		9606
VFLENVIR	8	Unmodified	_VFLENVIR_			0	0	0	P62805	P62805	P62805	HIST1H4A	Histone H4	MULTI-MSMS	DP1141_10	5	495.6050109863281	2	495.292559	988.570566	0.92313	0.00045722	-0.456	-0.00022586	0.46713	0.00023137	495.2924350314024	19.626	0.49983	19.626	19.376	19.876	0					7	4	2	0	0	0	1.0869E-14	1	13905	13905		167.82	115.19	1	951540000			2806	303	1628	1705	3811	3811		9606
VFLENVIR	8	Unmodified	_VFLENVIR_			0	0	0	P62805	P62805	P62805	HIST1H4A	Histone H4	MULTI-SECPEP	DP1141_6	1	494.803955078125	2	495.292559	988.570566	0.48936	0.00024238	0.051339	2.5428E-05	0.5407	0.0002678	495.2925355716255	19.656	2.4936	19.656	17.505	19.998	0					36	24	2	0	0	0	1.2027E-42	1	12858	12858		213.54	129.73	1	75292000			2807	303	1628	1705	3812	3812		9606
VFLIDLNSTHGTFLGHIR	18	Unmodified	_VFLIDLNSTHGTFLGHIR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	681.3751220703125	3	680.705691	2039.09524	0.59911	0.00040782	-0.21913	-0.00014916	0.37998	0.00025866	681.0397439226701	20.828	0.901	20.828	20.578	21.479	0					22	8	4	0	0	0	4.2902E-06	2	15078	15078;15811		198.95	112.4	1	797580000			2808	365	1629	1706	3813;3814	3813		9606
VFLIDLNSTHGTFLGHIR	18	Unmodified	_VFLIDLNSTHGTFLGHIR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	510.78125	4	510.781088	2039.09524	0.46511	0.00023757	-0.029753	-1.5197E-05	0.43535	0.00022237	511.031810868569	20.828	0.70066	20.828	20.477	21.178	0					15	6	4	0	0	0	0.00063973	2	15091	15091;15212		163.9	151.86	1	583880000			2809	365	1629	1706	3815;3816	3815		9606
VFLIDLNSTHGTFLGHIR	18	Unmodified	_VFLIDLNSTHGTFLGHIR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	511.031982421875	4	510.781088	2039.09524	-0.19801	-0.00010114	0.49342	0.00025203	0.29541	0.00015089	511.0321348511061	36.76	0.1686	36.76	36.733	36.902	0					9	4	3	0	0	0	0.023159	1	34229	34229		60.541	52.296	1	6033500			2810	365	1629	1706	3817	3817		9606
VFLIDLNSTHGTFLGHIR	18	Unmodified	_VFLIDLNSTHGTFLGHIR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	681.040283203125	3	680.705691	2039.09524	-0.13508	-9.195E-05	0.59055	0.00040199	0.45547	0.00031004	681.0403418058205	20.787	0.50114	20.787	20.636	21.138	0					8	4	2	0	0	0	0.0018144	1	15204	15204		181.97	166.46	1	254970000			2811	365	1629	1706	3818	3818		9606
VFLIDLNSTHGTFLGHIR	18	Unmodified	_VFLIDLNSTHGTFLGHIR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	1021.057373046875	2	1020.5549	2039.09524	0.06012	6.1356E-05	1.1329	0.0011561	1.193	0.0012175	1021.0574707462374	20.787	0.30083	20.787	20.636	20.937	0					6	2	3	0	0	0	0.027404	1	15260	15260		69.258	50.681	1	4532600			2812	365	1629	1706	3819	3819		9606
VFPGSTTEDYNLIVIER	17	Unmodified	_VFPGSTTEDYNLIVIER_			0	0	0	Q13263	Q13263	Q13263	TRIM28	Transcription intermediary factor 1-beta	MULTI-MSMS	DP1141_7	2	977.5049438476562	2	977.00183	1951.98911	0.6369	0.00062226	0.51316	0.00050136	1.1501	0.0011236	977.50374866338	21.104	0.69937	21.104	20.95	21.65	0					26	6	5	0	0	0	0.0016332	2	15818	15818;15870		161.25	106.91	1	37492000			2813	372	1630	1707	3820;3821	3820		9606
VFQPPPPPPPAPSGDAPAEKER	22	Unmodified	_VFQPPPPPPPAPSGDAPAEKER_			0	0	1	Q96SB3	Q96SB3	Q96SB3	PPP1R9B	Neurabin-2	MULTI-MSMS	DP1141_7	2	761.059326171875	3	761.05857	2280.15388	1.0259	0.00078075	-0.27287	-0.00020767	0.753	0.00057308	761.0589995837413	16.565	0.32318	16.565	16.415	16.738	0					9	3	3	0	0	0	0.0010836	1	8716	8716		95.622	71.823	1	10072000			2814	523	1631	1708	3822	3822		9606
VFQTEAELQEVISDLQSK	18	Unmodified	_VFQTEAELQEVISDLQSK_			0	0	0	Q92878	Q92878	Q92878	RAD50	DNA repair protein RAD50	MULTI-MSMS	DP1141_7	2	688.5989990234375	3	688.688032	2063.04227	0.72945	0.00050236	-0.15046	-0.00010362	0.57899	0.00039874	689.022409175157	23.396	0.36376	23.396	23.278	23.642	0					9	4	4	0	0	0	0.00010869	1	19066	19066		85.046	59.81	1	10288000			2815	497	1632	1709	3823	3823		9606
VFQTEAELQEVISDLQSK	18	Unmodified	_VFQTEAELQEVISDLQSK_			0	0	0	Q92878	Q92878	Q92878	RAD50	DNA repair protein RAD50	MULTI-MSMS	DP1141_7	2	1033.0299072265625	2	1032.52841	2063.04227	0.40914	0.00042245	0.27237	0.00028123	0.68151	0.00070368	1033.030511040533	23.393	0.34918	23.393	23.132	23.481	0					5	4	2	0	0	0	0.0074929	1	19165	19165		91.845	66.315	1	8966200			2816	497	1632	1709	3824	3824		9606
VGAAEIISR	9	Unmodified	_VGAAEIISR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_6	1	458.7585144042969	2	458.266542	914.51853	0.22115	0.00010135	-0.38205	-0.00017508	-0.1609	-7.3734E-05	458.26661894826447	16.355	0.5239	16.355	16.205	16.729	0					9	5	2	0	0	0	2.5198E-05	1	7590	7590		148.99	55.844	1	83406000			2817	78	1633	1710	3825	3825		9606
VGAAEIISR	9	Unmodified	_VGAAEIISR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-SECPEP	DP1141_8	3	458.7586669921875	2	458.266542	914.51853	-0.36656	-0.00016798	0.56271	0.00025787	0.19615	8.9887E-05	458.26675644374035	16.326	0.59357	16.326	15.876	16.469	0					6	5	2	0	0	0	2.6952E-26	1	8120	8120		166.68	56.559	1	124870000			2818	78	1633	1710	3826	3826		9606
VGAEDIEKTIK	11	Unmodified	_VGAEDIEKTIK_			0	0	1	O00300	O00300	O00300	TNFRSF11B	Tumor necrosis factor receptor superfamily member 11B	MULTI-SECPEP	DP1141_6	1	601.27880859375	2	601.834985	1201.65542	0.26534	0.00015969	0.91619	0.0005514	1.1815	0.00071109	601.8357397418617	15.753	0.39177	15.753	15.613	16.005	0					7	3	3	0	0	0	0.02183	1	6657	6657		77.318	47	1	28204000			2819	35	1634	1711	3827	3827		9606
VGINYQPPTVVPGGDLAK	18	Unmodified	_VGINYQPPTVVPGGDLAK_			0	0	0	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_10	5	912.9969482421875	2	912.996351	1823.97815	0.84536	0.00077181	-0.13214	-0.00012064	0.71322	0.00065117	913.4978429888799	19.426	0.59915	19.426	18.977	19.576	0					14	5	4	0	0	0	0.0014219	3	13702	13558;13702;13740		124.48	88.775	1	63585000			2820	321;442;322	1635	1712	3828;3829;3830	3829		9606
VGINYQPPTVVPGGDLAK	18	Unmodified	_VGINYQPPTVVPGGDLAK_			0	0	0	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_7	2	913.41552734375	2	912.996351	1823.97815	0.31761	0.00028998	0.045001	4.1086E-05	0.36261	0.00033106	913.497956527929	19.501	0.40032	19.501	19.15	19.551	0					7	3	3	0	0	0	1.1482E-06	1	13242	13242		153.75	110.95	1	42477000			2821	321;442;322	1635	1712	3831	3831		9606
VGINYQPPTVVPGGDLAK	18	Unmodified	_VGINYQPPTVVPGGDLAK_			0	0	0	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_8	3	912.9967651367188	2	912.996351	1823.97815	0.46446	0.00042405	-0.22491	-0.00020535	0.23955	0.0002187	912.9962306752604	19.426	0.70044	19.426	18.976	19.676	0					20	6	4	0	0	0	1.2929E-58	2	13084	12889;13084		196.02	148.18	1	297160000			2822	321;442;322	1635	1712	3832;3833	3833		9606
VGINYQPPTVVPGGDLAK	18	Unmodified	_VGINYQPPTVVPGGDLAK_			0	0	0	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	P68363;P68366;Q71U36	P68363	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	MULTI-MSMS	DP1141_9	4	913.4984130859375	2	912.996351	1823.97815	0.96099	0.00087738	-0.42989	-0.00039248	0.53111	0.0004849	913.4974787299194	19.489	0.50146	19.489	19.037	19.539	0					7	4	2	0	0	0	0.00092833	2	13156	13016;13156		131.79	82.813	1	237200000			2823	321;442;322	1635	1712	3834;3835	3835		9606
VGMVETNSQDRPVDDVK	17	Oxidation (M)	_VGM(Oxidation (M))VETNSQDRPVDDVK_	VGM(1)VETNSQDRPVDDVK	VGM(120)VETNSQDRPVDDVK	0	1	1	Q9Y3C6	Q9Y3C6	Q9Y3C6	PPIL1	Peptidyl-prolyl cis-trans isomerase-like 1	MULTI-MSMS	DP1141_10	5	635.6390380859375	3	635.638795	1903.89456	-0.67802	-0.00043097	0.98243	0.00062447	0.30442	0.0001935	635.6393565990243	14.769	0.29308	14.769	14.667	14.96	0					10	3	4	0	0	0	0.00036203	2	6098	6015;6098		115.09	80.577	1	49059000			2824	616	1636	1713	3836;3837	3837	424	9606
VGPATPSAQVGK	12	Unmodified	_VGPATPSAQVGK_			0	0	0	Q13428	Q13428	Q13428	TCOF1	Treacle protein	MULTI-MSMS	DP1141_7	2	556.3091430664062	2	556.308938	1110.60332	0.027299	1.5187E-05	0.62725	0.00034894	0.65455	0.00036413	556.3091872383292	14.658	0.49814	14.658	14.21	14.708	0					9	4	3	0	0	0	0.0018975	1	5399	5399		125.57	91.566	1	27072000			2825	373	1637	1714	3838	3838		9606
VGPEELPVVGQLLR	14	Unmodified	_VGPEELPVVGQLLR_			0	0	0	Q9NXF1	Q9NXF1	Q9NXF1	TEX10	Testis-expressed sequence 10 protein	MULTI-SECPEP	DP1141_7	2	752.9667358398438	2	753.437941	1504.86133	0.9549	0.00071946	-0.1232	-9.2822E-05	0.8317	0.00062664	753.4378786127328	22.195	0.3706	22.195	21.948	22.319	0					5	3	2	0	0	0	0.010898	1	17357	17357		84.31	45.557	1	3296300			2826	577	1638	1715	3839	3839		9606
VGVNGFGR	8	Unmodified	_VGVNGFGR_			0	0	0	P04406	P04406	P04406	GAPDH	Glyceraldehyde-3-phosphate dehydrogenase	MULTI-SECPEP	DP1141_9	4	403.5368347167969	2	403.219395	804.424236	0.10657	4.2972E-05	2.2287	0.00089864	2.3352	0.00094161	403.2198318062894	15.722	0.78691	15.722	15.471	16.258	0					13	7	3	0	0	0	0.01274	1	7775	7775		103.29	58.755	1	10537000			2827	103	1639	1716	3840	3840		9606
VHAALVYHK	9	Unmodified	_VHAALVYHK_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_7	2	519.2984619140625	2	519.298176	1036.5818	0.26034	0.0001352	0.23461	0.00012183	0.49495	0.00025703	519.2982312746668	13.578	0.29317	13.578	13.327	13.62	0					4	2	2	0	0	0	0.014152	1	3982	3982		88.029	62.202	1	1338200			2828	365	1640	1717	3841	3841		9606
VHAALVYHK	9	Unmodified	_VHAALVYHK_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	519.2984008789062	2	519.298176	1036.5818	0.053881	2.798E-05	-0.057305	-2.9758E-05	-0.0034232	-1.7777E-06	519.2980413045849	13.694	0.3636	13.694	13.52	13.884	0					13	4	4	0	0	0	2.8723E-05	1	4003	4003		148.21	113.01	1	17867000			2829	365	1640	1717	3842	3842		9606
VHAALVYHK	9	Unmodified	_VHAALVYHK_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	519.7998657226562	2	519.298176	1036.5818	0.072036	3.7408E-05	0.1886	9.7939E-05	0.26063	0.00013535	519.2982303614996	13.637	0.46574	13.637	13.474	13.94	0					10	6	2	0	0	0	0.0059958	2	3811	3811;3896		118.01	98.374	1	4767800			2830	365	1640	1717	3843;3844	3843		9606
VHAALVYHKHLK	12	Unmodified	_VHAALVYHKHLK_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_6	1	472.6141052246094	3	472.613856	1414.81974	0.43401	0.00020512	0.036398	1.7202E-05	0.4704	0.00022232	472.6139232986999	13.81	0.56672	13.81	13.488	14.054	0					11	6	2	0	0	0	0.033464	1	3796	3796		88.134	65.042	1	731820			2831	365	1641	1718	3845	3845		9606
VHAALVYHKHLK	12	Unmodified	_VHAALVYHKHLK_			0	0	1	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	472.6138000488281	3	472.613856	1414.81974	0.15857	7.4942E-05	0.038524	1.8207E-05	0.19709	9.3149E-05	472.6139034167966	13.548	0.99809	13.548	12.807	13.805	0					33	11	4	0	0	0	0.021019	1	3544	3544		99.53	99.53	1	3316100			2832	365	1641	1718	3846	3846		9606
VHAALVYHKHLKR	13	Unmodified	_VHAALVYHKHLKR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_6	1	524.9821166992188	3	524.64756	1570.92085	0.54777	0.00028739	-0.12398	-6.5044E-05	0.42379	0.00022234	524.6474800165137	13.855	0.74228	13.855	13.312	14.054	0					20	8	4	0	0	0	0.0075914	2	3715	3715;3795		90.913	63.241	1	723550			2833	365	1642	1719	3847;3848	3847		9606
VHAALVYHKHLKR	13	Unmodified	_VHAALVYHKHLKR_			0	0	2	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	524.6476440429688	3	524.64756	1570.92085	-0.013529	-7.0978E-06	0.35203	0.00018469	0.33851	0.0001776	524.9820557040014	13.581	1.2784	13.581	12.606	13.884	0					47	14	4	0	0	0	0.0083205	2	2982	2982;3097		115.57	106.68	1	4090200			2834	365	1642	1719	3849;3850	3849		9606
VHCCPHGAFCDLVHTR	16	Unmodified	_VHCCPHGAFCDLVHTR_			0	0	0	P28799	P28799	P28799	GRN	Granulins;Acrogranin;Paragranulin;Granulin-1;Granulin-2;Granulin-3;Granulin-4;Granulin-5;Granulin-6;Granulin-7	MULTI-MSMS	DP1141_10	5	492.5914306640625	4	492.221183	1964.85562	0.44631	0.00021968	-0.39743	-0.00019562	0.048874	2.4057E-05	492.22103325831785	16.216	0.29799	16.216	15.968	16.266	0					4	2	2	0	0	0	0.021776	1	8254	8254		52.862	41.543	1	17845000			2835	193	1643	1720	3851	3851		9606
VHIEIGPDGR	10	Unmodified	_VHIEIGPDGR_			0	0	0	P52597;P31943;P55795	P52597;P31943;P55795	P52597	HNRNPF;HNRNPH1;HNRNPH2	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H2	MULTI-MSMS	DP1141_10	5	547.296142578125	2	546.793455	1091.57236	0.33686	0.0001842	-0.025435	-1.3908E-05	0.31143	0.00017029	546.7934318469985	16.116	0.48995	16.116	15.873	16.363	0					7	4	2	0	0	0	0.025354	1	8261	8261		78.149	55.409	1	74407000			2836	266;200;272	1644	1721	3852	3852		9606
VHIEIGPDGR	10	Unmodified	_VHIEIGPDGR_			0	0	0	P52597;P31943;P55795	P52597;P31943;P55795	P52597	HNRNPF;HNRNPH1;HNRNPH2	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H2	MULTI-MSMS	DP1141_8	3	546.980712890625	2	546.793455	1091.57236	0.47943	0.00026215	0.0047618	2.6037E-06	0.48419	0.00026475	546.7934845883174	16.126	0.50043	16.126	15.876	16.376	0					7	4	2	0	0	0	2.7354E-13	1	7667	7667		163.15	131.92	1	88091000			2837	266;200;272	1644	1721	3853	3853		9606
VHIEIGPDGR	10	Unmodified	_VHIEIGPDGR_			0	0	0	P52597;P31943;P55795	P52597;P31943;P55795	P52597	HNRNPF;HNRNPH1;HNRNPH2	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H2	MULTI-MSMS	DP1141_9	4	546.9808959960938	2	546.793455	1091.57236	0.58372	0.00031917	-0.14282	-7.8096E-05	0.44089	0.00024108	546.7933681189063	16.108	0.58566	16.108	15.772	16.358	0					13	5	3	0	0	0	7.315299999999999E-21	2	7562	7562;7688		172.25	132.6	1	195660000			2838	266;200;272	1644	1721	3854;3855	3854		9606
VHIEIGPDGR	10	Unmodified	_VHIEIGPDGR_			0	0	0	P52597;P31943;P55795	P52597;P31943;P55795	P52597	HNRNPF;HNRNPH1;HNRNPH2	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H2	MSMS	DP1141_9	4	364.86468505859375	3	364.864729	1091.57236	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.277	1	16.277	15.777	16.777	0								0	0	0	0.025363	1	7908	7908		65.278	46.311	1				2839	266;200;272	1644	1721	3856	3856		9606
VHIGQVIMSIR	11	Oxidation (M)	_VHIGQVIM(Oxidation (M))SIR_	VHIGQVIM(1)SIR	VHIGQVIM(76)SIR	0	1	0	P27635;Q96L21	P27635	P27635	RPL10;RPL10L	60S ribosomal protein L10;60S ribosomal protein L10-like	MULTI-MSMS	DP1141_10	5	423.57635498046875	3	423.576302	1267.70708	-0.18894	-8.0028E-05	0.3176	0.00013453	0.12866	5.4499E-05	423.57646743540516	18.137	0.4998	18.137	17.688	18.187	0					10	4	4	0	0	0	0.0085588	1	11547	11547		75.566	51.715	1	64037000			2840	190	1645	1722	3857	3857	166	9606
VHLTPYTVDSPICDFLELQR	20	Unmodified	_VHLTPYTVDSPICDFLELQR_			0	0	0	Q8N163	Q8N163	Q8N163	CCAR2	Cell cycle and apoptosis regulator protein 2	MULTI-MSMS	DP1141_7	2	802.4076538085938	3	801.73862	2402.19403	0.64684	0.0005186	-0.32811	-0.00026306	0.31873	0.00025554	802.0726523652288	22.67	0.24199	22.67	22.486	22.728	0					8	2	4	0	0	0	2.5281E-37	1	18053	18053		176.68	152.67	1	17300000			2841	467	1646	1723	3858	3858		9606
VHNEGLPAPIVR	12	Unmodified	_VHNEGLPAPIVR_			0	0	0	CON__ENSEMBL:ENSBTAP00000024466;CON__ENSEMBL:ENSBTAP00000024462	CON__ENSEMBL:ENSBTAP00000024466	CON__ENSEMBL:ENSBTAP00000024466			MULTI-MSMS	DP1141_8	3	435.2397155761719	3	434.582333	1300.72517	-0.26307	-0.00011432	0.2807	0.00012199	0.017632	7.6626E-06	434.58248557221907	16.426	0.39356	16.426	16.076	16.469	0					9	3	4	0	0	0	0.011724	1	8179	8179		78.342	42.057	1	56560000		+	2842	7	1647	1724	3859	3859		
