Sequence	Modifications	Mass	Mass Fractional Part	Protein Groups	Proteins	Gene Names	Protein Names	Unique (Groups)	Unique (Proteins)	Acetyl (Protein N-term)	Oxidation (M)	Missed cleavages	Fraction Average	Fraction Std. Dev.	Fraction 1	Fraction 2	Fraction 3	Fraction 4	Fraction 5	Retention time	Calibrated retention time	Charges	PEP	MS/MS scan number	Raw file	Score	Delta score	Reverse	Potential contaminant	Intensity	id	Protein group IDs	Peptide ID	Evidence IDs	MS/MS IDs	Best MS/MS	Oxidation (M) site IDs	MS/MS Count	Taxonomy IDs
AAAAAATAAAAASIR	Acetyl (Protein N-term)	1298.6943	0.69426293	485	Q8WVM8	SCFD1	Sec1 family domain-containing protein 1	yes	yes	1	0	0	3	0			1			21.4	21.4	2	0.021893	15902	DP1141_8	118.9	89.354			0	0	485	0	0	0	0		1	9606
AAAAASAPQQLSDEELFSQLR	Acetyl (Protein N-term)	2244.1022	0.10223983	611	Q9Y2U8	LEMD3	Inner nuclear membrane protein Man1	yes	yes	1	0	0	2	0		1				22.858	22.858	3	0.00056186	18247	DP1141_7	83.213	61.162			2377300	1	611	1	1	1	1		1	9606
AAAAGGGGPGTAVGATGSGIAAAAAGLAVYR	Acetyl (Protein N-term)	2555.3092	0.30921291	499	Q92922	SMARCC1	SWI/SNF complex subunit SMARCC1	yes	yes	1	0	0	2.5	0.5		1	1			22.856	22.856	3	7.815799999999999E-21	18289	DP1141_7	142.4	121.96			12920000	2	499	2	2;3	2;3	2		2	9606
AAAAVVVPAEWIK	Acetyl (Protein N-term)	1365.7656	0.76563696	478	Q8NI27	THOC2	THO complex subunit 2	yes	yes	1	0	0	2	0		1				23.393	23.393	2	0.011353	19056	DP1141_7	87.298	50.713			7593800	3	478	3	4	4	4		1	9606
AAAEQAISVR	Unmodified	1014.5458	0.54580778	340	Q01780	EXOSC10	Exosome component 10	yes	yes	0	0	0	2	0		1				15.26	15.26	2	0.0030016	6432	DP1141_7	140.11	51.935			32746000	4	340	4	5	5	5		1	9606
AAETQTLNFGPEWLR	Acetyl (Protein N-term)	1773.8686	0.86859848	439	Q6Y7W6	GIGYF2	PERQ amino acid-rich with GYF domain-containing protein 2	yes	yes	1	0	0	2	0		1				23.797	23.797	2	0.0010291	19679	DP1141_7	138.24	75.828			1278900	5	439	5	6	6	6		1	9606
AAGLATMISTMRPDIDNMDEYVR	2 