VHPAEPFTGELPAQQTLPILGEK	23	Unmodified	_VHPAEPFTGELPAQQTLPILGEK_			0	0	0	O00763	O00763	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	825.4457397460938	3	824.775951	2471.30603	0.92185	0.00076032	0.36515	0.00030117	1.287	0.0010615	825.1105151993847	20.532	0.39136	20.532	20.19	20.582	0					10	3	4	0	0	0	1.4559E-09	1	14302	14302		106.23	83.057	1	12589000			2843	40	1648	1725	3860	3860		9606
VIAGLYQR	8	Unmodified	_VIAGLYQR_			0	0	0	P78527	P78527	P78527	PRKDC	DNA-dependent protein kinase catalytic subunit	MULTI-MSMS	DP1141_6	1	460.2713928222656	2	460.271627	918.528701	0.078307	3.6043E-05	0.034423	1.5844E-05	0.11273	5.1886E-05	460.2715702154804	16.914	0.27498	16.914	16.729	17.004	0					6	3	2	0	0	0	0.010196	2	8524	8493;8524		103.28	48.752	1	14973000			2844	329	1649	1726	3861;3862	3862		9606
VIAGLYQR	8	Unmodified	_VIAGLYQR_			0	0	0	P78527	P78527	P78527	PRKDC	DNA-dependent protein kinase catalytic subunit	MULTI-MSMS	DP1141_7	2	460.2351989746094	2	460.271627	918.528701	0.74195	0.0003415	-0.59813	-0.0002753	0.14382	6.6195E-05	460.27137333681486	16.881	0.21517	16.881	16.738	16.953	0					4	2	2	0	0	0	0.0062657	1	9048	9048		114.54	61.188	1	22601000			2845	329	1649	1726	3863	3863		9606
VIEHIMEDLDTNADK	15	Oxidation (M)	_VIEHIM(Oxidation (M))EDLDTNADK_	VIEHIM(1)EDLDTNADK	VIEHIM(120)EDLDTNADK	0	1	0	P06702	P06702	P06702	S100A9	Protein S100-A9	MULTI-MSMS	DP1141_10	5	586.946044921875	3	586.945336	1757.81418	0.53579	0.00031448	0.20505	0.00012035	0.74083	0.00043483	586.9455725742017	16.606	0.18863	16.606	16.46	16.649	0					4	2	2	0	0	0	0.0014647	1	9067	9067		116.58	93.591	1	12383000			2846	119	1650	1727	3864	3864	104	9606
VIGLQIFNIDTDR	13	Unmodified	_VIGLQIFNIDTDR_			0	0	0	Q69YH5	Q69YH5	Q69YH5	CDCA2	Cell division cycle-associated protein 2	MULTI-MSMS	DP1141_7	2	753.4383544921875	2	752.411923	1502.80929	0.91722	0.00069012	-0.49581	-0.00037305	0.4214	0.00031707	752.4114350229353	22.295	0.25407	22.295	22.146	22.4	0					6	2	3	0	0	0	0.0045438	2	17457	17457;17542		115.57	83.731	1	6125200			2847	429	1651	1728	3865;3866	3865		9606
VIGSGCNLDSAR	12	Unmodified	_VIGSGCNLDSAR_			0	0	0	P07195;Q6ZMR3;P07864;P00338	P07195	P07195	LDHB;LDHAL6A;LDHC;LDHA	L-lactate dehydrogenase B chain;L-lactate dehydrogenase A-like 6A;L-lactate dehydrogenase C chain;L-lactate dehydrogenase A chain	MSMS	DP1141_6	1	624.798095703125	2	624.803694	1247.59283	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.611	1	15.611	15.111	16.111	0								0	0	0	4.2255E-15	1	6337	6337		147.95	89.271	1				2848	121	1652	1729	3867	3867		9606
VIHLSNLPHSGYSDSAVLK	19	Unmodified	_VIHLSNLPHSGYSDSAVLK_			0	0	0	P43243	P43243	P43243	MATR3	Matrin-3	MULTI-MSMS	DP1141_7	2	510.2924499511719	4	510.024549	2036.06909	0.12657	6.4555E-05	-0.79601	-0.00040599	-0.66944	-0.00034143	510.27462482361955	17.899	0.59966	17.899	17.45	18.049	0					6	5	2	0	0	0	0.010237	1	10635	10635		47	25.554	1	55569000			2849	229	1653	1730	3868	3868		9606
VIISAPSADAPMFVMGVNHEK	21	2 Oxidation (M)	_VIISAPSADAPM(Oxidation (M))FVM(Oxidation (M))GVNHEK_	VIISAPSADAPM(1)FVM(1)GVNHEK	VIISAPSADAPM(64)FVM(64)GVNHEK	0	2	0	P04406	P04406	P04406	GAPDH	Glyceraldehyde-3-phosphate dehydrogenase	MULTI-MSMS	DP1141_7	2	749.326904296875	3	749.037901	2244.09187	0.5918	0.00044328	-0.021003	-1.5732E-05	0.5708	0.00042755	749.3723465925178	18.41	0.30057	18.41	18.249	18.55	0					6	2	3	0	0	0	0.0035016	1	11543	11543		63.69	48.6	1	51741000			2850	103	1654	1731	3869	3869	86;87	9606
VIISAPSADAPMFVMGVNHEK	21	2 Oxidation (M)	_VIISAPSADAPM(Oxidation (M))FVM(Oxidation (M))GVNHEK_	VIISAPSADAPM(1)FVM(1)GVNHEK	VIISAPSADAPM(59)FVM(59)GVNHEK	0	2	0	P04406	P04406	P04406	GAPDH	Glyceraldehyde-3-phosphate dehydrogenase	MULTI-MSMS	DP1141_9	4	748.7110595703125	3	749.037901	2244.09187	0.54986	0.00041187	-0.51586	-0.0003864	0.033997	2.5465E-05	749.3718060185354	18.398	0.89963	18.398	17.837	18.737	0					15	8	4	0	0	0	0.0053871	1	11317	11317		58.835	45.286	1	35301000			2851	103	1654	1731	3870	3870	86;87	9606
VIISAPSADAPMFVMGVNHEK	21	Oxidation (M)	_VIISAPSADAPM(Oxidation (M))FVMGVNHEK_	VIISAPSADAPM(0.932)FVM(0.068)GVNHEK	VIISAPSADAPM(11)FVM(-11)GVNHEK	0	1	0	P04406	P04406	P04406	GAPDH	Glyceraldehyde-3-phosphate dehydrogenase	MULTI-MSMS	DP1141_9	4	744.6701049804688	3	743.706263	2228.09696	0.54232	0.00040333	-0.77487	-0.00057627	-0.23255	-0.00017295	743.705749272964	19.398	0.60176	19.398	18.937	19.539	0					12	5	3	0	0	0	0.017007	1	12705	12705		47.822	23.811	2	9973600			2852	103	1654	1732	3871	3871	86;87	9606
VIMVTGDHPITAK	13	Oxidation (M)	_VIM(Oxidation (M))VTGDHPITAK_	VIM(1)VTGDHPITAK	VIM(64)VTGDHPITAK	0	1	0	P05023;P13637;P50993;Q13733;P54707;P20648	P05023;P13637;P20648	P13637	ATP1A1;ATP1A3;ATP1A2;ATP1A4;ATP12A;ATP4A	Sodium/potassium-transporting ATPase subunit alpha-1;Sodium/potassium-transporting ATPase subunit alpha-3;Sodium/potassium-transporting ATPase subunit alpha-2;Sodium/potassium-transporting ATPase subunit alpha-4;Potassium-transporting ATPase alpha chain 2;Potassium-transporting ATPase alpha chain 1	MULTI-MSMS	DP1141_10	5	466.58685302734375	3	466.586755	1396.73844	0.038833	1.8119E-05	-0.0027717	-1.2932E-06	0.036061	1.6826E-05	466.5867849258558	15.56	0.24092	15.56	15.368	15.609	0					4	2	2	0	0	0	0.018278	1	7254	7254		63.966	38.074	1	37428000			2853	147;106;172	1655	1733	3872	3872	90	9606
VIMVTGDHPITAK	13	Oxidation (M)	_VIM(Oxidation (M))VTGDHPITAK_	VIM(1)VTGDHPITAK	VIM(54)VTGDHPITAK	0	1	0	P05023;P13637;P50993;Q13733;P54707;P20648	P05023;P13637;P20648	P13637	ATP1A1;ATP1A3;ATP1A2;ATP1A4;ATP12A;ATP4A	Sodium/potassium-transporting ATPase subunit alpha-1;Sodium/potassium-transporting ATPase subunit alpha-3;Sodium/potassium-transporting ATPase subunit alpha-2;Sodium/potassium-transporting ATPase subunit alpha-4;Potassium-transporting ATPase alpha chain 2;Potassium-transporting ATPase alpha chain 1	MULTI-MSMS	DP1141_6	1	466.92584228515625	3	466.586755	1396.73844	0.094686	4.4179E-05	0.76749	0.0003581	0.86218	0.00040228	466.5870919368165	15.563	0.29991	15.563	15.408	15.708	0					4	2	2	0	0	0	0.028318	1	6324	6324		53.947	30.433	1	41196000			2854	147;106;172	1655	1733	3873	3873	90	9606
VITEEEKNFK	10	Unmodified	_VITEEEKNFK_			0	0	1	P26373	P26373	P26373	RPL13	60S ribosomal protein L13	MULTI-MSMS	DP1141_10	5	412.8872375488281	3	412.887199	1235.63977	0.26719	0.00011032	-0.31435	-0.00012979	-0.047165	-1.9474E-05	412.8870447410111	14.843	0.21727	14.843	14.667	14.884	0					4	2	2	0	0	0	0.0064399	1	6139	6139		131.11	84.648	1	70376000			2855	188	1656	1734	3874	3874		9606
VITNFNSAHDTDR	13	Unmodified	_VITNFNSAHDTDR_			0	0	0	Q08188	Q08188	Q08188	TGM3	Protein-glutamine gamma-glutamyltransferase E;Protein-glutamine gamma-glutamyltransferase E 50 kDa catalytic chain;Protein-glutamine gamma-glutamyltransferase E 27 kDa non-catalytic chain	MULTI-MSMS	DP1141_8	3	496.9229431152344	3	497.239183	1488.69572	0.78891	0.00039228	0.19238	9.5661E-05	0.9813	0.00048794	497.23922541117787	15.166	0.39803	15.166	14.873	15.271	0					5	3	2	0	0	0	0.0027451	1	6016	6016		109.15	62.987	1	1948700			2856	356	1657	1735	3875	3875		9606
VIVSDVQESFIWVR	14	Unmodified	_VIVSDVQESFIWVR_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_7	2	839.4551391601562	2	838.953955	1675.89336	0.62122	0.00052118	-0.92113	-0.00077279	-0.29991	-0.00025161	839.4537958432412	22.043	0.39137	22.043	21.85	22.241	0					5	3	2	0	0	0	0.022129	1	17161	17161		75.229	38.558	1	6440400			2857	402	1658	1736	3876	3876		9606
VIVVGNPANTNCLTASK	17	Unmodified	_VIVVGNPANTNCLTASK_			0	0	0	P40925	P40925	P40925	MDH1	Malate dehydrogenase, cytoplasmic	MSMS	DP1141_10	5	879.398193359375	2	879.464361	1756.91417	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.809	1	17.809	17.309	18.309	0								0	0	0	8.82E-97	1	11003	11003		193.28	143.25	1				2858	222	1659	1737	3877	3877		9606
VKADRDESSPYAAMLAAQDVAQR	23	Oxidation (M)	_VKADRDESSPYAAM(Oxidation (M))LAAQDVAQR_	VKADRDESSPYAAM(1)LAAQDVAQR	VKADRDESSPYAAM(80)LAAQDVAQR	0	1	2	P62263	P62263	P62263	RPS14	40S ribosomal protein S14	MULTI-MSMS	DP1141_10	5	628.279296875	4	627.809139	2507.20745	-0.97343	-0.00061113	1.3839	0.00086885	0.4105	0.00025772	628.3115487801324	16.973	0.36017	16.973	16.727	17.087	0					12	5	4	0	0	0	0.0009964	1	9704	9704		79.942	57.834	1	33055000			2859	291	1660	1738	3878	3878	234	9606
VKDLVLSVHNR	11	Unmodified	_VKDLVLSVHNR_			0	0	1	Q15020	Q15020	Q15020	SART3	Squamous cell carcinoma antigen recognized by T-cells 3	MULTI-MSMS	DP1141_7	2	427.90667724609375	3	427.254216	1278.74082	0.013197	5.6385E-06	0.57846	0.00024715	0.59166	0.00025279	427.25457633333946	15.26	0.3	15.26	15.109	15.409	0					8	2	4	0	0	0	0.017023	1	6552	6552		103.08	61.603	1	42539000			2860	398	1661	1739	3879	3879		9606
VKDMAAPGTSSVPAPTAGNAEK	22	Oxidation (M)	_VKDM(Oxidation (M))AAPGTSSVPAPTAGNAEK_	VKDM(1)AAPGTSSVPAPTAGNAEK	VKDM(81)AAPGTSSVPAPTAGNAEK	0	1	1	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-SECPEP	DP1141_6	1	706.2922973632812	3	705.684404	2114.03138	0.21157	0.0001493	0.22526	0.00015897	0.43683	0.00030827	706.0188111192521	14.858	0.59769	14.858	14.31	14.908	0					9	5	2	0	0	0	0.00050429	1	5148	5148		81.017	67.113	1	6497700			2861	445	1662	1740	3880	3880	331	9606
VKPLQDQNELFGK	13	Unmodified	_VKPLQDQNELFGK_			0	0	1	Q12874	Q12874	Q12874	SF3A3	Splicing factor 3A subunit 3	MSMS	DP1141_8	3	758.3440551757812	2	758.411923	1514.80929	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.289	1	17.289	16.789	17.789	0								0	0	0	0.013714	1	9655	9655		110.08	52.218	1				2862	361	1663	1741	3881	3881		9606
VKPYLPQICGTVLWR	15	Unmodified	_VKPYLPQICGTVLWR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	610.6751098632812	3	610.674675	1829.0022	0.77809	0.00047516	-0.53096	-0.00032425	0.24713	0.00015092	610.674595016326	20.692	0.49962	20.692	20.351	20.85	0					13	4	4	0	0	0	2.7845E-118	4	15107	14939;14970;15107;15150		222.56	182.01	1	301410000			2863	78	1664	1742	3882;3883;3884;3885	3884		9606
VLANPGNSQVAR	12	Unmodified	_VLANPGNSQVAR_			0	0	0	Q14974	Q14974	Q14974	KPNB1	Importin subunit beta-1	MULTI-MSMS	DP1141_7	2	613.33642578125	2	613.336018	1224.65748	0.26343	0.00016157	0.14831	9.0964E-05	0.41174	0.00025253	613.3361098343431	14.757	0.30041	14.757	14.508	14.809	0					8	2	4	0	0	0	0.001808	1	5677	5677		142.43	111.86	1	29109000			2864	395	1665	1743	3886	3886		9606
VLANPGNSQVAR	12	Unmodified	_VLANPGNSQVAR_			0	0	0	Q14974	Q14974	Q14974	KPNB1	Importin subunit beta-1	MULTI-MSMS	DP1141_9	4	613.336181640625	2	613.336018	1224.65748	0.094159	5.7751E-05	0.37004	0.00022696	0.46419	0.00028471	613.3360996876344	14.75	0.24351	14.75	14.552	14.795	0					4	2	2	0	0	0	0.018141	1	5466	5466		82.417	53.72	1	4694800			2865	395	1665	1743	3887	3887		9606
VLATVTKPVGGDK	13	Unmodified	_VLATVTKPVGGDK_			0	0	1	Q02878	Q02878	Q02878	RPL6	60S ribosomal protein L6	MULTI-MSMS	DP1141_6	1	428.9223937988281	3	428.922244	1283.7449	0.2855	0.00012246	-0.18611	-7.9828E-05	0.099382	4.2627E-05	428.92218857292374	14.559	0.49319	14.559	14.215	14.708	0					9	4	3	0	0	0	1.9292E-05	1	4862	4862		150.14	104.48	1	5069500			2866	343	1666	1744	3888	3888		9606
VLATVTKPVGGDK	13	Unmodified	_VLATVTKPVGGDK_			0	0	1	Q02878	Q02878	Q02878	RPL6	60S ribosomal protein L6	MSMS	DP1141_6	1	643.325439453125	2	642.879727	1283.7449	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.552	1	14.552	14.052	15.052	0								0	0	0	0.016363	1	4785	4785		99.568	48.763	1				2867	343	1666	1744	3889	3889		9606
VLATVTKPVGGDK	13	Unmodified	_VLATVTKPVGGDK_			0	0	1	Q02878	Q02878	Q02878	RPL6	60S ribosomal protein L6	MULTI-MSMS	DP1141_9	4	429.2572937011719	3	428.922244	1283.7449	0.41994	0.00018012	0.12281	5.2675E-05	0.54275	0.0002328	428.9222625224149	14.589	0.32159	14.589	14.312	14.634	0					6	3	2	0	0	0	3.9442E-29	1	5166	5166		178.95	133.8	1	27939000			2868	343	1666	1744	3890	3890		9606
VLCAVSGPR	9	Unmodified	_VLCAVSGPR_			0	0	0	Q5RKV6	Q5RKV6	Q5RKV6	EXOSC6	Exosome complex component MTR3	MULTI-MSMS	DP1141_10	5	479.76068115234375	2	479.760569	957.506586	0.29992	0.00014389	0.1717	8.2374E-05	0.47162	0.00022626	479.76062854109335	15.32	0.40814	15.32	14.96	15.368	0					7	4	3	0	0	0	0.011293	1	6918	6918		89.752	58.463	1	66145000			2869	418	1667	1745	3891	3891		9606
VLDELTLTK	9	Unmodified	_VLDELTLTK_			0	0	0	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MSMS	DP1141_6	1	516.2815551757812	2	516.30279	1030.59103	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.479	1	18.479	17.979	18.979	0								0	0	0	2.2838E-09	1	11034	11034		145.16	65.705	1			+	2870	17	1668	1746	3892	3892		9606
VLDELTLTK	9	Unmodified	_VLDELTLTK_			0	0	0	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-MSMS	DP1141_8	3	516.2813110351562	2	516.30279	1030.59103	0.51791	0.0002674	0.32281	0.00016667	0.84071	0.00043406	516.3025129021588	18.525	0.50018	18.525	18.075	18.575	0					7	4	2	0	0	0	1.595E-05	1	11562	11562		151.04	54.845	1	86163000		+	2871	17	1668	1746	3893	3893		9606
VLDSGAPIK	9	Unmodified	_VLDSGAPIK_			0	0	0	P06576	P06576	P06576	ATP5B	ATP synthase subunit beta, mitochondrial	MULTI-SECPEP	DP1141_6	1	449.61376953125	2	450.263468	898.512382	0.3731	0.00016799	0.049528	2.2301E-05	0.42262	0.00019029	450.26343509749006	15.45	0.30195	15.45	15.209	15.51	0					6	2	3	0	0	0	0.0074117	1	6001	6001		133.12	38.854	1	6725500			2872	118	1669	1747	3894	3894		9606
VLEENQEHYHIVQK	14	Unmodified	_VLEENQEHYHIVQK_			0	0	0	P57740	P57740	P57740	NUP107	Nuclear pore complex protein Nup107	MULTI-SECPEP	DP1141_7	2	590.03466796875	3	589.300442	1764.8795	0.16744	9.8673E-05	0.29412	0.00017333	0.46156	0.000272	589.3007968056071	15.059	0.30061	15.059	14.909	15.21	0					4	2	2	0	0	0	0.0043949	1	6125	6125		94.547	61.614	1	20533000			2873	273	1670	1748	3895	3895		9606
VLELNASDER	10	Unmodified	_VLELNASDER_			0	0	0	P35249	P35249	P35249	RFC4	Replication factor C subunit 4	MULTI-MSMS	DP1141_9	4	573.2940673828125	2	573.293485	1144.57242	0.11616	6.6594E-05	1.3507	0.00077437	1.4669	0.00084096	573.2940958685812	16.643	0.23434	16.643	16.458	16.693	0					6	2	3	0	0	0	0.0031002	1	8547	8547		107.57	35.882	1	17774000			2874	207	1671	1749	3896	3896		9606
VLETAEDIQER	11	Unmodified	_VLETAEDIQER_			0	0	0	Q13813	Q13813	Q13813	SPTAN1	Spectrin alpha chain, non-erythrocytic 1	MSMS	DP1141_6	1	651.8540649414062	2	651.830431	1301.64631	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.392	1	16.392	15.892	16.892	0								0	0	0	4.9523E-10	1	7624	7624		145.9	94.558	1				2875	380	1672	1750	3897	3897		9606
VLGQSSSKPAAAATGPPPGNTSSTQK	26	Unmodified	_VLGQSSSKPAAAATGPPPGNTSSTQK_			0	0	1	Q9H2P0	Q9H2P0	Q9H2P0	ADNP	Activity-dependent neuroprotector homeobox protein	MULTI-MSMS	DP1141_6	1	813.8765258789062	3	813.753987	2438.24013	-0.075913	-6.1775E-05	-0.077435	-6.3013E-05	-0.15335	-0.00012479	814.4228042571841	14.459	0.2982	14.459	14.31	14.609	0					6	2	3	0	0	0	3.703E-06	2	4784	4784;4823		94.838	66.09	1	2313500			2876	559	1673	1751	3898;3899	3898		9606
VLGQSSSKPAAAATGPPPGNTSSTQK	26	Unmodified	_VLGQSSSKPAAAATGPPPGNTSSTQK_			0	0	1	Q9H2P0	Q9H2P0	Q9H2P0	ADNP	Activity-dependent neuroprotector homeobox protein	MULTI-MSMS	DP1141_7	2	813.8762817382812	3	813.753987	2438.24013	0.5166	0.00042038	-0.087178	-7.0941E-05	0.42942	0.00034944	814.0884160310101	14.458	0.39985	14.458	14.309	14.708	0					5	3	2	0	0	0	3.9943E-11	2	5254	5254;5377		116.92	95.564	1	20191000			2877	559	1673	1751	3900;3901	3900		9606
VLGQSSSKPAAAATGPPPGNTSSTQK	26	Unmodified	_VLGQSSSKPAAAATGPPPGNTSSTQK_			0	0	1	Q9H2P0	Q9H2P0	Q9H2P0	ADNP	Activity-dependent neuroprotector homeobox protein	MULTI-MSMS	DP1141_8	3	813.75439453125	3	813.753987	2438.24013	0.75258	0.00061242	-0.6647	-0.0005409	0.087887	7.1518E-05	814.0876357781822	14.511	0.22305	14.511	14.354	14.577	0					8	2	4	0	0	0	0.015007	1	5283	5283		48.389	22.949	1	4993100			2878	559	1673	1751	3902	3902		9606
VLHNAQEVEKEPGQR	15	Unmodified	_VLHNAQEVEKEPGQR_			0	0	1	P49916	P49916	P49916	LIG3	DNA ligase 3	MULTI-MSMS	DP1141_7	2	578.6360473632812	3	578.635825	1732.88565	0.75662	0.00043781	-0.35008	-0.00020257	0.40654	0.00023524	578.9698996726181	13.648	0.45312	13.648	13.327	13.78	0					13	4	4	0	0	0	0.0085042	2	4064	3993;4064		160.46	135.51	1	3574900			2879	253	1674	1752	3903;3904	3904		9606
VLHNAQEVEKEPGQR	15	Unmodified	_VLHNAQEVEKEPGQR_			0	0	1	P49916	P49916	P49916	LIG3	DNA ligase 3	MULTI-MSMS	DP1141_7	2	434.22882080078125	4	434.228688	1732.88565	0.67458	0.00029292	0.1695	7.3601E-05	0.84407	0.00036652	434.2284458087518	13.677	0.80918	13.677	13.226	14.035	0					25	8	4	0	0	0	0.0046013	1	4061	4061		146.96	109.36	1	7733000			2880	253	1674	1752	3905	3905		9606
VLHNAQEVEKEPGQR	15	Unmodified	_VLHNAQEVEKEPGQR_			0	0	1	P49916	P49916	P49916	LIG3	DNA ligase 3	MULTI-MSMS	DP1141_8	3	578.5203857421875	3	578.635825	1732.88565	-0.14063	-8.1371E-05	0.43937	0.00025423	0.29874	0.00017286	578.6361732307598	13.765	0.21753	13.765	13.587	13.805	0					4	2	2	0	0	0	0.0061213	1	4068	4068		134.9	121	1	2602900			2881	253	1674	1752	3906	3906		9606
VLHNAQEVEKEPGQR	15	Unmodified	_VLHNAQEVEKEPGQR_			0	0	1	P49916	P49916	P49916	LIG3	DNA ligase 3	MULTI-SECPEP	DP1141_8	3	434.03564453125	4	434.228688	1732.88565	-0.098286	-4.2679E-05	0.15451	6.7092E-05	0.056223	2.4413E-05	434.47951041102795	13.765	0.29683	13.765	13.587	13.884	0					7	3	3	0	0	0	0.006662	1	4085	4085		86.498	63.1	1	3763700			2882	253	1674	1752	3907	3907		9606
VLIANNGIAAVK	12	Unmodified	_VLIANNGIAAVK_			0	0	0	Q13085;O00763	Q13085;O00763	Q13085	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	591.8641357421875	2	591.86388	1181.71321	0.95333	0.00056424	-1.0665	-0.0006312	-0.11313	-6.6959E-05	591.8632782026457	17.655	0.50063	17.655	17.404	17.905	0					9	4	3	0	0	0	0.0098034	1	9728	9728		88.37	35.433	1	305200000			2883	367;40	1675	1753	3908	3908		9606
VLIFSQMTK	9	Oxidation (M)	_VLIFSQM(Oxidation (M))TK_	VLIFSQM(1)TK	VLIFSQM(96)TK	0	1	0	Q14839;Q8TDI0;Q12873	Q14839	Q14839	CHD4;CHD5;CHD3	Chromodomain-helicase-DNA-binding protein 4;Chromodomain-helicase-DNA-binding protein 5;Chromodomain-helicase-DNA-binding protein 3	MSMS	DP1141_6	1	541.8034057617188	2	541.79936	1081.58417	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.96	1	17.96	17.46	18.46	0								0	0	0	0.028256	1	10202	10202		95.815	55.243	1				2884	394	1676	1754	3909	3909	303	9606
VLLATLSIPITPER	14	Unmodified	_VLLATLSIPITPER_			0	0	0	Q14152	Q14152	Q14152	EIF3A	Eukaryotic translation initiation factor 3 subunit A	MULTI-MSMS	DP1141_7	2	761.9649047851562	2	761.963791	1521.91303	0.96908	0.00073841	0.36007	0.00027436	1.3292	0.0010128	761.9640838340911	21.6	0.39955	21.6	21.35	21.75	0					5	3	2	0	0	0	0.0045038	1	16560	16560		95.618	74.784	1	13592000			2885	383	1677	1755	3910	3910		9606
VLLDNVENK	9	Unmodified	_VLLDNVENK_			0	0	0	Q93009	Q93009	Q93009	USP7	Ubiquitin carboxyl-terminal hydrolase 7	MULTI-MSMS	DP1141_7	2	522.2904663085938	2	522.290214	1042.56587	0.36785	0.00019212	-0.096834	-5.0575E-05	0.27102	0.00014155	522.2901603173875	16.565	0.52322	16.565	16.215	16.738	0					8	5	3	0	0	0	0.019603	1	8625	8625		84.743	30.132	1	64534000			2886	501	1678	1756	3911	3911		9606
VLNTNIDGR	9	Unmodified	_VLNTNIDGR_			0	0	0	P62269	P62269	P62269	RPS18	40S ribosomal protein S18	MULTI-SECPEP	DP1141_10	5	500.7659912109375	2	501.272355	1000.53016	0.25242	0.00012653	1.5448	0.00077439	1.7973	0.00090092	501.272543504262	15.569	0.6748	15.569	15.199	15.873	0					12	7	3	0	0	0	2.1335E-26	1	7395	7395		199.07	124.73	1	25890000			2887	293	1679	1757	3912	3912		9606
VLPPPAGYVPIR	12	Unmodified	_VLPPPAGYVPIR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_10	5	640.366943359375	2	639.882073	1277.74959	-0.18643	-0.00011929	0.35988	0.00023028	0.17345	0.00011099	639.8824464407073	18.853	0.88914	18.853	18.587	19.476	0					19	8	3	0	0	0	0.017589	2	12729	12729;12841		83.005	65.764	1	10177000			2888	78	1680	1758	3913;3914	3913		9606
VLPPPAGYVPIR	12	Unmodified	_VLPPPAGYVPIR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_6	1	639.8828735351562	2	639.882073	1277.74959	0.74412	0.00047615	0.035745	2.2873E-05	0.77987	0.00049902	639.882050925111	18.934	1.2012	18.934	18.604	19.806	0					27	11	3	0	0	0	0.0047009	4	11660	11421;11576;11660;11753		118.74	93.184	1	13127000			2889	78	1680	1758	3915;3916;3917;3918	3917		9606
VLPPPAGYVPIR	12	Unmodified	_VLPPPAGYVPIR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	639.883056640625	2	639.882073	1277.74959	0.93845	0.0006005	0.064848	4.1495E-05	1.0033	0.00064199	639.8820376078904	18.872	1.3013	18.872	18.575	19.877	0					38	12	4	0	0	0	0.0049349	4	12089	12042;12089;12179;12913		114.5	95.183	1	58370000			2890	78	1680	1758	3919;3920;3921;3922	3920		9606
VLPPPAGYVPIR	12	Unmodified	_VLPPPAGYVPIR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_9	4	639.8827514648438	2	639.882073	1277.74959	0.66137	0.0004232	0.01565	1.0014E-05	0.67702	0.00043321	639.8820667238231	18.823	1.2016	18.823	18.537	19.739	0					23	11	3	0	0	0	0.006397	2	12198	12104;12198		93.143	74.363	1	12869000			2891	78	1680	1758	3923;3924	3924		9606
VLPSITTEILK	11	Unmodified	_VLPSITTEILK_			0	0	0	P35232	P35232	P35232	PHB	Prohibitin	MULTI-MSMS	DP1141_10	5	607.2633056640625	2	607.373746	1212.73294	0.73226	0.00044476	0.25453	0.0001546	0.9868	0.00059935	607.3737918484368	20.226	0.39996	20.226	19.976	20.376	0					6	3	2	0	0	0	0.019786	1	14886	14886		83.647	39.252	1	43240000			2892	206	1681	1759	3925	3925		9606
VLPSIVNEVLK	11	Unmodified	_VLPSIVNEVLK_			0	0	0	Q99623	Q99623	Q99623	PHB2	Prohibitin-2	MULTI-MSMS	DP1141_9	4	605.8741455078125	2	605.873914	1209.73327	-0.28565	-0.00017307	0.82986	0.00050279	0.54421	0.00032972	605.8744363051554	20.987	0.50114	20.987	20.636	21.138	0					10	4	3	0	0	0	4.104E-05	2	15385	15271;15385		148.94	97.885	1	47915000			2893	529	1682	1760	3926;3927	3927		9606
VLRPPGGGSNFSLGFDEPTEQPVRK	25	Unmodified	_VLRPPGGGSNFSLGFDEPTEQPVRK_			0	0	2	Q9UK76	Q9UK76	Q9UK76	HN1	Hematological and neurological expressed 1 protein;Hematological and neurological expressed 1 protein, N-terminally processed	MULTI-MSMS	DP1141_10	5	672.1014404296875	4	671.85023	2683.37181	0.13363	8.9778E-05	0.34715	0.00023323	0.48078	0.00032301	672.1012500940989	18.637	0.3946	18.637	18.287	18.682	0					9	3	4	0	0	0	3.7271E-17	1	12362	12362		149.71	126.31	1	67572000			2894	596	1683	1761	3928	3928		9606
VLSAPPHFHFGQTNR	15	Unmodified	_VLSAPPHFHFGQTNR_			0	0	0	P26641	P26641	P26641	EEF1G	Elongation factor 1-gamma	MULTI-MSMS	DP1141_10	5	427.5585021972656	4	427.723307	1706.86412	-0.27813	-0.00011896	0.10227	4.3741E-05	-0.17586	-7.5221E-05	427.97405933390104	17.173	0.28207	17.173	17.005	17.287	0					4	2	2	0	0	0	0.012492	1	10007	10007		58.831	35.652	1	4270500			2895	189	1684	1762	3929	3929		9606
VLSGTIHAGQPVK	13	Unmodified	_VLSGTIHAGQPVK_			0	0	0	Q15029	Q15029	Q15029	EFTUD2	116 kDa U5 small nuclear ribonucleoprotein component	MULTI-MSMS	DP1141_7	2	436.2157897949219	3	436.254105	1305.74048	0.07502	3.2728E-05	0.078328	3.4171E-05	0.15335	6.6899E-05	436.2540795424146	14.959	0.30073	14.959	14.809	15.109	0					4	2	2	0	0	0	0.00299	1	5932	5932		103.44	57.549	1	42562000			2896	399	1685	1763	3930	3930		9606
VLSGTIHAGQPVK	13	Unmodified	_VLSGTIHAGQPVK_			0	0	0	Q15029	Q15029	Q15029	EFTUD2	116 kDa U5 small nuclear ribonucleoprotein component	MULTI-MSMS	DP1141_8	3	436.8346252441406	3	436.254105	1305.74048	0.32147	0.00014024	-0.7005	-0.0003056	-0.37903	-0.00016535	436.58780452697334	14.962	0.39935	14.962	14.772	15.172	0					5	3	2	0	0	0	0.0069028	1	5827	5827		84.821	41.402	1	2076000			2897	399	1685	1763	3931	3931		9606
VLSIGDGIAR	10	Unmodified	_VLSIGDGIAR_			0	0	0	P25705	P25705	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	501.227783203125	2	500.792924	999.571294	0.64363	0.00032233	-0.096989	-4.8571E-05	0.54665	0.00027376	500.79282844561044	18.025	0.80127	18.025	17.774	18.575	0					12	7	2	0	0	0	1.0166E-13	2	10894	10762;10894		166.68	76.776	1	66181000			2898	187	1686	1764	3932;3933	3933		9606
VLSQSTPGTPSK	12	Unmodified	_VLSQSTPGTPSK_			0	0	0	Q6MZP7	Q6MZP7	Q6MZP7	LIN54	Protein lin-54 homolog	MULTI-MSMS	DP1141_8	3	601.324951171875	2	601.324785	1200.63502	0.1169	7.0297E-05	-0.19554	-0.00011758	-0.078634	-4.7285E-05	601.3246126054071	14.131	0.3853	14.131	13.968	14.354	0					7	4	2	0	0	0	2.1251E-05	3	4694	4518;4694;4773		148.32	104.51	1	5659800			2899	431	1687	1765	3934;3935;3936	3935		9606
VLTANSNPSSPSAAK	15	Unmodified	_VLTANSNPSSPSAAK_			0	0	0	Q9NV56	Q9NV56	Q9NV56	MRGBP	MRG/MORF4L-binding protein	MULTI-MSMS	DP1141_10	5	722.3756713867188	2	722.375537	1442.73652	0.88182	0.00063701	-0.97951	-0.00070758	-0.097692	-7.057E-05	722.3747872855405	14.313	0.18923	14.313	14.215	14.404	0					6	2	3	0	0	0	0.0062005	1	5362	5362		92.925	41.833	1	4849500			2900	576	1688	1766	3937	3937		9606
VLYDAEISQIHQSVTDTNVILSMDNSR	27	Oxidation (M)	_VLYDAEISQIHQSVTDTNVILSM(Oxidation (M))DNSR_	VLYDAEISQIHQSVTDTNVILSM(1)DNSR	VLYDAEISQIHQSVTDTNVILSM(58)DNSR	0	1	0	CON__P35908v2;CON__P35908;P35908	CON__P35908v2	CON__P35908v2	KRT2	Keratin, type II cytoskeletal 2 epidermal	MULTI-MSMS	DP1141_7	2	1022.5032348632812	3	1022.16791	3063.48189	0.66594	0.00068071	0.34296	0.00035056	1.0089	0.0010313	1022.8368988361922	20.849	0.29979	20.849	20.651	20.95	0					12	2	6	0	0	0	5.923E-05	1	15386	15386		57.648	38.536	1	28305000		+	2901	20	1689	1767	3938	3938	26	9606
VLYLLSQLQQSQMAEK	16	Oxidation (M)	_VLYLLSQLQQSQM(Oxidation (M))AEK_	VLYLLSQLQQSQM(1)AEK	VLYLLSQLQQSQM(110)AEK	0	1	0	O95239	O95239	O95239	KIF4A	Chromosome-associated kinesin KIF4A	MSMS	DP1141_7	2	947.8087158203125	2	948.000776	1893.987	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.035	1	21.035	20.535	21.535	0								0	0	0	0.0025294	1	15561	15561		110.38	74.059	1				2902	89	1690	1768	3939	3939	76	9606
VMEETLSYLLGR	12	Oxidation (M)	_VM(Oxidation (M))EETLSYLLGR_	VM(1)EETLSYLLGR	VM(74)EETLSYLLGR	0	1	0	P05089	P05089	P05089	ARG1	Arginase-1	MULTI-SECPEP	DP1141_9	4	713.3673706054688	2	713.86596	1425.71737	0.62798	0.0004483	3.5817	0.0025569	4.2097	0.0030052	713.8682274200447	20.687	0.30036	20.687	20.536	20.837	0					4	2	2	0	0	0	0.031351	1	15099	15099		74.162	41.412	1	7280300			2903	107	1691	1769	3940	3940	91	9606
VMIIENSHVK	10	Oxidation (M)	_VM(Oxidation (M))IIENSHVK_	VM(1)IIENSHVK	VM(91)IIENSHVK	0	1	0	P13569	P13569	P13569	CFTR	Cystic fibrosis transmembrane conductance regulator	MSMS	DP1141_7	2	593.3162841796875	2	593.318448	1184.62234	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.289	1	18.289	17.789	18.789	0								0	0	0	0.025948	1	11377	11377		90.601	55.306	1				2904	146	1692	1770	3941	3941	148	9606
VMQQQQQTTQQQLPQK	16	Oxidation (M)	_VM(Oxidation (M))QQQQQTTQQQLPQK_	VM(1)QQQQQTTQQQLPQK	VM(110)QQQQQTTQQQLPQK	0	1	0	Q15459	Q15459	Q15459	SF3A1	Splicing factor 3A subunit 1	MULTI-MSMS	DP1141_7	2	979.4921875	2	979.491638	1956.96872	0.62226	0.0006095	-0.081231	-7.9565E-05	0.54103	0.00052993	979.4915401773288	14.162	0.27384	14.162	14.035	14.309	0					4	2	2	0	0	0	0.012048	1	4928	4928		105.13	80.624	1	15638000			2905	405	1693	1771	3942	3942	311	9606
VMTDVAGNPEEERR	14	Oxidation (M)	_VM(Oxidation (M))TDVAGNPEEERR_	VM(1)TDVAGNPEEERR	VM(75)TDVAGNPEEERR	0	1	1	Q6STE5	Q6STE5	Q6STE5	SMARCD3	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3	MULTI-MSMS	DP1141_8	3	540.2960815429688	3	540.254504	1617.74168	0.28162	0.00015215	-0.18745	-0.00010127	0.094173	5.0878E-05	540.2541564741741	14.226	0.38389	14.226	13.884	14.268	0					5	4	2	0	0	0	0.0072025	1	4725	4725		75.479	36.315	1	3403100			2906	434	1694	1772	3943	3943	324	9606
VNLLYSR	7	Unmodified	_VNLLYSR_			0	0	0	Q13011	Q13011	Q13011	ECH1	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial	MULTI-MSMS	DP1141_10	5	432.5963439941406	2	432.750527	863.486502	-0.37987	-0.00016439	0.42718	0.00018486	0.047313	2.0475E-05	432.75071392930664	17.538	0.30041	17.538	17.287	17.588	0					4	2	2	0	0	0	0.010463	1	10548	10548		104.45	62.946	1	22095000			2907	366	1695	1773	3944	3944		9606
VNNADDFPNLFR	12	Unmodified	_VNNADDFPNLFR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	711.7022705078125	2	711.34404	1420.67353	1.0996	0.00078217	-0.051993	-3.6985E-05	1.0476	0.00074519	711.3441224323838	20.732	0.27978	20.732	20.582	20.862	0					8	2	4	0	0	0	3.9463000000000002E-177	2	14485	14485;14670		240.38	211.65	1	235640000			2908	367	1696	1774	3945;3946	3945		9606
VPAGNWVLIEGVDQPIVK	18	Unmodified	_VPAGNWVLIEGVDQPIVK_			0	0	0	Q15029	Q15029	Q15029	EFTUD2	116 kDa U5 small nuclear ribonucleoprotein component	MSMS	DP1141_7	2	967.5713500976562	2	967.540926	1933.0673	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.738	1	21.738	21.238	22.238	0								0	0	0	0	1	16592	16592		299.25	253.1	1				2909	399	1697	1775	3947	3947		9606
VPEWVDTVK	9	Unmodified	_VPEWVDTVK_			0	0	0	P39019	P39019	P39019	RPS19	40S ribosomal protein S19	MULTI-MSMS	DP1141_10	5	536.6746826171875	2	536.787307	1071.56006	-0.13493	-7.2431E-05	1.0345	0.00055532	0.8996	0.00048289	536.7875819643976	18.537	0.29479	18.537	18.387	18.682	0					4	2	2	0	0	0	0.01891	1	12171	12171		85.161	46.342	1	3352300			2910	218	1698	1776	3948	3948		9606
VPIPVKESIEEPSAK	15	Unmodified	_VPIPVKESIEEPSAK_			0	0	1	O75643	O75643	O75643	SNRNP200	U5 small nuclear ribonucleoprotein 200 kDa helicase	MULTI-MSMS	DP1141_6	1	541.924560546875	3	541.638172	1621.89269	0.013876	7.5159E-06	0.48171	0.00026091	0.49558	0.00026843	541.6384411871945	16.68	0.22432	16.68	16.505	16.729	0					4	2	2	0	0	0	0.01888	1	8085	8085		105.99	70.183	1	6558900			2911	80	1699	1777	3949	3949		9606
VPLPSLSPTMQAGTIAR	17	Oxidation (M)	_VPLPSLSPTM(Oxidation (M))QAGTIAR_	VPLPSLSPTM(1)QAGTIAR	VPLPSLSPTM(77)QAGTIAR	0	1	0	P10515	P10515	P10515	DLAT	Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial	MSMS	DP1141_6	1	877.9732055664062	2	877.977104	1753.93965	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.945	1	18.945	18.445	19.445	0								0	0	0	0.023714	1	11776	11776		77.279	29.977	1				2912	138	1700	1778	3950	3950	132	9606
VPPPPPIAR	9	Unmodified	_VPPPPPIAR_			0	0	0	P07910	P07910	P07910	HNRNPC	Heterogeneous nuclear ribonucleoproteins C1/C2	MULTI-MSMS	DP1141_9	4	472.2767028808594	2	472.28982	942.565087	0.33133	0.00015648	0.14055	6.6382E-05	0.47188	0.00022286	472.28977988266297	15.625	0.98718	15.625	15.471	16.458	0					21	9	4	0	0	0	0.00044127	2	6853	6853;6981		133.47	75.302	1	107170000			2913	124	1701	1779	3951;3952	3951		9606
VPPPWLIAMQR	11	Unmodified	_VPPPWLIAMQR_			0	0	0	Q13435	Q13435	Q13435	SF3B2	Splicing factor 3B subunit 2	MULTI-MSMS	DP1141_7	2	654.3692626953125	2	654.368275	1306.722	0.14396	9.4206E-05	1.0551	0.00069044	1.1991	0.00078465	654.3691818188336	21.6	0.70014	21.6	21.15	21.85	0					12	6	4	0	0	0	0.018234	1	16541	16541		84.568	56.555	1	49553000			2914	374	1702	1780	3953	3953		9606
VPVFSHEVVPDHLR	14	Unmodified	_VPVFSHEVVPDHLR_			0	0	0	Q96G25	Q96G25	Q96G25	MED8	Mediator of RNA polymerase II transcription subunit 8	MULTI-MSMS	DP1141_10	5	544.2850952148438	3	544.294852	1629.86273	-0.39595	-0.00021552	-0.43383	-0.00023613	-0.82978	-0.00045165	544.6293375128386	17.438	0.70047	17.438	17.087	17.788	0					10	6	3	0	0	0	0.0029814	1	10485	10485		93.766	61.698	1	6247400			2915	511	1703	1781	3954	3954		9606
VQDQDLPNTPHSK	13	Unmodified	_VQDQDLPNTPHSK_			0	0	0	Q08554	Q08554	Q08554	DSC1	Desmocollin-1	MULTI-MSMS	DP1141_6	1	493.5793151855469	3	493.579317	1477.71612	0.23845	0.0001177	-0.49483	-0.00024424	-0.25638	-0.00012654	493.5790945311021	14.097	0.24674	14.097	13.968	14.215	0					6	2	3	0	0	0	0.0098398	1	4285	4285		80.318	42.324	1	1328000			2916	358	1704	1782	3955	3955		9606
VQENCIDLVGR	11	Unmodified	_VQENCIDLVGR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	651.67822265625	2	651.827169	1301.63978	0.033774	2.2015E-05	0.051257	3.341E-05	0.085031	5.5426E-05	651.8273086287187	17.599	0.49974	17.599	17.249	17.749	0					9	4	3	0	0	0	2.3944999999999997E-52	2	10318	10224;10318		192.64	107.43	1	618750000			2917	78	1705	1783	3956;3957	3957		9606
VQENCIDLVGR	11	Unmodified	_VQENCIDLVGR_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_8	3	652.834228515625	2	651.827169	1301.63978	1.1005	0.00071735	0.34098	0.00022226	1.4415	0.00093961	651.8272307152214	17.624	0.50063	17.624	17.273	17.774	0					8	4	3	0	0	0	0.0035691	1	10190	10190		128.6	73.88	1	107030000			2918	78	1705	1783	3958	3958		9606
VQISPDSGGLPER	13	Unmodified	_VQISPDSGGLPER_			0	0	0	Q92945	Q92945	Q92945	KHSRP	Far upstream element-binding protein 2	MULTI-MSMS	DP1141_8	3	677.8519897460938	2	677.851698	1353.68884	0.38566	0.00026142	0.16088	0.00010905	0.54654	0.00037048	677.8516829753181	16.923	0.24507	16.923	16.828	17.073	0					6	2	3	0	0	0	0.0060949	1	9233	9233		90.653	78.94	1	32450000			2919	500	1706	1784	3959	3959		9606
VQQAELHTGSLPR	13	Unmodified	_VQQAELHTGSLPR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	719.318115234375	2	718.386239	1434.75793	0.44778	0.00032168	0.3708	0.00026638	0.81858	0.00058806	718.386543785826	15.563	0.49978	15.563	15.209	15.708	0					7	4	2	0	0	0	0.025234	2	6114	6114;6395		75.566	44.072	1	270110000			2920	367	1707	1785	3960;3961	3960		9606
VQQAELHTGSLPR	13	Unmodified	_VQQAELHTGSLPR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MSMS	DP1141_6	1	479.2579345703125	3	479.259918	1434.75793	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.486	1	15.486	14.986	15.986	0								0	0	0	0.015431	1	6148	6148		107.34	71.607	1				2921	367	1707	1785	3962	3962		9606
VQSLQATFGTFESILR	16	Unmodified	_VQSLQATFGTFESILR_			0	0	0	Q07065	Q07065	Q07065	CKAP4	Cytoskeleton-associated protein 4	MULTI-MSMS	DP1141_8	3	898.9818725585938	2	898.980701	1795.94685	0.44347	0.00039867	0.42996	0.00038653	0.87344	0.0007852	899.4822442694665	23.505	0.22581	23.505	23.325	23.551	0					4	2	2	0	0	0	7.4991E-23	1	19097	19097		175.48	137.24	1	9107100			2922	351	1708	1786	3963	3963		9606
VRMQGQEAVLAMSSR	15	2 Oxidation (M)	_VRM(Oxidation (M))QGQEAVLAM(Oxidation (M))SSR_	VRM(1)QGQEAVLAM(1)SSR	VRM(70)QGQEAVLAM(70)SSR	0	2	1	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	565.59912109375	3	565.615268	1693.82397	-0.1073	-6.0693E-05	-0.31329	-0.0001772	-0.42059	-0.00023789	565.6150862387066	14.597	0.29943	14.597	14.409	14.708	0					6	2	3	0	0	0	0.0086083	1	4831	4831		70.197	29.34	1	579420			2923	402	1709	1787	3964	3964	307;308	9606
VRPDYTAQNLDHGK	14	Unmodified	_VRPDYTAQNLDHGK_			0	0	1	P82930	P82930	P82930	MRPS34	28S ribosomal protein S34, mitochondrial	MULTI-MSMS	DP1141_10	5	538.6068725585938	3	538.605866	1612.79577	-0.35014	-0.00018859	0.68748	0.00037028	0.33733	0.00018169	538.6062578281702	14.509	0.38495	14.509	14.215	14.6	0					6	5	2	0	0	0	0.0060755	1	5606	5606		119.62	107.69	1	17114000			2924	330	1710	1788	3965	3965		9606
VRQQAADLISR	11	Unmodified	_VRQQAADLISR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	419.5459289550781	3	419.573837	1255.69968	-0.16057	-6.7371E-05	0.10228	4.2913E-05	-0.058294	-2.4459E-05	419.5737164319916	15.16	0.30025	15.16	15.009	15.309	0					4	2	2	0	0	0	0.015743	1	6299	6299		107.34	56.553	1	11690000			2925	78	1711	1789	3966	3966		9606
VRQQAADLISR	11	Unmodified	_VRQQAADLISR_			0	0	1	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-SECPEP	DP1141_7	2	628.3359985351562	2	628.857118	1255.69968	-0.26353	-0.00016572	0.38015	0.00023906	0.11662	7.3336E-05	628.8573750720262	15.16	0.30025	15.16	15.009	15.309	0					4	2	2	0	0	0	7.519000000000001E-69	1	6364	6364		219.5	133.83	1	24156000			2926	78	1711	1789	3967	3967		9606
VRVELSTGMPR	11	Oxidation (M)	_VRVELSTGM(Oxidation (M))PR_	VRVELSTGM(1)PR	VRVELSTGM(76)PR	0	1	1	Q16629	Q16629	Q16629	SRSF7	Serine/arginine-rich splicing factor 7	MULTI-MSMS	DP1141_10	5	420.56317138671875	3	420.895812	1259.66561	0.20413	8.5917E-05	0.42346	0.00017823	0.62759	0.00026415	420.89605729370714	15.24	0.24131	15.24	15.039	15.28	0					4	2	2	0	0	0	0.02999	1	6766	6766		76.332	51.317	1	15981000			2927	412	1712	1790	3968	3968	314	9606
VSALNSVHCEHVEDEGESR	19	Unmodified	_VSALNSVHCEHVEDEGESR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	539.4942626953125	4	539.243366	2152.94436	0.083651	4.5108E-05	-0.41661	-0.00022465	-0.33296	-0.00017955	539.4942413026705	15.158	1.0956	15.158	14.708	15.804	0					33	10	7	0	0	0	0.0015256	2	5807	5807;6111		82.865	66.251	1	534330000			2928	367	1713	1791	3969;3970	3969		9606
VSALNSVHCEHVEDEGESR	19	Unmodified	_VSALNSVHCEHVEDEGESR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	1077.9815673828125	2	1077.47946	2152.94436	-0.52695	-0.00056778	0.61089	0.00065822	0.083935	9.0438E-05	1077.9821389845968	15.158	0.40014	15.158	15.008	15.408	0					9	3	4	0	0	0	1.8678E-34	1	5823	5823		168.45	136.63	1	11254000			2929	367	1713	1791	3971	3971		9606
VSALNSVHCEHVEDEGESR	19	Unmodified	_VSALNSVHCEHVEDEGESR_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_8	3	718.703125	3	718.655396	2152.94436	0.43333	0.00031142	1.3818	0.00099304	1.8151	0.0013045	718.9899726288002	15.221	0.29834	15.221	14.972	15.271	0					6	2	3	0	0	0	6.3577E-60	1	6222	6222		195.25	168.21	1	7731500			2930	367	1713	1791	3972	3972		9606
VSGAAPPRPGSSFAHFGFDEQLMHQIR	27	Unmodified	_VSGAAPPRPGSSFAHFGFDEQLMHQIR_			0	0	1	Q86XP3	Q86XP3	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	MULTI-MSMS	DP1141_7	2	735.8292236328125	4	735.614696	2938.42968	0.28021	0.00020613	-0.00019919	-1.4653E-07	0.28001	0.00020598	736.1165073454058	19.501	0.2998	19.501	19.35	19.65	0					8	2	4	0	0	0	0.0036711	1	13316	13316		52.927	38.864	1	45388000			2931	460	1714	1792	3973	3973		9606
VSGVECMIIANDATVK	16	Oxidation (M)	_VSGVECM(Oxidation (M))IIANDATVK_	VSGVECM(1)IIANDATVK	VSGVECM(120)IIANDATVK	0	1	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MSMS	DP1141_8	3	861.92431640625	2	861.92368	1721.83281	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.135	1	18.135	17.635	18.635	0								0	0	0	0.0030097	1	11007	11007		115.34	79.665	1				2932	567	1715	1793	3974	3974	408	9606
VSGVECMIIANDATVK	16	Unmodified	_VSGVECMIIANDATVK_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MSMS	DP1141_8	3	853.926513671875	2	853.926222	1705.83789	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.628	1	19.628	19.128	20.128	0								0	0	0	0.0043931	1	13283	13283		133.88	85.984	1				2933	567	1715	1794	3975	3975		9606
VSISEGDDKIEYR	13	Unmodified	_VSISEGDDKIEYR_			0	0	1	P22087	P22087	P22087	FBL	rRNA 2-O-methyltransferase fibrillarin	MULTI-MSMS	DP1141_9	4	504.25128173828125	3	504.250977	1509.7311	-0.25089	-0.00012651	0.63709	0.00032125	0.3862	0.00019474	504.2513275150266	16.643	0.23434	16.643	16.458	16.693	0					8	2	4	0	0	0	0.0014681	1	8550	8550		159.44	129.89	1	79141000			2934	176	1716	1795	3976	3976		9606
VSVADHSLHLSK	12	Unmodified	_VSVADHSLHLSK_			0	0	0	Q13162	Q13162	Q13162	PRDX4	Peroxiredoxin-4	MULTI-MSMS	DP1141_10	5	432.258544921875	3	431.570093	1291.68845	0.026081	1.1256E-05	0.095673	4.129E-05	0.12175	5.2545E-05	431.57002083747227	15.245	0.41272	15.245	15.12	15.533	0					7	4	3	0	0	0	0.029141	1	6775	6775		68.44	33.216	1	11159000			2935	370	1717	1796	3977	3977		9606
VSWLGEEPVAGVWSEK	16	Unmodified	_VSWLGEEPVAGVWSEK_			0	0	0	Q9BQ67	Q9BQ67	Q9BQ67	GRWD1	Glutamate-rich WD repeat-containing protein 1	MULTI-MSMS	DP1141_8	3	886.9654541015625	2	886.946327	1771.8781	0.50178	0.00044505	-2.3181	-0.002056	-1.8163	-0.001611	886.9443134413791	21.397	0.60166	21.397	21.078	21.679	0					8	5	2	0	0	0	0.00050294	1	16274	16274		146.5	104.03	1	14257000			2936	536	1718	1797	3978	3978		9606
VSYFAVFDGHGGIR	14	Unmodified	_VSYFAVFDGHGGIR_			0	0	0	Q9H0C8	Q9H0C8	Q9H0C8	ILKAP	Integrin-linked kinase-associated serine/threonine phosphatase 2C	MULTI-MSMS	DP1141_9	4	508.8031005859375	3	508.924647	1523.75211	-0.13766	-7.006E-05	0.19021	9.68E-05	0.052542	2.674E-05	508.9248720222205	19.988	0.39824	19.988	19.639	20.037	0					7	3	3	0	0	0	0.0093097	1	13868	13868		116.74	85.211	1	19454000			2937	552	1719	1798	3979	3979		9606
VTEDTSSVLR	10	Unmodified	_VTEDTSSVLR_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MSMS	DP1141_10	5	553.788330078125	2	553.788035	1105.56152	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.741	1	15.741	15.241	16.241	0								0	0	0	3.0419E-84	1	7545	7545		193.41	122.5	1				2938	110	1720	1799	3980	3980		9606
VTFSEDDEIINPEDVDPSVGR	21	Unmodified	_VTFSEDDEIINPEDVDPSVGR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_10	5	1167.0428466796875	2	1167.04261	2332.07066	0.65337	0.00076251	-0.21794	-0.00025435	0.43542	0.00050816	1167.5440178177612	20.725	0.39933	20.725	20.376	20.775	0					12	3	4	0	0	0	0	2	15551	15520;15551		438.97	415.48	1	193990000			2939	365	1721	1800	3981;3982	3982		9606
VTFSEDDEIINPEDVDPSVGR	21	Unmodified	_VTFSEDDEIINPEDVDPSVGR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_6	1	1167.544677734375	2	1167.04261	2332.07066	0.20704	0.00024163	0.43778	0.00051091	0.64483	0.00075254	1167.5445552299736	20.732	0.56461	20.732	20.39	20.954	0					18	5	5	0	0	0	6.8755E-201	2	14435	14435;14502		324.84	291.09	1	135010000			2940	365	1721	1800	3983;3984	3983		9606
VTFSEDDEIINPEDVDPSVGR	21	Unmodified	_VTFSEDDEIINPEDVDPSVGR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_6	1	778.3643798828125	3	778.364165	2332.07066	0.16198	0.00012608	1.0317	0.00080302	1.1936	0.00092909	778.3648582277335	20.732	0.28653	20.732	20.485	20.772	0					10	2	5	0	0	0	1.6663E-05	1	14587	14587		120.74	97.057	1	14377000			2941	365	1721	1800	3985	3985		9606
VTFSEDDEIINPEDVDPSVGR	21	Unmodified	_VTFSEDDEIINPEDVDPSVGR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_7	2	1167.0440673828125	2	1167.04261	2332.07066	0.66162	0.00077214	-0.23697	-0.00027655	0.42465	0.00049559	1167.5437110692678	20.7	0.49962	20.7	20.351	20.85	0					11	4	4	0	0	0	0	2	15147	15147;15226		398.06	377.32	1	79737000			2942	365	1721	1800	3986;3987	3986		9606
VTFSEDDEIINPEDVDPSVGR	21	Unmodified	_VTFSEDDEIINPEDVDPSVGR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_8	3	778.6995849609375	3	778.364165	2332.07066	0.32799	0.0002553	0.53786	0.00041865	0.86586	0.00067395	778.6989317325787	20.728	0.60145	20.728	20.176	20.778	0					7	5	2	0	0	0	1.0455E-05	1	14939	14939		143.23	138.06	1	205290000			2943	365	1721	1800	3988	3988		9606
VTFSEDDEIINPEDVDPSVGR	21	Unmodified	_VTFSEDDEIINPEDVDPSVGR_			0	0	0	Q12972	Q12972	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	MULTI-MSMS	DP1141_9	4	778.6991577148438	3	778.364165	2332.07066	0.89279	0.00069491	-0.22548	-0.00017551	0.66731	0.00051941	778.6982782172342	20.687	0.50007	20.687	20.337	20.837	0					12	4	4	0	0	0	7.4391E-05	1	14981	14981		131.9	114.48	1	26822000			2944	365	1721	1800	3989	3989		9606
VTGEADVEFATHEEAVAAMSK	21	Oxidation (M)	_VTGEADVEFATHEEAVAAM(Oxidation (M))SK_	VTGEADVEFATHEEAVAAM(1)SK	VTGEADVEFATHEEAVAAM(48)SK	0	1	0	P52597	P52597	P52597	HNRNPF	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed	MULTI-MSMS	DP1141_10	5	737.9229125976562	3	736.675686	2207.00523	0.36296	0.00026738	0.52785	0.00038885	0.89081	0.00065624	737.0103424128388	18.237	0.49947	18.237	18.087	18.587	0					11	4	4	0	0	0	0.017007	1	11740	11740		47.822	28.331	1	24921000			2945	266	1722	1801	3990	3990	221	9606
VTGEADVEFATHEEAVAAMSK	21	Oxidation (M)	_VTGEADVEFATHEEAVAAM(Oxidation (M))SK_	VTGEADVEFATHEEAVAAM(1)SK	VTGEADVEFATHEEAVAAM(110)SK	0	1	0	P52597	P52597	P52597	HNRNPF	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed	MULTI-MSMS	DP1141_9	4	737.0106811523438	3	736.675686	2207.00523	0.38601	0.00028437	0.43994	0.00032409	0.82596	0.00060846	737.0102842774547	18.287	0.49967	18.287	17.837	18.337	0					7	4	3	0	0	0	8.5048E-08	1	11250	11250		105.38	83.702	1	87053000			2946	266	1722	1801	3991	3991	221	9606
VTHAVVTVPAYFNDAQR	17	Unmodified	_VTHAVVTVPAYFNDAQR_			0	0	0	P11021	P11021	P11021	HSPA5	78 kDa glucose-regulated protein	MULTI-MSMS	DP1141_8	3	630.3290405273438	3	629.995242	1886.9639	0.62646	0.00039467	0.033728	2.1249E-05	0.66019	0.00041591	629.9953009383393	18.525	0.40003	18.525	18.175	18.575	0					9	3	3	0	0	0	0.00010403	2	11532	11532;11637		118.21	92.597	1	53470000			2947	139	1723	1802	3992;3993	3992		9606
VTIAQGGVLPNIQAVLLPK	19	Unmodified	_VTIAQGGVLPNIQAVLLPK_			0	0	0	Q99878;Q96KK5;Q9BTM1;Q16777;Q93077;Q7L7L0;Q6FI13;P20671;P0C0S8;P04908	Q99878	Q99878	HIST1H2AJ;HIST1H2AH;H2AFJ;HIST2H2AC;HIST1H2AC;HIST3H2A;HIST2H2AA3;HIST1H2AD;HIST1H2AG;HIST1H2AB	Histone H2A type 1-J;Histone H2A type 1-H;Histone H2A.J;Histone H2A type 2-C;Histone H2A type 1-C;Histone H2A type 3;Histone H2A type 2-A;Histone H2A type 1-D;Histone H2A type 1;Histone H2A type 1-B/E	MULTI-MSMS	DP1141_10	5	966.5894165039062	2	966.088043	1930.16153	0.47969	0.00046342	-0.19449	-0.0001879	0.2852	0.00027552	966.5891889288753	22.729	0.67927	22.729	22.349	23.028	0					31	7	7	0	0	0	1.2389E-59	2	18268	18268;18379		248.67	203.31	1	519570000			2948	105	1724	1803	3994;3995	3994		9606
VTIAQGGVLPNIQAVLLPK	19	Unmodified	_VTIAQGGVLPNIQAVLLPK_			0	0	0	Q99878;Q96KK5;Q9BTM1;Q16777;Q93077;Q7L7L0;Q6FI13;P20671;P0C0S8;P04908	Q99878	Q99878	HIST1H2AJ;HIST1H2AH;H2AFJ;HIST2H2AC;HIST1H2AC;HIST3H2A;HIST2H2AA3;HIST1H2AD;HIST1H2AG;HIST1H2AB	Histone H2A type 1-J;Histone H2A type 1-H;Histone H2A.J;Histone H2A type 2-C;Histone H2A type 1-C;Histone H2A type 3;Histone H2A type 2-A;Histone H2A type 1-D;Histone H2A type 1;Histone H2A type 1-B/E	MULTI-MSMS	DP1141_6	1	966.4653930664062	2	966.088043	1930.16153	0.45371	0.00043833	0.045821	4.4267E-05	0.49953	0.00048259	966.589496445561	22.705	0.52058	22.705	22.254	22.775	0					28	9	5	0	0	0	2.0873E-25	5	17552	17150;17281;17317;17388;17552		211.22	169.01	1	17455000			2949	105	1724	1803	3996;3997;3998;3999;4000	4000		9606
VTIAQGGVLPNIQAVLLPK	19	Unmodified	_VTIAQGGVLPNIQAVLLPK_			0	0	0	Q99878;Q96KK5;Q9BTM1;Q16777;Q93077;Q7L7L0;Q6FI13;P20671;P0C0S8;P04908	Q99878	Q99878	HIST1H2AJ;HIST1H2AH;H2AFJ;HIST2H2AC;HIST1H2AC;HIST3H2A;HIST2H2AA3;HIST1H2AD;HIST1H2AG;HIST1H2AB	Histone H2A type 1-J;Histone H2A type 1-H;Histone H2A.J;Histone H2A type 2-C;Histone H2A type 1-C;Histone H2A type 3;Histone H2A type 2-A;Histone H2A type 1-D;Histone H2A type 1;Histone H2A type 1-B/E	MULTI-MSMS	DP1141_6	1	644.729248046875	3	644.394454	1930.16153	0.8921	0.00057487	-0.28313	-0.00018245	0.60897	0.00039242	644.3942653336017	22.671	0.34867	22.671	22.426	22.775	0					10	6	2	0	0	0	0.011333	1	17575	17575		70.335	46.975	1	2609000			2950	105	1724	1803	4001	4001		9606
VTIAQGGVLPNIQAVLLPK	19	Unmodified	_VTIAQGGVLPNIQAVLLPK_			0	0	0	Q99878;Q96KK5;Q9BTM1;Q16777;Q93077;Q7L7L0;Q6FI13;P20671;P0C0S8;P04908	Q99878	Q99878	HIST1H2AJ;HIST1H2AH;H2AFJ;HIST2H2AC;HIST1H2AC;HIST3H2A;HIST2H2AA3;HIST1H2AD;HIST1H2AG;HIST1H2AB	Histone H2A type 1-J;Histone H2A type 1-H;Histone H2A.J;Histone H2A type 2-C;Histone H2A type 1-C;Histone H2A type 3;Histone H2A type 2-A;Histone H2A type 1-D;Histone H2A type 1;Histone H2A type 1-B/E	MSMS	DP1141_7	2	966.08837890625	2	966.088043	1930.16153	NaN	NaN	NaN	NaN	NaN	NaN	NaN	22.767	1	22.767	22.267	23.267	0								0	0	0	0.021339	1	18136	18136		89.356	65.888	1				2951	105	1724	1803	4002	4002		9606
VTIAQGGVLPNIQAVLLPK	19	Unmodified	_VTIAQGGVLPNIQAVLLPK_			0	0	0	Q99878;Q96KK5;Q9BTM1;Q16777;Q93077;Q7L7L0;Q6FI13;P20671;P0C0S8;P04908	Q99878	Q99878	HIST1H2AJ;HIST1H2AH;H2AFJ;HIST2H2AC;HIST1H2AC;HIST3H2A;HIST2H2AA3;HIST1H2AD;HIST1H2AG;HIST1H2AB	Histone H2A type 1-J;Histone H2A type 1-H;Histone H2A.J;Histone H2A type 2-C;Histone H2A type 1-C;Histone H2A type 3;Histone H2A type 2-A;Histone H2A type 1-D;Histone H2A type 1;Histone H2A type 1-B/E	MULTI-MSMS	DP1141_8	3	966.470703125	2	966.088043	1930.16153	0.44585	0.00043073	-0.086986	-8.4036E-05	0.35886	0.00034669	966.5894531855135	22.719	0.31274	22.719	22.475	22.788	0					9	3	4	0	0	0	7.401600000000001E-25	2	17880	17880;17935		208.08	168.69	1	5528600			2952	105	1724	1803	4003;4004	4003		9606
VTIAQGGVLPNIQAVLLPK	19	Unmodified	_VTIAQGGVLPNIQAVLLPK_			0	0	0	Q99878;Q96KK5;Q9BTM1;Q16777;Q93077;Q7L7L0;Q6FI13;P20671;P0C0S8;P04908	Q99878	Q99878	HIST1H2AJ;HIST1H2AH;H2AFJ;HIST2H2AC;HIST1H2AC;HIST3H2A;HIST2H2AA3;HIST1H2AD;HIST1H2AG;HIST1H2AB	Histone H2A type 1-J;Histone H2A type 1-H;Histone H2A.J;Histone H2A type 2-C;Histone H2A type 1-C;Histone H2A type 3;Histone H2A type 2-A;Histone H2A type 1-D;Histone H2A type 1;Histone H2A type 1-B/E	MULTI-MSMS	DP1141_9	4	966.5901489257812	2	966.088043	1930.16153	0.56399	0.00054487	0.30534	0.00029499	0.86934	0.00083986	966.5896061419321	22.697	0.19732	22.697	22.582	22.779	0					8	2	4	0	0	0	0.00011511	1	17991	17991		176.87	142.69	1	6512600			2953	105	1724	1803	4005	4005		9606
VTIASLPR	8	Unmodified	_VTIASLPR_			0	0	0	Q12912	Q12912	Q12912	LRMP	Lymphoid-restricted membrane protein;Processed lymphoid-restricted membrane protein	MULTI-SECPEP	DP1141_9	4	855.9219360351562	1	856.525079	855.517802	0.18881	0.00016172	0.0094542	8.0977E-06	0.19826	0.00016982	856.5250346727656	16.643	0.33448	16.643	16.358	16.693	0					8	3	3	0	0	0	0.018914	1	8574	8574		67.032	2.4649	1	27894000			2954	363	1725	1804	4006	4006		9606
VTMQNLNDR	9	Unmodified	_VTMQNLNDR_			0	0	0	CON__P13645;P13645;CON__P02535-1;Q7Z3Y7;CON__Q148H6;CON__Q7Z3Y7;CON__Q7Z3Y8;CON__Q7Z3Z0;Q7Z3Y8;Q7Z3Z0;CON__Q7Z3Y9;Q7Z3Y9;CON__P02533;P02533;CON__A2A4G1;CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8	CON__P13645;CON__P02533;CON__P08779	CON__P13645	KRT10;KRT28;KRT27;KRT25;KRT26;KRT14;KRT16	Keratin, type I cytoskeletal 10;Keratin, type I cytoskeletal 28;Keratin, type I cytoskeletal 27;Keratin, type I cytoskeletal 25;Keratin, type I cytoskeletal 26;Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 16	MULTI-MSMS	DP1141_6	1	546.2425537109375	2	545.769123	1089.52369	-0.084044	-4.5868E-05	-0.15074	-8.2267E-05	-0.23478	-0.00012814	545.7695003661569	15.663	0.59636	15.663	15.408	16.005	0					10	5	3	0	0	0	0.00050388	2	6336	6336;6449		143.73	64.964	1	35515000		+	2955	17;16;9	1726	1805	4007;4008	4007		9606
VTMQNLNDR	9	Unmodified	_VTMQNLNDR_			0	0	0	CON__P13645;P13645;CON__P02535-1;Q7Z3Y7;CON__Q148H6;CON__Q7Z3Y7;CON__Q7Z3Y8;CON__Q7Z3Z0;Q7Z3Y8;Q7Z3Z0;CON__Q7Z3Y9;Q7Z3Y9;CON__P02533;P02533;CON__A2A4G1;CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8	CON__P13645;CON__P02533;CON__P08779	CON__P13645	KRT10;KRT28;KRT27;KRT25;KRT26;KRT14;KRT16	Keratin, type I cytoskeletal 10;Keratin, type I cytoskeletal 28;Keratin, type I cytoskeletal 27;Keratin, type I cytoskeletal 25;Keratin, type I cytoskeletal 26;Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 16	MULTI-MSMS	DP1141_7	2	545.7694702148438	2	545.769123	1089.52369	0.042723	2.3317E-05	0.69234	0.00037786	0.73506	0.00040117	545.7693872719068	15.664	0.40501	15.664	15.309	15.714	0					7	3	3	0	0	0	0.0253	1	7087	7087		79.906	33.954	1	42278000		+	2956	17;16;9	1726	1805	4009	4009		9606
VTMQNLNDR	9	Oxidation (M)	_VTM(Oxidation (M))QNLNDR_	VTM(1)QNLNDR	VTM(89)QNLNDR	0	1	0	CON__P13645;P13645;CON__P02535-1;Q7Z3Y7;CON__Q148H6;CON__Q7Z3Y7;CON__Q7Z3Y8;CON__Q7Z3Z0;Q7Z3Y8;Q7Z3Z0;CON__Q7Z3Y9;Q7Z3Y9;CON__P02533;P02533;CON__A2A4G1;CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8	CON__P13645;CON__P02533;CON__P08779	CON__P13645	KRT10;KRT28;KRT27;KRT25;KRT26;KRT14;KRT16	Keratin, type I cytoskeletal 10;Keratin, type I cytoskeletal 28;Keratin, type I cytoskeletal 27;Keratin, type I cytoskeletal 25;Keratin, type I cytoskeletal 26;Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 16	MSMS	DP1141_9	4	553.7670288085938	2	553.76658	1105.51861	NaN	NaN	NaN	NaN	NaN	NaN	NaN	13.74	1	13.74	13.24	14.24	0								0	0	0	0.029454	1	3937	3937		88.948	50.71	1			+	2957	17;16;9	1726	1806	4010	4010	10	9606
VTMQNLNDR	9	Oxidation (M)	_VTM(Oxidation (M))QNLNDR_	VTM(1)QNLNDR	VTM(79)QNLNDR	0	1	0	CON__P13645;P13645;CON__P02535-1;Q7Z3Y7;CON__Q148H6;CON__Q7Z3Y7;CON__Q7Z3Y8;CON__Q7Z3Z0;Q7Z3Y8;Q7Z3Z0;CON__Q7Z3Y9;Q7Z3Y9;CON__P02533;P02533;CON__A2A4G1;CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8	CON__P13645;CON__P02533;CON__P08779	CON__P13645	KRT10;KRT28;KRT27;KRT25;KRT26;KRT14;KRT16	Keratin, type I cytoskeletal 10;Keratin, type I cytoskeletal 28;Keratin, type I cytoskeletal 27;Keratin, type I cytoskeletal 25;Keratin, type I cytoskeletal 26;Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 16	MSMS	DP1141_9	4	553.9398803710938	2	553.76658	1105.51861	NaN	NaN	NaN	NaN	NaN	NaN	NaN	14.304	1	14.304	13.804	14.804	0								0	0	0	0.035867	1	4743	4743		79.474	34.782	1			+	2958	17;16;9	1726	1806	4011	4011	10	9606
VTQDELKEVFEDAAEIR	17	Unmodified	_VTQDELKEVFEDAAEIR_			0	0	1	P19338	P19338	P19338	NCL	Nucleolin	MULTI-MSMS	DP1141_7	2	664.6697387695312	3	664.66886	1990.98475	0.36311	0.00024135	0.48379	0.00032156	0.84691	0.00056291	665.0034613259368	21.76	0.30021	21.76	21.55	21.85	0					6	2	3	0	0	0	0.034231	1	16700	16700		95.9	62.635	1	10982000			2959	171	1727	1807	4012	4012		9606
VTQSNFAVGYK	11	Unmodified	_VTQSNFAVGYK_			0	0	0	P21796	P21796	P21796	VDAC1	Voltage-dependent anion-selective channel protein 1	MULTI-MSMS	DP1141_10	5	607.3145141601562	2	607.31422	1212.61389	-0.089368	-5.4274E-05	0.5875	0.00035679	0.49813	0.00030252	607.3145727362995	16.832	0.20625	16.832	16.727	16.933	0					6	3	2	0	0	0	0.0077658	1	9448	9448		94.692	63.27	1	36673000			2960	174	1728	1808	4013	4013		9606
VVDRDSEEAEIIRK	14	Unmodified	_VVDRDSEEAEIIRK_			0	0	2	P09874	P09874	P09874	PARP1	Poly [ADP-ribose] polymerase 1	MULTI-MSMS	DP1141_7	2	553.5899658203125	3	553.628448	1657.86351	-0.35832	-0.00019837	0.86125	0.00047681	0.50293	0.00027844	553.6287978702048	15.16	0.30025	15.16	15.009	15.309	0					4	2	2	0	0	0	0.035326	1	6395	6395		77.527	37.011	1	10578000			2961	131	1729	1809	4014	4014		9606
VVEEAPSIFLDAETR	15	Unmodified	_VVEEAPSIFLDAETR_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_8	3	838.9332275390625	2	838.430509	1674.84647	0.71748	0.00060156	0.66264	0.00055557	1.3801	0.0011571	838.4308451143185	20.527	0.50112	20.527	20.277	20.778	0					8	4	3	0	0	0	0.0018584	1	14780	14780		125.28	92.553	1	56447000			2962	110	1730	1810	4015	4015		9606
VVEEAPSIFLDAETRR	16	Unmodified	_VVEEAPSIFLDAETRR_			0	0	1	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_6	1	611.8321533203125	3	611.323135	1830.94758	0.75115	0.00045919	-0.15989	-9.7744E-05	0.59126	0.00036145	611.6573086805892	19.355	0.30029	19.355	19.205	19.506	0					6	2	3	0	0	0	0.016349	1	12537	12537		71.513	44.784	1	13329000			2963	110	1731	1811	4016	4016		9606
VVEEAPSIFLDAETRR	16	Unmodified	_VVEEAPSIFLDAETRR_			0	0	1	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_8	3	611.074462890625	3	611.323135	1830.94758	0.58307	0.00035645	0.22099	0.0001351	0.80406	0.00049154	611.3232849877088	19.403	0.3004	19.403	19.175	19.476	0					6	2	3	0	0	0	0.00073399	2	12938	12938;13017		145.1	112.57	1	41141000			2964	110	1731	1811	4017;4018	4017		9606
VVEGTPLIDGR	11	Unmodified	_VVEGTPLIDGR_			0	0	0	Q14739	Q14739	Q14739	LBR	Lamin-B receptor	MULTI-MSMS	DP1141_6	1	578.7954711914062	2	578.322045	1154.62954	0.90547	0.00052365	-0.14794	-8.5555E-05	0.75753	0.0004381	578.3218514160229	17.254	0.702	17.254	17.103	17.805	0					8	6	2	0	0	0	0.0045698	2	9184	9184;9227		139.98	105.79	1	28030000			2965	392	1732	1812	4019;4020	4019		9606
VVEIAPAAHLDPQLR	15	Unmodified	_VVEIAPAAHLDPQLR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_6	1	543.9768676757812	3	543.64214	1627.90459	0.77763	0.00042275	-0.28629	-0.00015564	0.49134	0.00026711	543.6419765663378	18.355	0.49959	18.355	17.905	18.405	0					9	4	4	0	0	0	0.01075	1	10858	10858		113.25	73.507	1	133500000			2966	142	1733	1813	4021	4021		9606
VVEIAPAAHLDPQLR	15	Unmodified	_VVEIAPAAHLDPQLR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	543.97705078125	3	543.64214	1627.90459	0.15882	8.634E-05	0.26562	0.0001444	0.42444	0.00023074	543.6427685267845	18.299	0.40029	18.299	18.049	18.449	0					9	3	3	0	0	0	0.01075	3	11427	11357;11365;11427		104.17	87.096	1	2325600000			2967	142	1733	1813	4022;4023;4024	4024		9606
VVEIAPAAHLDPQLR	15	Unmodified	_VVEIAPAAHLDPQLR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	815.378662109375	2	814.959571	1627.90459	0.45377	0.0003698	0.020573	1.6766E-05	0.47434	0.00038657	814.9596750448627	18.299	0.40029	18.299	18.049	18.449	0					6	3	2	0	0	0	0.0030233	1	11500	11500		130.56	97.156	1	577500000			2968	142	1733	1813	4025	4025		9606
VVEIAPAAHLDPQLR	15	Unmodified	_VVEIAPAAHLDPQLR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_8	3	543.91845703125	3	543.64214	1627.90459	0.87245	0.0004743	-0.35278	-0.00019179	0.51967	0.00028251	543.6419002518084	18.325	0.40039	18.325	17.975	18.375	0					9	3	4	0	0	0	0.0030867	2	11263	11263;11333		131.35	80.546	1	241570000			2969	142	1733	1813	4026;4027	4026		9606
VVHIMDFQR	9	Oxidation (M)	_VVHIM(Oxidation (M))DFQR_	VVHIM(1)DFQR	VVHIM(80)DFQR	0	1	0	P43243	P43243	P43243	MATR3	Matrin-3	MSMS	DP1141_7	2	580.8173217773438	2	580.797683	1159.58081	NaN	NaN	NaN	NaN	NaN	NaN	NaN	16.212	1	16.212	15.712	16.712	0								0	0	0	0.035514	1	7975	7975		79.713	41.985	1				2970	229	1734	1814	4028	4028	184	9606
VVHSYEELEENYTR	14	Unmodified	_VVHSYEELEENYTR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_10	5	590.3414916992188	3	589.944324	1766.81114	0.13918	8.2106E-05	0.70059	0.00041331	0.83976	0.00049541	589.9445358504255	17.637	0.50037	17.637	17.287	17.788	0					6	4	2	0	0	0	7.384599999999999E-53	1	10821	10821		190.34	142.73	1	70296000			2971	142	1735	1815	4029	4029		9606
VVHSYEELEENYTR	14	Unmodified	_VVHSYEELEENYTR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	884.9140014648438	2	884.412848	1766.81114	0.50789	0.00044919	-0.34134	-0.00030189	0.16655	0.0001473	884.4125531980069	17.699	0.29927	17.699	17.45	17.749	0					4	2	2	0	0	0	8.682099999999999E-67	1	10472	10472		223.77	223.77	1	266490000			2972	142	1735	1815	4030	4030		9606
VVHSYEELEENYTR	14	Unmodified	_VVHSYEELEENYTR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-SECPEP	DP1141_7	2	590.303955078125	3	589.944324	1766.81114	0.73205	0.00043187	-0.38284	-0.00022586	0.34921	0.00020601	589.9442036919517	17.699	0.39927	17.699	17.45	17.849	0					12	3	4	0	0	0	1.6512E-22	1	10423	10423		171.62	171.62	1	734200000			2973	142	1735	1815	4031	4031		9606
VVHSYEELEENYTR	14	Unmodified	_VVHSYEELEENYTR_			0	0	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-SECPEP	DP1141_8	3	590.6588134765625	3	589.944324	1766.81114	0.35914	0.00021187	0.5874	0.00034653	0.94654	0.00055841	590.2791046348997	17.624	0.40012	17.624	17.374	17.774	0					5	3	2	0	0	0	1.9705999999999998E-22	1	10306	10306		169.09	138.22	1	124780000			2974	142	1735	1815	4032	4032		9606
VVLIGGKPDR	10	Unmodified	_VVLIGGKPDR_			0	0	1	P61978	P61978	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	MULTI-SECPEP	DP1141_8	3	527.7985229492188	2	527.324391	1052.63423	0.38594	0.00020352	0.29232	0.00015415	0.67826	0.00035767	527.3245325730134	15.122	0.3978	15.122	14.972	15.37	0					8	3	3	0	0	0	0.020127	1	6160	6160		106.68	51.907	1	43679000			2975	284	1736	1816	4033	4033		9606
VVNANQNASPNVPGKR	16	Unmodified	_VVNANQNASPNVPGKR_			0	0	1	Q8IWI9	Q8IWI9	Q8IWI9	MGA	MAX gene-associated protein	MSMS	DP1141_6	1	555.6326293945312	3	555.632415	1663.87542	NaN	NaN	NaN	NaN	NaN	NaN	NaN	13.852	1	13.852	13.352	14.352	0								0	0	0	0.017645	1	3877	3877		79.81	52.985	1				2976	462	1737	1817	4034	4034		9606
VVNANQNASPNVPGKR	16	Unmodified	_VVNANQNASPNVPGKR_			0	0	1	Q8IWI9	Q8IWI9	Q8IWI9	MGA	MAX gene-associated protein	MULTI-MSMS	DP1141_7	2	555.6325073242188	3	555.632415	1663.87542	0.39239	0.00021802	-0.20919	-0.00011624	0.18319	0.00010179	555.9666121264233	13.74	0.33307	13.74	13.528	13.861	0					8	3	3	0	0	0	0.002235	2	4180	4180;4279		150.26	89.963	1	9358300			2977	462	1737	1817	4035;4036	4035		9606
VVQGDIGEANEDVTQIVEILHSGPSK	26	Unmodified	_VVQGDIGEANEDVTQIVEILHSGPSK_			0	0	0	Q86XP3	Q86XP3	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	MULTI-MSMS	DP1141_7	2	912.4696655273438	3	912.134644	2733.3821	0.53447	0.00048751	0.15782	0.00014395	0.69229	0.00063147	912.4691713301213	22.288	0.42609	22.288	22.146	22.572	0					12	4	5	0	0	0	2.6079E-17	2	17505	17505;17523		150.26	130.28	1	99275000			2978	460	1738	1818	4037;4038	4037		9606
VWDDGIIDPADTR	13	Unmodified	_VWDDGIIDPADTR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_10	5	736.8551025390625	2	736.854438	1471.69432	1.2468	0.00091868	-0.79165	-0.00058333	0.45511	0.00033535	736.8542897796888	19.926	0.59975	19.926	19.376	19.976	0					10	5	3	0	0	0	3.3434E-06	2	14402	14212;14402		152.04	98.952	1	91586000			2979	567	1739	1819	4039;4040	4040		9606
VWDDGIIDPADTR	13	Unmodified	_VWDDGIIDPADTR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MSMS	DP1141_7	2	736.8788452148438	2	736.854438	1471.69432	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.892	1	19.892	19.392	20.392	0								0	0	0	0.0092049	1	13860	13860		115	72.666	1				2980	567	1739	1819	4041	4041		9606
VWDDGIIDPADTR	13	Unmodified	_VWDDGIIDPADTR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MSMS	DP1141_7	2	736.8557739257812	2	736.854438	1471.69432	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.94	1	19.94	19.44	20.44	0								0	0	0	6.7897E-33	1	13934	13934		169.21	112.95	1				2981	567	1739	1819	4042	4042		9606
VWDDGIIDPADTR	13	Unmodified	_VWDDGIIDPADTR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_8	3	736.8550415039062	2	736.854438	1471.69432	0.66564	0.00049048	0.11594	8.543E-05	0.78158	0.00057591	736.854494375372	19.926	0.70073	19.926	19.476	20.176	0					18	6	4	0	0	0	2.4730999999999997E-52	3	13583	13461;13583;13599		192.5	132.39	1	881530000			2982	567	1739	1819	4043;4044;4045	4044		9606
VWDDGIIDPADTR	13	Unmodified	_VWDDGIIDPADTR_			0	0	0	Q9HCC0	Q9HCC0	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	MULTI-MSMS	DP1141_9	4	737.3560791015625	2	736.854438	1471.69432	0.43623	0.00032144	0.30677	0.00022605	0.743	0.00054748	736.8547265607967	19.938	0.69785	19.938	19.438	20.136	0					13	6	3	0	0	0	4.4413E-09	3	13711	13599;13711;13854		155.11	109.11	1	32281000			2983	567	1739	1819	4046;4047;4048	4047		9606
VWSPLVTEEGKR	12	Unmodified	_VWSPLVTEEGKR_			0	0	1	O00151	O00151	O00151	PDLIM1	PDZ and LIM domain protein 1	MSMS	DP1141_9	4	467.8985290527344	3	467.589265	1399.74596	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.742	1	17.742	17.242	18.242	0								0	0	0	0.0064019	1	10321	10321		98.156	51.427	1				2984	31	1740	1820	4049	4049		9606
VYADGIFDLFHSGHAR	16	Unmodified	_VYADGIFDLFHSGHAR_			0	0	0	P49585;Q9Y5K3	P49585	P49585	PCYT1A;PCYT1B	Choline-phosphate cytidylyltransferase A;Choline-phosphate cytidylyltransferase B	MULTI-SECPEP	DP1141_9	4	602.3265991210938	3	602.297032	1803.86927	-0.10719	-6.4561E-05	0.94479	0.00056905	0.8376	0.00050448	602.6319132660433	20.687	0.30004	20.687	20.437	20.737	0					4	2	2	0	0	0	0.0011567	1	14769	14769		98.676	79.688	1	6437900			2985	248	1741	1821	4050	4050		9606
VYAEDPYK	8	Unmodified	_VYAEDPYK_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_6	1	492.73748779296875	2	492.737283	983.460012	0.20735	0.00010217	0.42669	0.00021024	0.63403	0.00031241	492.73743701469147	15.753	0.59636	15.753	15.408	16.005	0					11	5	4	0	0	0	0.014138	1	6572	6572		91.626	59.156	1	25535000			2986	110	1742	1822	4051	4051		9606
VYAEDPYK	8	Unmodified	_VYAEDPYK_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_8	3	492.737548828125	2	492.737283	983.460012	0.52179	0.00025711	-0.36214	-0.00017844	0.15965	7.8666E-05	492.73709511302246	15.726	0.40371	15.726	15.472	15.876	0					9	3	4	0	0	0	1.2787E-05	2	7097	7017;7097		138.37	101.35	1	222440000			2987	110	1742	1822	4052;4053	4053		9606
VYMHLPQTDNK	11	Oxidation (M)	_VYM(Oxidation (M))HLPQTDNK_	VYM(1)HLPQTDNK	VYM(56)HLPQTDNK	0	1	0	P24928	P24928	P24928	POLR2A	DNA-directed RNA polymerase II subunit RPB1	MULTI-MSMS	DP1141_7	2	454.8847961425781	3	454.555455	1360.64454	0.56514	0.00025689	-1.6908	-0.00076858	-1.1257	-0.00051169	454.55448231625223	14.358	0.4876	14.358	14.121	14.608	0					7	4	3	0	0	0	0.030688	1	5035	5035		55.721	29.603	1	3789800			2988	185	1743	1823	4054	4054	162	9606
VYNVTQHAVGIVVNK	15	Unmodified	_VYNVTQHAVGIVVNK_			0	0	0	P46778	P46778	P46778	RPL21	60S ribosomal protein L21	MULTI-MSMS	DP1141_10	5	547.6423950195312	3	547.64214	1639.90459	-0.1885	-0.00010323	0.42882	0.00023484	0.24032	0.00013161	547.642519167438	17.538	0.50037	17.538	17.287	17.788	0					10	4	4	0	0	0	0.012233	1	10593	10593		63.727	44.199	1	82223000			2989	234	1744	1824	4055	4055		9606
WDQTADQTPGATPK	14	Unmodified	_WDQTADQTPGATPK_			0	0	0	O75533	O75533	O75533	SF3B1	Splicing factor 3B subunit 1	MULTI-MSMS	DP1141_7	2	758.3571166992188	2	758.357345	1514.70014	0.65598	0.00049747	-0.16481	-0.00012499	0.49117	0.00037248	758.3571859045624	15.664	0.60485	15.664	15.409	16.014	0					12	5	3	0	0	0	0	2	7189	7189;7239		300.35	276.36	1	307240000			2990	78	1745	1825	4056;4057	4056		9606
WECKNDTLLGIK	12	Unmodified	_WECKNDTLLGIK_			0	0	1	P22897	P22897	P22897	MRC1	Macrophage mannose receptor 1	MULTI-MSMS	DP1141_7	2	738.87939453125	2	738.879401	1475.74425	0.64956	0.00047994	0.47034	0.00034753	1.1199	0.00082747	738.8798483274	20.2	0.40076	20.2	19.95	20.351	0					6	3	2	0	0	0	0.015953	1	14394	14394		124.92	72.667	1	34008000			2991	180	1746	1826	4058	4058		9606
WEGLVYAPPGK	11	Unmodified	_WEGLVYAPPGK_			0	0	0	Q9Y2W1	Q9Y2W1	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	MULTI-SECPEP	DP1141_7	2	608.3220825195312	2	608.821681	1215.62881	0.38794	0.00023618	0.46701	0.00028432	0.85494	0.00052051	608.8218899670112	19.401	0.50094	19.401	18.95	19.451	0					6	4	2	0	0	0	0.017561	1	13074	13074		99.802	64.994	1	44949000			2992	612	1747	1827	4059	4059		9606
WELLQQVDTSTR	12	Unmodified	_WELLQQVDTSTR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MSMS	DP1141_10	5	738.3689575195312	2	738.37808	1474.74161	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.276	1	20.276	19.776	20.776	0								0	0	0	1.473E-22	1	14858	14858		157.78	103.71	1			+	2993	102	1748	1828	4060	4060		9606
WELLQQVDTSTR	12	Unmodified	_WELLQQVDTSTR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_6	1	738.8801879882812	2	738.37808	1474.74161	0.16085	0.00011877	0.39658	0.00029283	0.55743	0.0004116	738.3781176775724	20.241	0.77616	20.241	19.806	20.582	0					15	7	4	0	0	0	1.2334E-30	2	13876	13876;13940		182.28	123.59	1	237380000		+	2994	102	1748	1828	4061;4062	4061		9606
WELLQQVDTSTR	12	Unmodified	_WELLQQVDTSTR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MSMS	DP1141_7	2	738.3786010742188	2	738.37808	1474.74161	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.306	1	20.306	19.806	20.806	0								0	0	0	9.9177E-43	1	14484	14484		172.8	114.95	1			+	2995	102	1748	1828	4063	4063		9606
WELLQQVDTSTR	12	Unmodified	_WELLQQVDTSTR_			0	0	0	P04264;CON__P04264	P04264	P04264	KRT1	Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_8	3	738.3711547851562	2	738.37808	1474.74161	0.64524	0.00047643	-0.31749	-0.00023443	0.32775	0.000242	738.3772731052134	20.226	0.60076	20.226	19.877	20.477	0					10	5	3	0	0	0	3.3696999999999996E-40	2	14283	14283;14342		185.77	120.14	1	53767000		+	2996	102	1748	1828	4064;4065	4064		9606
WEWLVNQHR	9	Unmodified	_WEWLVNQHR_			0	0	0	Q9BWJ5	Q9BWJ5	Q9BWJ5	SF3B5	Splicing factor 3B subunit 5	MULTI-MSMS	DP1141_10	5	423.16827392578125	3	423.215873	1266.62579	0.76579	0.0003241	-0.32054	-0.00013566	0.44525	0.00018844	423.2156929327953	19.127	0.39943	19.127	18.977	19.376	0					7	3	3	0	0	0	0.0055249	1	13127	13127		80.438	48.944	1	77610000			2997	543	1749	1829	4066	4066		9606
WFLTCINQPQFR	12	Unmodified	_WFLTCINQPQFR_			0	0	0	P26641	P26641	P26641	EEF1G	Elongation factor 1-gamma	MULTI-MSMS	DP1141_8	3	805.9204711914062	2	805.400835	1608.78712	0.7788	0.00062725	1.0441	0.00084095	1.8229	0.0014682	805.4013756737312	21.829	0.30029	21.829	21.579	21.879	0					4	2	2	0	0	0	0.022668	1	16519	16519		96.143	26.115	1	4764500			2998	189	1750	1830	4067	4067		9606
WFNGQPIHAELSPVTDFR	18	Unmodified	_WFNGQPIHAELSPVTDFR_			0	0	0	Q01081	Q01081	Q01081	U2AF1	Splicing factor U2AF 35 kDa subunit	MSMS	DP1141_9	4	705.0262451171875	3	705.353318	2113.03812	NaN	NaN	NaN	NaN	NaN	NaN	NaN	20.548	1	20.548	20.048	21.048	0								0	0	0	0.015869	1	14693	14693		76.378	40.905	1				2999	338	1751	1831	4068	4068		9606
WLQDNLTLR	9	Unmodified	_WLQDNLTLR_			0	0	0	Q92878	Q92878	Q92878	RAD50	DNA repair protein RAD50	MULTI-MSMS	DP1141_7	2	579.808837890625	2	579.81693	1157.61931	0.58609	0.00033982	0.84057	0.00048738	1.4267	0.0008272	579.8173641747014	19.7	0.49968	19.7	19.551	20.05	0					5	4	2	0	0	0	0.027943	1	13609	13609		77.318	34.453	1	40147000			3000	497	1752	1832	4069	4069		9606
WMLAGRPHPTQK	12	Oxidation (M)	_WM(Oxidation (M))LAGRPHPTQK_	WM(1)LAGRPHPTQK	WM(93)LAGRPHPTQK	0	1	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	479.9190368652344	3	479.918839	1436.73469	-0.21981	-0.00010549	0.50346	0.00024162	0.28365	0.00013613	479.9192565267579	15.054	0.90191	15.054	14.609	15.51	0					26	8	6	0	0	0	0.0078145	1	5507	5507		92.943	52.428	1	90616000			3001	367	1753	1833	4070	4070	288	9606
WMLAGRPHPTQK	12	Unmodified	_WMLAGRPHPTQK_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	474.213623046875	3	474.587201	1420.73977	0.10644	5.0513E-05	0.37887	0.00017981	0.48531	0.00023032	474.587339555771	15.685	0.89679	15.685	15.309	16.205	0					25	8	6	0	0	0	0.013897	1	6289	6289		120.86	58.327	1	88431000			3002	367	1753	1834	4071	4071		9606
WNTDSVEEFLSEK	13	Unmodified	_WNTDSVEEFLSEK_			0	0	0	O60613	O60613	O60613	SEP15	15 kDa selenoprotein	MULTI-MSMS	DP1141_6	1	792.36572265625	2	792.364835	1582.71512	0.57138	0.00045274	2.5849	0.0020481	3.1562	0.0025009	792.3668863772486	18.055	0.50021	18.055	17.605	18.105	0					6	4	2	0	0	0	0.015305	1	10338	10338		82.831	28.108	1	31079000			3003	63	1754	1835	4072	4072		9606
WQNNLLPSR	9	Unmodified	_WQNNLLPSR_			0	0	0	P62244	P62244	P62244	RPS15A	40S ribosomal protein S15a	MULTI-MSMS	DP1141_10	5	564.302001953125	2	564.301447	1126.58834	0.67618	0.00038157	-0.16203	-9.1433E-05	0.51415	0.00029014	564.3012671524838	18.437	0.49945	18.437	17.987	18.487	0					11	4	3	0	0	0	2.3902E-08	2	11909	11909;12047		155	131.47	1	116910000			3004	288	1755	1836	4073;4074	4073		9606
WVTTASLLDYDTVAGADK	18	Unmodified	_WVTTASLLDYDTVAGADK_			0	0	0	Q15393	Q15393	Q15393	SF3B3	Splicing factor 3B subunit 3	MULTI-MSMS	DP1141_6	1	963.0068359375	2	963.478188	1924.94182	0.4897	0.00047182	0.35273	0.00033985	0.84244	0.00081167	963.9801388420584	21.558	0.4216	21.558	21.206	21.628	0					10	4	4	0	0	0	7.9546E-105	3	15766	15766;15875;15890		211.77	182.23	1	9111700			3005	402	1756	1837	4075;4076;4077	4075		9606
YCLPFLQPGR	10	Unmodified	_YCLPFLQPGR_			0	0	0	P42285	P42285	P42285	SKIV2L2	Superkiller viralicidic activity 2-like 2	MULTI-MSMS	DP1141_7	2	625.7916870117188	2	625.821158	1249.62776	0.53842	0.00033696	0.2376	0.00014869	0.77602	0.00048565	625.8211945972239	21	0.39962	21	20.75	21.15	0					5	3	2	0	0	0	0.014981	1	15640	15640		89.296	56.976	1	3753800			3006	226	1757	1838	4078	4078		9606
YDGIILPGK	9	Unmodified	_YDGIILPGK_			0	0	0	P62913	P62913	P62913	RPL11	60S ribosomal protein L11	MULTI-MSMS	DP1141_10	5	488.7813720703125	2	488.279118	974.543683	0.27922	0.00013634	0.047731	2.3306E-05	0.32695	0.00015964	488.27905622478653	18.537	0.3946	18.537	18.287	18.682	0					6	3	2	0	0	0	0.010359	1	12267	12267		98.299	67.01	1	267760000			3007	313	1758	1839	4079	4079		9606
YDGPIEILRLNNMMVTK	17	2 Oxidation (M)	_YDGPIEILRLNNM(Oxidation (M))M(Oxidation (M))VTK_	YDGPIEILRLNNM(1)M(1)VTK	YDGPIEILRLNNM(49)M(49)VTK	0	2	1	P48169	P48169	P48169	GABRA4	Gamma-aminobutyric acid receptor subunit alpha-4	MULTI-SECPEP	DP1141_10	5	680.0131225585938	3	680.348187	2038.02273	0.71925	0.00048934	-1.4328	-0.00097478	-0.71351	-0.00048544	680.347201981296	21.326	0.58413	21.326	20.875	21.459	0					8	5	2	0	0	0	0.021139	1	16443	16443		49.265	20.625	1	235720000			3008	241	1759	1840	4080	4080	190;191	9606
YDSAPATDGSGTALGWTVAWK	21	Unmodified	_YDSAPATDGSGTALGWTVAWK_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MULTI-MSMS	DP1141_10	5	718.3740844726562	3	718.676126	2153.00655	1.4397	0.0010347	-0.70471	-0.00050646	0.73503	0.00052825	719.0099933826281	21.609	0.69926	21.609	21.459	22.159	0					15	6	3	0	0	0	0	3	16874	16874;16970;16990		277.98	235.73	1	71551000		+	3009	29	1760	1841	4081;4082;4083	4081		
YDSAPATDGSGTALGWTVAWK	21	Unmodified	_YDSAPATDGSGTALGWTVAWK_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MULTI-MSMS	DP1141_10	5	1078.263916015625	2	1077.51055	2153.00655	0.53593	0.00057747	-0.19445	-0.00020952	0.34148	0.00036795	1078.0117656645943	21.609	0.79933	21.609	21.459	22.259	0					26	7	4	0	0	0	2.8381999999999998E-176	4	17251	16986;16987;17251;17616		238.88	175.01	1	833140000		+	3010	29	1760	1841	4084;4085;4086;4087	4086		
YDSAPATDGSGTALGWTVAWK	21	Unmodified	_YDSAPATDGSGTALGWTVAWK_			0	0	0	CON__Streptavidin	CON__Streptavidin	CON__Streptavidin			MSMS	DP1141_7	2	1077.5126953125	2	1077.51055	2153.00655	NaN	NaN	NaN	NaN	NaN	NaN	NaN	21.822	1	21.822	21.322	22.322	0								0	0	0	4.5305E-11	1	16710	16710		141.82	104.57	1			+	3011	29	1760	1841	4088	4088		
YEEELEINDFPQTAR	15	Unmodified	_YEEELEINDFPQTAR_			0	0	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-MSMS	DP1141_6	1	927.9324951171875	2	927.431238	1852.84792	0.15036	0.00013945	-0.13976	-0.00012961	0.010605	9.8357E-06	927.932228118787	19.69	0.49246	19.69	19.506	19.998	0					7	4	3	0	0	0	0.0034732	1	13095	13095		101.53	69.278	1	5704900			3012	445	1761	1842	4089	4089		9606
YEEELEINDFPQTAR	15	Unmodified	_YEEELEINDFPQTAR_			0	0	0	Q7L014	Q7L014	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	MULTI-MSMS	DP1141_7	2	927.931884765625	2	927.431238	1852.84792	0.38957	0.0003613	-0.06373	-5.9105E-05	0.32584	0.00030219	927.9323762949912	19.7	0.39941	19.7	19.451	19.85	0					5	3	2	0	0	0	0.0061381	1	13650	13650		114.82	89.622	1	9150100			3013	445	1761	1842	4090	4090		9606
YEELQITAGR	10	Unmodified	_YEELQITAGR_			0	0	0	P04259;P04264;CON__P04264	P04259;P04264	P04264	KRT6B;KRT1	Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 1	MULTI-MSMS	DP1141_9	4	590.3040161132812	2	590.303852	1178.59315	0.40099	0.00023671	0.059311	3.5011E-05	0.4603	0.00027172	590.3038635473433	17.588	0.5996	17.588	17.338	17.937	0					12	5	4	0	0	0	0.028111	1	10233	10233		76.17	42.167	1	173300000		+	3014	102;101	1762	1843	4091	4091		9606
YEELQQTAGR	10	Unmodified	_YEELQQTAGR_			0	0	0	CON__P13647;P13647	CON__P13647	CON__P13647	KRT5	Keratin, type II cytoskeletal 5	MULTI-MSMS	DP1141_6	1	597.7914428710938	2	597.791109	1193.56767	-0.11879	-7.1012E-05	0.36292	0.00021695	0.24413	0.00014594	597.7915272359379	15.165	0.50222	15.165	15.008	15.51	0					12	4	4	0	0	0	0.012943	1	5813	5813		91.867	55.987	1	23997000		+	3015	18	1763	1844	4092	4092		9606
YEELQQTAGR	10	Unmodified	_YEELQQTAGR_			0	0	0	CON__P13647;P13647	CON__P13647	CON__P13647	KRT5	Keratin, type II cytoskeletal 5	MULTI-MSMS	DP1141_9	4	597.7911987304688	2	597.791109	1193.56767	0.35203	0.00021044	-0.91538	-0.0005472	-0.56335	-0.00033677	597.7910314080941	15.152	0.58409	15.152	14.887	15.471	0					11	5	3	0	0	0	0.01097	1	6201	6201		96.331	62.535	1	11609000		+	3016	18	1763	1844	4093	4093		9606
YEELQVTVGR	10	Unmodified	_YEELQVTVGR_			0	0	0	CON__P35908v2;CON__P35908;P35908	CON__P35908v2	CON__P35908v2	KRT2	Keratin, type II cytoskeletal 2 epidermal	MULTI-MSMS	DP1141_6	1	598.2643432617188	2	597.311677	1192.6088	0.92099	0.00055012	-0.23161	-0.00013835	0.68938	0.00041177	597.3115844917991	17.755	0.60047	17.755	17.505	18.105	0					9	5	3	0	0	0	0.012363	1	9989	9989		93.178	42.119	1	20786000		+	3017	20	1764	1845	4094	4094		9606
YEGFFSLWK	9	Unmodified	_YEGFFSLWK_			0	0	0	Q02978	Q02978	Q02978	SLC25A11	Mitochondrial 2-oxoglutarate/malate carrier protein	MSMS	DP1141_10	5	589.010009765625	2	588.78985	1175.56515	NaN	NaN	NaN	NaN	NaN	NaN	NaN	23.019	1	23.019	22.519	23.519	0								0	0	0	4.9501E-05	1	18944	18944		139.97	77.424	1				3018	344	1765	1846	4095	4095		9606
YENEVALR	8	Unmodified	_YENEVALR_			0	0	0	CON__P13645;P13645	CON__P13645	CON__P13645	KRT10	Keratin, type I cytoskeletal 10	MULTI-SECPEP	DP1141_7	2	497.2906494140625	2	497.253631	992.49271	0.14279	7.1001E-05	0.74602	0.00037096	0.8888	0.00044196	497.25398478495964	15.964	0.29984	15.964	15.815	16.114	0					4	2	2	0	0	0	0.00072315	1	7643	7643		111.01	43.838	1	96276000		+	3019	17	1766	1847	4096	4096		9606
YESLTDPSK	9	Unmodified	_YESLTDPSK_			0	0	0	P08238;Q58FF8;P07900;Q58FF6;Q58FF7	P08238	P08238	HSP90AB1;HSP90AB2P;HSP90AA1;HSP90AB4P;HSP90AB3P	Heat shock protein HSP 90-beta;Putative heat shock protein HSP 90-beta 2;Heat shock protein HSP 90-alpha;Putative heat shock protein HSP 90-beta 4;Putative heat shock protein HSP 90-beta-3	MULTI-MSMS	DP1141_6	1	520.2606811523438	2	520.250754	1038.48696	0.01435	7.4655E-06	1.0131	0.00052709	1.0275	0.00053456	520.2511793908367	15.492	0.30439	15.492	15.309	15.613	0					4	2	2	0	0	0	0.0095425	1	6211	6211		99.136	74.933	1	2119500			3020	126	1767	1848	4097	4097		9606
YFPTQALNFAFK	12	Unmodified	_YFPTQALNFAFK_			0	0	0	P05141;P12236;P12235;Q9H0C2	P05141	P05141	SLC25A5;SLC25A6;SLC25A4;SLC25A31	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed;ADP/ATP translocase 3;ADP/ATP translocase 3, N-terminally processed;ADP/ATP translocase 1;ADP/ATP translocase 4;ADP/ATP translocase 4, N-terminally processed	MULTI-MSMS	DP1141_10	5	723.875	2	723.874445	1445.73434	1.2945	0.00093705	-0.5777	-0.00041819	0.71679	0.00051887	723.8739555861912	22.009	0.39959	22.009	21.859	22.259	0					7	3	3	0	0	0	0.015472	1	17566	17566		84.615	59.178	1	49229000			3021	109	1768	1849	4098	4098		9606
YFPTQALNFAFK	12	Unmodified	_YFPTQALNFAFK_			0	0	0	P05141;P12236;P12235;Q9H0C2	P05141	P05141	SLC25A5;SLC25A6;SLC25A4;SLC25A31	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed;ADP/ATP translocase 3;ADP/ATP translocase 3, N-terminally processed;ADP/ATP translocase 1;ADP/ATP translocase 4;ADP/ATP translocase 4, N-terminally processed	MULTI-MSMS	DP1141_6	1	724.377197265625	2	723.874445	1445.73434	0.96735	0.00070024	-0.0018816	-1.362E-06	0.96547	0.00069888	723.8743971342205	22.033	0.38945	22.033	21.865	22.254	0					14	5	4	0	0	0	0.004913	2	16558	16558;16662		114.89	85.725	1	28152000			3022	109	1768	1849	4099;4100	4099		9606
YFPTQALNFAFK	12	Unmodified	_YFPTQALNFAFK_			0	0	0	P05141;P12236;P12235;Q9H0C2	P05141	P05141	SLC25A5;SLC25A6;SLC25A4;SLC25A31	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed;ADP/ATP translocase 3;ADP/ATP translocase 3, N-terminally processed;ADP/ATP translocase 1;ADP/ATP translocase 4;ADP/ATP translocase 4, N-terminally processed	MULTI-MSMS	DP1141_7	2	723.8748168945312	2	723.874445	1445.73434	0.37186	0.00026918	0.30262	0.00021906	0.67449	0.00048824	723.8745712512091	21.996	0.29593	21.996	21.85	22.146	0					6	2	3	0	0	0	0.020424	1	17131	17131		79.986	45.453	1	21789000			3023	109	1768	1849	4101	4101		9606
YFSADHCSSVDHR	13	Unmodified	_YFSADHCSSVDHR_			0	0	0	Q5VUA4	Q5VUA4	Q5VUA4	ZNF318	Zinc finger protein 318	MULTI-SECPEP	DP1141_7	2	527.27587890625	3	527.556406	1579.64739	0.3394	0.00017905	-0.11271	-5.9463E-05	0.22668	0.00011959	527.890852870091	14.259	0.27384	14.259	14.035	14.309	0					6	2	3	0	0	0	0.017353	1	4876	4876		82.774	75.881	1	5445400			3024	425	1769	1850	4102	4102		9606
YGINTDPPK	9	Unmodified	_YGINTDPPK_			0	0	0	Q9Y3B4	Q9Y3B4	Q9Y3B4	SF3B6	Splicing factor 3B subunit 6	MULTI-MSMS	DP1141_10	5	502.75665283203125	2	502.756007	1003.49746	0.28892	0.00014526	0.25876	0.00013009	0.54767	0.00027535	502.75609093432615	15.736	1.0459	15.736	15.12	16.166	0					26	11	3	0	0	0	0.0073009	1	7193	7193		101.43	52.072	1	288760000			3025	615	1770	1851	4103	4103		9606
YGQFSGLNPGGR	12	Unmodified	_YGQFSGLNPGGR_			0	0	0	P62136	P62136	P62136	PPP1CA	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit	MULTI-MSMS	DP1141_9	4	626.8074340820312	2	626.807094	1251.59963	0.27749	0.00017393	0.34043	0.00021338	0.61792	0.00038732	626.8073331773702	17.787	0.49941	17.787	17.537	18.037	0					8	4	3	0	0	0	0.0048892	1	10416	10416		128.27	128.27	1	46461000			3026	286	1771	1852	4104	4104		9606
YGSALASAGDPGHPNHPLHASQNSAR	26	Unmodified	_YGSALASAGDPGHPNHPLHASQNSAR_			0	0	0	O95071	O95071	O95071	UBR5	E3 ubiquitin-protein ligase UBR5	MULTI-MSMS	DP1141_6	1	654.3203125	4	653.814179	2611.22761	-0.3995	-0.0002612	1.1685	0.000764	0.76903	0.0005028	654.0655268396254	14.945	0.39969	14.945	14.609	15.008	0					9	3	4	0	0	0	7.1414E-07	1	5337	5337		90.758	63.978	1	2373600			3027	88	1772	1853	4105	4105		9606
YGSALASAGDPGHPNHPLHASQNSAR	26	Unmodified	_YGSALASAGDPGHPNHPLHASQNSAR_			0	0	0	O95071	O95071	O95071	UBR5	E3 ubiquitin-protein ligase UBR5	MULTI-SECPEP	DP1141_7	2	523.2588500976562	5	523.252798	2611.22761	-0.15328	-8.0207E-05	-0.34791	-0.00018204	-0.50119	-0.00026225	523.4532779174137	14.859	0.30069	14.859	14.608	14.909	0					4	2	2	0	0	0	0.011027	1	5809	5809		51.577	39.283	1	4719200			3028	88	1772	1853	4106	4106		9606
YGVNPGPIVGTTR	13	Unmodified	_YGVNPGPIVGTTR_			0	0	0	P42166	P42166	P42166	TMPO	Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin	MULTI-MSMS	DP1141_8	3	666.0613403320312	2	665.859326	1329.7041	0.67811	0.00045152	-0.19025	-0.00012668	0.48786	0.00032484	665.859206726667	17.524	0.40086	17.524	17.273	17.674	0					8	3	3	0	0	0	0.0061663	1	10151	10151		81.625	62.953	1	190950000			3029	225	1773	1854	4107	4107		9606
YGVNPGPIVGTTR	13	Unmodified	_YGVNPGPIVGTTR_			0	0	0	P42166	P42166	P42166	TMPO	Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin	MULTI-MSMS	DP1141_9	4	665.8596801757812	2	665.859326	1329.7041	0.99393	0.00066182	-0.41272	-0.00027481	0.58122	0.00038701	665.8589941391504	17.588	0.39985	17.588	17.238	17.638	0					9	3	4	0	0	0	0.0053496	1	10078	10078		108.9	75.525	1	72418000			3030	225	1773	1854	4108	4108		9606
YHVLVNLGK	9	Unmodified	_YHVLVNLGK_			0	0	0	O75643	O75643	O75643	SNRNP200	U5 small nuclear ribonucleoprotein 200 kDa helicase	MSMS	DP1141_6	1	521.8065795898438	2	521.805834	1041.59712	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.182	1	17.182	16.682	17.682	0								0	0	0	0.009415	1	8937	8937		132.09	58.861	1				3031	80	1774	1855	4109	4109		9606
YICDNQDTISSK	12	Unmodified	_YICDNQDTISSK_			0	0	0	CON__P02769	CON__P02769	CON__P02769			MSMS	DP1141_9	4	722.3754272460938	2	722.324656	1442.63476	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.486	1	15.486	14.986	15.986	0								0	0	0	0.016597	1	6598	6598		100.88	39.717	1			+	3032	15	1775	1856	4110	4110		
YIDQEELNK	9	Unmodified	_YIDQEELNK_			0	0	0	P08238;Q58FF8;P07900;Q14568	P08238	P08238	HSP90AB1;HSP90AB2P;HSP90AA1;HSP90AA2P	Heat shock protein HSP 90-beta;Putative heat shock protein HSP 90-beta 2;Heat shock protein HSP 90-alpha;Heat shock protein HSP 90-alpha A2	MULTI-MSMS	DP1141_9	4	576.624755859375	2	576.282586	1150.55062	0.21516	0.00012399	0.44899	0.00025875	0.66415	0.00038274	576.2829459780637	15.822	0.78691	15.822	15.471	16.258	0					11	7	2	0	0	0	0.0055569	1	7130	7130		113.41	61.624	1	12708000			3033	126	1776	1857	4111	4111		9606
YIQAEPPTNK	10	Unmodified	_YIQAEPPTNK_			0	0	0	Q8TAQ2	Q8TAQ2	Q8TAQ2	SMARCC2	SWI/SNF complex subunit SMARCC2	MULTI-MSMS	DP1141_7	2	580.9514770507812	2	580.800946	1159.58734	0.31563	0.00018332	-0.33122	-0.00019237	-0.015587	-9.053E-06	580.8007937097277	14.859	0.50093	14.859	14.508	15.009	0					7	4	2	0	0	0	1.1706000000000001E-29	1	5728	5728		175.91	104.22	1	26871000			3034	480	1777	1858	4112	4112		9606
YIQQTKPLTLER	12	Unmodified	_YIQQTKPLTLER_			0	0	1	O43809	O43809	O43809	NUDT21	Cleavage and polyadenylation specificity factor subunit 5	MULTI-MSMS	DP1141_10	5	497.2843017578125	3	497.283953	1488.83003	0.44272	0.00022016	0.043818	2.179E-05	0.48654	0.00024195	497.28399704165184	16.316	0.29744	16.316	16.066	16.363	0					6	2	3	0	0	0	0.0084026	2	8537	8453;8537		153.54	114.66	1	274150000			3035	61	1778	1859	4113;4114	4114		9606
YKITDIIGK	9	Unmodified	_YKITDIIGK_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_6	1	526.2532348632812	2	525.813325	1049.6121	0.94255	0.00049561	1.1628	0.00061143	2.1054	0.001107	526.3156471049814	18.355	0.3994	18.355	18.105	18.504	0					7	3	3	0	0	0	0.0027213	1	10725	10725		107.69	61.741	1	8716900			3036	367	1779	1860	4115	4115		9606
YKPYEEALLQAEAPR	15	Unmodified	_YKPYEEALLQAEAPR_			0	0	1	Q15020	Q15020	Q15020	SART3	Squamous cell carcinoma antigen recognized by T-cells 3	MSMS	DP1141_7	2	889.4033203125	2	889.459601	1776.90465	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.754	1	18.754	18.254	19.254	0								0	0	0	6.930700000000001E-25	1	12113	12113		158.25	124.49	1				3037	398	1780	1861	4116	4116		9606
YLAEVAAGDDKK	12	Unmodified	_YLAEVAAGDDKK_			0	0	1	P63104	P63104	P63104	YWHAZ	14-3-3 protein zeta/delta	MULTI-MSMS	DP1141_10	5	640.3302001953125	2	640.330067	1278.64558	-0.66153	-0.0004236	1.0371	0.00066406	0.37553	0.00024046	640.3308279651836	14.843	0.29308	14.843	14.667	14.96	0					5	3	2	0	0	0	0.034658	1	6229	6229		114.97	59.598	1	16224000			3038	316	1781	1862	4117	4117		9606
YLANIEQQHGNSGR	14	Unmodified	_YLANIEQQHGNSGR_			0	0	0	Q9UKX7	Q9UKX7	Q9UKX7	NUP50	Nuclear pore complex protein Nup50	MULTI-SECPEP	DP1141_8	3	530.2935180664062	3	529.593849	1585.75972	0.31858	0.00016872	0.25698	0.0001361	0.57556	0.00030481	529.5939809425275	15.122	0.29881	15.122	14.873	15.172	0					4	2	2	0	0	0	0.013822	1	6001	6001		80.905	56.715	1	98745000			3039	600	1782	1863	4118	4118		9606
YLDFSSIITEVR	12	Unmodified	_YLDFSSIITEVR_			0	0	0	CON__Q7RTT2;CON__Q8N1N4-2;Q8N1N4	CON__Q7RTT2	CON__Q7RTT2	KRT78	Keratin, type II cytoskeletal 78	MULTI-SECPEP	DP1141_7	2	721.9237670898438	2	721.879924	1441.7453	0.32127	0.00023192	0.66947	0.00048328	0.99075	0.0007152	721.880490169298	22.858	0.17739	22.858	22.728	22.906	0					4	2	2	0	0	0	0.015643	1	18283	18283		105.98	90.598	1	3484500		+	3040	28	1783	1864	4119	4119		9606
YLDGLTAER	9	Unmodified	_YLDGLTAER_			0	0	0	CON__P35908v2;CON__P35908;P35908	CON__P35908v2	CON__P35908v2	KRT2	Keratin, type II cytoskeletal 2 epidermal	MULTI-MSMS	DP1141_6	1	519.7472534179688	2	519.266739	1036.51892	0.72321	0.00037554	-0.2645	-0.00013734	0.45871	0.00023819	519.2666036866776	17.655	0.40063	17.655	17.404	17.805	0					5	3	2	0	0	0	0.0042927	1	9784	9784		107.01	35.058	1	65449000		+	3041	20	1784	1865	4120	4120		9606
YLSQQWAK	8	Unmodified	_YLSQQWAK_			0	0	0	P13984	P13984	P13984	GTF2F2	General transcription factor IIF subunit 2	MULTI-MSMS	DP1141_10	5	512.26611328125	2	512.266542	1022.51853	0.059268	3.0361E-05	0.43358	0.00022211	0.49285	0.00025247	512.2666348532566	16.872	0.20625	16.872	16.727	16.933	0					6	3	2	0	0	0	0.034831	1	9483	9483		85.359	65.583	1	42536000			3042	150	1785	1866	4121	4121		9606
YLSSVSSQETQGGPLAPMTGTIEK	24	Oxidation (M)	_YLSSVSSQETQGGPLAPM(Oxidation (M))TGTIEK_	YLSSVSSQETQGGPLAPM(1)TGTIEK	YLSSVSSQETQGGPLAPM(180)TGTIEK	0	1	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_6	1	1249.6121826171875	2	1249.10997	2496.20538	0.42539	0.00053136	0.068066	8.5022E-05	0.49346	0.00061638	1249.6116298453696	18.255	0.2998	18.255	18.005	18.305	0					8	2	4	0	0	0	7.4935E-33	1	10744	10744		175.26	124.26	1	42245000			3043	521	1786	1867	4122	4122	379	9606
YLSSVSSQETQGGPLAPMTGTIEK	24	Unmodified	_YLSSVSSQETQGGPLAPMTGTIEK_			0	0	0	Q96RQ3	Q96RQ3	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	MULTI-MSMS	DP1141_8	3	1242.1136474609375	2	1241.11251	2480.21047	1.7358	0.0021543	-1.4555	-0.0018064	0.28036	0.00034796	1241.6120656208852	19.526	0.50098	19.526	19.175	19.676	0					12	4	4	0	0	0	2.9233E-139	2	13230	13230;13299		292.38	232.03	1	33844000			3044	521	1786	1868	4123;4124	4123		9606
YLTVAAVFR	9	Unmodified	_YLTVAAVFR_			0	0	0	P07437;P68371;P04350	P07437;P68371	P68371	TUBB;TUBB4B;TUBB4A	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain	MULTI-MSMS	DP1141_9	4	520.6325073242188	2	520.300384	1038.58622	0.15485	8.0567E-05	0.27833	0.00014482	0.43318	0.00022538	520.3004788465968	20.387	0.39984	20.387	20.237	20.636	0					7	3	3	0	0	0	7.299499999999999E-21	2	14564	14564;14601		173.59	128.9	1	96777000			3045	122;323	1787	1869	4125;4126	4125		9606
YLVVLYYNANR	11	Unmodified	_YLVVLYYNANR_			0	0	0	Q9Y3B4	Q9Y3B4	Q9Y3B4	SF3B6	Splicing factor 3B subunit 6	MULTI-MSMS	DP1141_10	5	694.3724975585938	2	694.372069	1386.72959	1.2049	0.00083668	-0.51033	-0.00035436	0.6946	0.00048231	694.3717243546004	20.526	0.69927	20.526	20.276	20.975	0					14	6	4	0	0	0	2.9964999999999997E-21	2	15251	15251;15264		200.1	154.42	1	138350000			3046	615	1788	1870	4127;4128	4127		9606
YLYLTPQDYK	10	Unmodified	_YLYLTPQDYK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	652.3326416015625	2	652.332079	1302.6496	0.30494	0.00019893	0.10351	6.7522E-05	0.40845	0.00026645	652.3322813115565	19.355	0.90055	19.355	18.805	19.706	0					19	8	5	0	0	0	7.6032E-67	4	12436	12248;12374;12436;12450		202.28	154.43	1	690370000			3047	367	1789	1871	4129;4130;4131;4132	4131		9606
YLYLTPQDYK	10	Unmodified	_YLYLTPQDYK_			0	0	0	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-SECPEP	DP1141_7	2	651.678466796875	2	652.332079	1302.6496	-0.24845	-0.00016207	0.99137	0.0006467	0.74292	0.00048463	652.3326468931788	19.3	0.30043	19.3	19.15	19.451	0					4	2	2	0	0	0	0.012518	1	13102	13102		97.431	62.075	1	21484000			3048	367	1789	1871	4133	4133		9606
YLYLTPQDYKR	11	Unmodified	_YLYLTPQDYKR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	487.2577209472656	3	487.257515	1458.75072	1.0603	0.00051665	-0.72262	-0.0003521	0.33771	0.00016455	487.25709419154055	18.055	0.69958	18.055	17.705	18.405	0					18	6	4	0	0	0	0.0047839	2	10310	10310;10433		94.692	63.834	1	61771000			3049	367	1790	1872	4134;4135	4134		9606
YLYLTPQDYKR	11	Unmodified	_YLYLTPQDYKR_			0	0	1	Q13085	Q13085	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	MULTI-MSMS	DP1141_6	1	731.3926391601562	2	730.382634	1458.75072	0.92945	0.00067886	1.6835	0.0012296	2.613	0.0019085	730.3824620996326	18.106	0.59991	18.106	17.705	18.305	0					11	5	3	0	0	0	0.032683	1	10464	10464		131.62	88.752	1	17476000			3050	367	1790	1872	4136	4136		9606
YMACCLLYR	9	Oxidation (M)	_YM(Oxidation (M))ACCLLYR_	YM(1)ACCLLYR	YM(98)ACCLLYR	0	1	0	P68363;A6NHL2;P68366;Q71U36	P68363;P68366;Q71U36	P68363	TUBA1B;TUBAL3;TUBA4A;TUBA1A	Tubulin alpha-1B chain;Tubulin alpha chain-like 3;Tubulin alpha-4A chain;Tubulin alpha-1A chain	MSMS	DP1141_9	4	633.2977905273438	2	633.277412	1264.54027	NaN	NaN	NaN	NaN	NaN	NaN	NaN	18.402	1	18.402	17.902	18.902	0								0	0	0	0.025938	1	11379	11379		97.602	72.749	1				3051	321;442;322	1791	1873	4137	4137	248	9606
YMDAWNTVSR	10	Oxidation (M)	_YM(Oxidation (M))DAWNTVSR_	YM(1)DAWNTVSR	YM(130)DAWNTVSR	0	1	0	Q9Y5L4	Q9Y5L4	Q9Y5L4	TIMM13	Mitochondrial import inner membrane translocase subunit Tim13	MULTI-SECPEP	DP1141_10	5	629.2896728515625	2	629.779687	1257.54482	-1.0178	-0.000641	2.0388	0.001284	1.021	0.00064301	629.780944059678	17.438	0.6005	17.438	17.187	17.788	0					10	5	3	0	0	0	0.01901	1	10506	10506		134.05	109.53	1	27942000			3052	621	1792	1874	4138	4138	428	9606
YMFIRDYKSK	10	Oxidation (M)	_YM(Oxidation (M))FIRDYKSK_	YM(1)FIRDYKSK	YM(74)FIRDYKSK	0	1	2	O75486	O75486	O75486	SUPT3H	Transcription initiation protein SPT3 homolog	MULTI-SECPEP	DP1141_7	2	684.311279296875	2	683.84483	1365.67511	0.13729	9.3883E-05	2.7518	0.0018818	2.889	0.0019757	683.8464106798085	15.059	0.30061	15.059	14.909	15.21	0					4	2	2	0	0	0	0.022081	1	6182	6182		74.173	24.139	1	10180000			3053	76	1793	1875	4139	4139	59	9606
YMPQNPHIIATK	12	Oxidation (M)	_YM(Oxidation (M))PQNPHIIATK_	YM(1)PQNPHIIATK	YM(57)PQNPHIIATK	0	1	0	Q16576	Q16576	Q16576	RBBP7	Histone-binding protein RBBP7	MULTI-SECPEP	DP1141_8	3	476.2127380371094	3	476.914983	1427.72312	0.68925	0.00032871	0.057329	2.7341E-05	0.74658	0.00035605	476.91476515579063	15.32	0.40026	15.32	15.072	15.472	0					6	3	2	0	0	0	0.034217	1	6525	6525		57.164	29.585	1	9500400			3054	410	1794	1876	4140	4140	313	9606
YNILGTNTIMDK	12	Oxidation (M)	_YNILGTNTIM(Oxidation (M))DK_	YNILGTNTIM(1)DK	YNILGTNTIM(96)DK	0	1	0	Q00839	Q00839	Q00839	HNRNPU	Heterogeneous nuclear ribonucleoprotein U	MULTI-MSMS	DP1141_6	1	699.6588134765625	2	699.850309	1397.68607	1.3951	0.00097633	3.0983	0.0021683	4.4933	0.0031447	699.8523864843927	18.255	0.49937	18.255	18.105	18.604	0					6	4	2	0	0	0	0.033487	1	11215	11215		95.618	40.069	1	9000600			3055	337	1795	1877	4141	4141	257	9606
YNPTWHCIVGR	11	Unmodified	_YNPTWHCIVGR_			0	0	0	Q96FJ2;P63167	Q96FJ2	Q96FJ2	DYNLL2;DYNLL1	Dynein light chain 2, cytoplasmic;Dynein light chain 1, cytoplasmic	MSMS	DP1141_10	5	467.90301513671875	3	468.227673	1401.66119	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.85	1	17.85	17.35	18.35	0								0	0	0	0.0032586	1	11067	11067		140.45	103.76	1				3056	317	1796	1878	4142	4142		9606
YNPTWHCIVGR	11	Unmodified	_YNPTWHCIVGR_			0	0	0	Q96FJ2;P63167	Q96FJ2	Q96FJ2	DYNLL2;DYNLL1	Dynein light chain 2, cytoplasmic;Dynein light chain 1, cytoplasmic	MULTI-SECPEP	DP1141_10	5	701.3511962890625	2	701.837871	1401.66119	0.41623	0.00029213	0.42555	0.00029867	0.84178	0.00059079	701.838403682556	17.838	0.29984	17.838	17.688	17.987	0					4	2	2	0	0	0	0.0038815	1	11060	11060		96.331	54.141	1	56440000			3057	317	1796	1878	4143	4143		9606
YPEETLSLMTK	11	Oxidation (M)	_YPEETLSLM(Oxidation (M))TK_	YPEETLSLM(1)TK	YPEETLSLM(110)TK	0	1	0	P78527	P78527	P78527	PRKDC	DNA-dependent protein kinase catalytic subunit	MSMS	DP1141_6	1	664.2930297851562	2	664.326136	1326.63772	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.834	1	17.834	17.334	18.334	0								0	0	0	0.011792	1	9995	9995		114.4	71.155	1				3058	329	1797	1879	4144	4144	252	9606
YPENFFLLR	9	Unmodified	_YPENFFLLR_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_10	5	599.8167114257812	2	599.816399	1197.61824	0.93413	0.00056031	-0.33765	-0.00020253	0.59648	0.00035778	599.8161428875626	21.709	0.4994	21.709	21.559	22.058	0					12	4	3	0	0	0	0.0010742	4	17126	16913;17009;17126;17137		128.57	67.656	1	66198000			3059	286;212;287	1798	1880	4145;4146;4147;4148	4147		9606
YPENFFLLR	9	Unmodified	_YPENFFLLR_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_6	1	599.8167114257812	2	599.816399	1197.61824	0.86945	0.00052151	-0.2405	-0.00014426	0.62895	0.00037726	599.816240721021	21.672	0.52565	21.672	21.546	22.072	0					16	6	3	0	0	0	0.0055863	3	16112	16112;16117;16325		113.5	42.12	1	23782000			3060	286;212;287	1798	1880	4149;4150;4151	4149		9606
YPENFFLLR	9	Unmodified	_YPENFFLLR_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_7	2	599.8168334960938	2	599.816399	1197.61824	0.79193	0.00047501	0.16066	9.6365E-05	0.95259	0.00057138	599.816358676205	21.7	0.49664	21.7	21.55	22.047	0					14	4	4	0	0	0	0.0044321	2	16683	16503;16683		107.9	50.473	1	31003000			3061	286;212;287	1798	1880	4152;4153	4153		9606
YPENFFLLR	9	Unmodified	_YPENFFLLR_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_8	3	599.8168334960938	2	599.816399	1197.61824	0.46543	0.00027917	0.30452	0.00018266	0.76995	0.00046183	599.8165357225738	21.729	1.1863	21.729	21.379	22.565	0					34	11	5	0	0	0	0.00082172	2	16536	16395;16536		138.83	99.863	1	251900000			3062	286;212;287	1798	1880	4154;4155	4155		9606
YPENFFLLR	9	Unmodified	_YPENFFLLR_			0	0	0	P62140;P62136;P36873	P62140;P62136;P36873	P62136	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	MULTI-MSMS	DP1141_9	4	599.816650390625	2	599.816399	1197.61824	-0.085342	-5.1189E-05	0.42945	0.00025759	0.34411	0.0002064	599.8167289228272	21.689	0.89163	21.689	21.538	22.43	0					25	9	5	0	0	0	0.00060445	3	16546	16546;16547;16761		135.77	62.102	1	414120000			3063	286;212;287	1798	1880	4156;4157;4158	4156		9606
YPENKEKR	8	Unmodified	_YPENKEKR_			0	0	2	Q5VYS8	Q5VYS8	Q5VYS8	ZCCHC6	Terminal uridylyltransferase 7	MULTI-SECPEP	DP1141_6	1	531.9303588867188	2	532.28018	1062.54581	0.79955	0.00042559	-0.67768	-0.00036071	0.12188	6.4872E-05	532.2798018329397	17.455	0.70141	17.455	17.204	17.905	0					9	6	2	0	0	0	0.0055191	1	9400	9400		107.32	6.5753	1	205090000			3064	426	1799	1881	4159	4159		9606
YPHVEDYRR	9	Unmodified	_YPHVEDYRR_			0	0	1	P61289	P61289	P61289	PSME3	Proteasome activator complex subunit 3	MULTI-SECPEP	DP1141_10	5	412.88714599609375	3	412.203633	1233.58907	0.28841	0.00011889	-0.11263	-4.6425E-05	0.17579	7.246E-05	412.20366207355147	14.995	0.49997	14.995	14.539	15.039	0					12	6	2	0	0	0	0.035242	1	6222	6222		71.223	71.223	1	38372000			3065	281	1800	1882	4160	4160		9606
YPHVEDYRR	9	Unmodified	_YPHVEDYRR_			0	0	1	P61289	P61289	P61289	PSME3	Proteasome activator complex subunit 3	MULTI-MSMS	DP1141_9	4	412.23828125	3	412.203633	1233.58907	0.35507	0.00014636	-0.21644	-8.9216E-05	0.13863	5.7145E-05	412.2035293218084	14.949	0.82811	14.949	14.247	15.075	0					25	9	5	0	0	0	0.0043226	2	5723	5723;5775		101.72	82.765	1	18255000			3066	281	1800	1882	4161;4162	4161		9606
YPMAVGLNK	9	Oxidation (M)	_YPM(Oxidation (M))AVGLNK_	YPM(1)AVGLNK	YPM(97)AVGLNK	0	1	0	Q9Y3U8	Q9Y3U8	Q9Y3U8	RPL36	60S ribosomal protein L36	MULTI-SECPEP	DP1141_10	5	504.5989074707031	2	504.762778	1007.511	0.41833	0.00021116	0.46313	0.00023377	0.88146	0.00044493	504.7627879748625	16.116	0.58204	16.116	15.781	16.363	0					7	5	2	0	0	0	0.013457	1	8206	8206		97.068	45.28	1	18698000			3067	618	1801	1883	4163	4163	427	9606
YPSLELER	8	Unmodified	_YPSLELER_			0	0	0	Q5SSJ5	Q5SSJ5	Q5SSJ5	HP1BP3	Heterochromatin protein 1-binding protein 3	MULTI-MSMS	DP1141_8	3	503.94415283203125	2	503.763832	1005.51311	0.67093	0.00033799	0.38176	0.00019231	1.0527	0.00053031	504.26552992248304	18.325	0.60098	18.325	17.874	18.475	0					6	5	2	0	0	0	0.017276	1	11369	11369		95.531	26.744	1	7617400			3068	419	1802	1884	4164	4164		9606
YRPGTVALR	9	Unmodified	_YRPGTVALR_			0	0	1	Q71DI3;Q16695;P84243;P68431;Q5TEC6;Q6NXT2	Q71DI3	Q71DI3	HIST2H3A;HIST3H3;H3F3A;HIST1H3A;HIST2H3PS2;H3F3C	Histone H3.2;Histone H3.1t;Histone H3.3;Histone H3.1;Histone H3;Histone H3.3C	MSMS	DP1141_10	5	344.8699035644531	3	344.869814	1031.58761	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.259	1	15.259	14.759	15.759	0								0	0	0	0.033363	1	6749	6749		87.258	45.829	1				3069	324	1803	1885	4165	4165		9606
YSLDPENPTK	10	Unmodified	_YSLDPENPTK_			0	0	0	P18621	P18621	P18621	RPL17	60S ribosomal protein L17	MULTI-MSMS	DP1141_10	5	582.7937622070312	2	582.282586	1162.55062	0.0012113	7.0531E-07	0.90786	0.00052863	0.90907	0.00052933	582.2828886980988	17.037	0.3902	17.037	16.797	17.187	0					10	5	2	0	0	0	0.00036875	2	9668	9567;9668		146.79	119.74	1	106130000			3070	169	1804	1886	4166;4167	4167		9606
YSLQYYMGLAEELVR	15	Oxidation (M)	_YSLQYYM(Oxidation (M))GLAEELVR_	YSLQYYM(1)GLAEELVR	YSLQYYM(180)GLAEELVR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	925.953125	2	925.953294	1849.89204	0.42843	0.00039671	0.029151	2.6992E-05	0.45758	0.0004237	925.9534261800063	23.161	0.47731	23.161	22.801	23.278	0					20	6	4	0	0	0	1.0637E-29	2	18527	18527;18536		176.87	133.33	1	98320000			3071	142	1805	1887	4168;4169	4168	146	9606
YSLQYYMGLAEELVR	15	Oxidation (M)	_YSLQYYM(Oxidation (M))GLAEELVR_	YSLQYYM(1)GLAEELVR	YSLQYYM(130)GLAEELVR	0	1	0	P11498	P11498	P11498	PC	Pyruvate carboxylase, mitochondrial	MULTI-MSMS	DP1141_7	2	617.6383666992188	3	617.637955	1849.89204	0.41805	0.0002582	0.21137	0.00013055	0.62942	0.00038875	617.6381366734183	23.161	0.34482	23.161	22.853	23.198	0					6	4	2	0	0	0	0.00058125	1	18679	18679		127.18	93.388	1	19147000			3072	142	1805	1887	4170	4170	146	9606
YSPSQNSPIHHIPSR	15	Unmodified	_YSPSQNSPIHHIPSR_			0	0	0	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_7	2	430.719482421875	4	430.719493	1718.84887	-0.023489	-1.0117E-05	0.4068	0.00017522	0.38331	0.0001651	430.719585900825	15.077	0.40086	15.077	14.809	15.21	0					14	3	5	0	0	0	0.00049081	2	6185	6185;6287		154.13	112.1	1	45910000			3073	580	1806	1888	4171;4172	4171		9606
YSPSQNSPIHHIPSR	15	Unmodified	_YSPSQNSPIHHIPSR_			0	0	0	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_7	2	573.6353149414062	3	573.956898	1718.84887	-0.018027	-1.0347E-05	1.152	0.00066121	1.134	0.00065086	573.9572196616618	15.082	0.70094	15.082	14.708	15.409	0					11	6	3	0	0	0	0.0011717	2	6266	6250;6266		155.98	113.41	1	23774000			3074	580	1806	1888	4173;4174	4174		9606
YSPSQNSPIHHIPSR	15	Unmodified	_YSPSQNSPIHHIPSR_			0	0	0	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_8	3	430.7196960449219	4	430.719493	1718.84887	0.42313	0.00018225	-0.10412	-4.4847E-05	0.31901	0.0001374	430.96989440720813	15.122	0.4975	15.122	14.873	15.37	0					9	4	4	0	0	0	0.020975	1	6192	6192		74.769	50.359	1	12656000			3075	580	1806	1888	4175	4175		9606
YSPSQNSPIHHIPSRR	16	Unmodified	_YSPSQNSPIHHIPSRR_			0	0	1	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-MSMS	DP1141_7	2	469.7339172363281	4	469.744771	1874.94998	0.47111	0.0002213	-0.26364	-0.00012384	0.20747	9.7456E-05	469.9953720627471	14.558	0.59834	14.558	14.21	14.809	0					10	5	3	0	0	0	0.026935	1	5351	5351		90.759	84.158	1	32607000			3076	580	1807	1889	4176	4176		9606
YSPSQNSPIHHIPSRR	16	Unmodified	_YSPSQNSPIHHIPSRR_			0	0	1	Q9NYF8	Q9NYF8	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	MULTI-SECPEP	DP1141_8	3	469.2726135253906	4	469.744771	1874.94998	0.22712	0.00010669	-0.28352	-0.00013318	-0.056401	-2.6494E-05	469.995413672501	14.527	0.32082	14.527	14.354	14.674	0					9	3	3	0	0	0	0.029703	1	5358	5358		44.44	23.086	1	3916200			3077	580	1807	1889	4177	4177		9606
YSPVVEAGSDMVFRWTINDK	20	Oxidation (M)	_YSPVVEAGSDM(Oxidation (M))VFRWTINDK_	YSPVVEAGSDM(1)VFRWTINDK	YSPVVEAGSDM(56)VFRWTINDK	0	1	1	P98161	P98161	P98161	PKD1	Polycystin-1	MSMS	DP1141_9	4	777.3782348632812	3	777.375571	2329.10488	NaN	NaN	NaN	NaN	NaN	NaN	NaN	17.454	1	17.454	16.954	17.954	0								0	0	0	0.030504	1	9851	9851		56.339	26.917	1				3078	334	1808	1890	4178	4178	254	9606
YSSAGTVEFLVDSK	14	Unmodified	_YSSAGTVEFLVDSK_			0	0	0	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-MSMS	DP1141_8	3	752.3594970703125	2	751.872296	1501.73004	0.77402	0.00058197	-0.028684	-2.1566E-05	0.74534	0.0005604	751.8722284341746	19.827	0.50015	19.827	19.676	20.176	0					5	4	2	0	0	0	3.2828E-05	2	13584	13584;13744		148.28	88.349	1	48603000			3079	110	1809	1891	4179;4180	4179		9606
YSSAGTVEFLVDSKK	15	Unmodified	_YSSAGTVEFLVDSKK_			0	0	1	P05165	P05165	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	MULTI-SECPEP	DP1141_8	3	544.2640991210938	3	544.282277	1629.825	0.92615	0.00050409	1.0284	0.00055972	1.9545	0.0010638	544.2836713371443	18.525	0.49998	18.525	18.175	18.675	0					7	4	3	0	0	0	2.9108E-61	1	11681	11681		201.08	152.81	1	21345000			3080	110	1810	1892	4181	4181		9606
YTIHSQLEHLQSK	13	Unmodified	_YTIHSQLEHLQSK_			0	0	0	Q9BWJ5	Q9BWJ5	Q9BWJ5	SF3B5	Splicing factor 3B subunit 5	MULTI-MSMS	DP1141_10	5	528.5783081054688	3	528.610728	1582.81036	0.29148	0.00015408	0.071462	3.7776E-05	0.36294	0.00019186	528.6107553016253	16.116	0.48482	16.116	15.781	16.266	0					6	4	2	0	0	0	6.6979E-157	2	8054	8054;8189		241.35	224.78	1	162170000			3081	543	1811	1893	4182;4183	4182		9606
YTIHSQLEHLQSK	13	Unmodified	_YTIHSQLEHLQSK_			0	0	0	Q9BWJ5	Q9BWJ5	Q9BWJ5	SF3B5	Splicing factor 3B subunit 5	MULTI-MSMS	DP1141_10	5	792.8635864257812	2	792.412454	1582.81036	0.59195	0.00046907	-0.55595	-0.00044054	0.036003	2.853E-05	792.4124084764039	16.137	0.48995	16.137	15.873	16.363	0					12	4	4	0	0	0	1.7958E-234	2	8109	8109;8235		260.57	189.42	1	21253000			3082	543	1811	1893	4184;4185	4184		9606
YVASYLLAALGGNSSPSAK	19	Unmodified	_YVASYLLAALGGNSSPSAK_			0	0	0	P05387	P05387	P05387	RPLP2	60S acidic ribosomal protein P2	MULTI-SECPEP	DP1141_10	5	935.1187133789062	2	934.991266	1867.96798	0.50921	0.00047611	-0.089235	-8.3434E-05	0.41997	0.00039267	935.4923296191292	22.108	0.39959	22.108	21.859	22.259	0					7	3	3	0	0	0	1.5268E-190	1	17622	17622		247.73	215.74	1	5555900			3083	113	1812	1894	4186	4186		9606
YVELFLNSTAGASGGAYEHR	20	Unmodified	_YVELFLNSTAGASGGAYEHR_			0	0	0	P31943	P31943	P31943	HNRNPH1	Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed	MSMS	DP1141_10	5	714.8543701171875	3	714.67987	2141.01778	NaN	NaN	NaN	NaN	NaN	NaN	NaN	19.37	1	19.37	18.87	19.87	0								0	0	0	3.0905E-05	1	13490	13490		112.74	84.76	1				3084	200	1813	1895	4187	4187		9606
YYPTEDVPRK	10	Unmodified	_YYPTEDVPRK_			0	0	1	Q02878	Q02878	Q02878	RPL6	60S ribosomal protein L6	MSMS	DP1141_9	4	423.5401306152344	3	423.215427	1266.62445	NaN	NaN	NaN	NaN	NaN	NaN	NaN	15.197	1	15.197	14.697	15.697	0								0	0	0	0.015218	1	6142	6142		81.525	34.57	1				3085	343	1814	1896	4188	4188		9606
YYTEFPTVLDITAEDPSK	18	Unmodified	_YYTEFPTVLDITAEDPSK_			0	0	0	O14929	O14929	O14929	HAT1	Histone acetyltransferase type B catalytic subunit	MULTI-MSMS	DP1141_9	4	1045.5050048828125	2	1045.00424	2087.99392	-0.20933	-0.00021875	0.24805	0.00025921	0.038719	4.0462E-05	1045.5061451775953	22.314	0.31097	22.314	22.119	22.43	0					8	3	3	0	0	0	2.267E-10	2	17421	17421;17465		159.58	127.15	1	7141600			3086	47	1815	1897	4189;4190	4189		9606
YYVTIIDAPGHR	12	Unmodified	_YYVTIIDAPGHR_			0	0	0	P68104;Q5VTE0	P68104	P68104	EEF1A1;EEF1A1P5	Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3	MULTI-MSMS	DP1141_10	5	469.257080078125	3	468.91386	1403.71975	-0.32313	-0.00015152	0.29719	0.00013936	-0.025944	-1.2166E-05	468.91409493036906	18.07	0.29986	18.07	17.887	18.187	0					4	2	2	0	0	0	0.0013741	1	11489	11489		101.3	77.224	1	7630800			3087	320	1816	1898	4191	4191		9606
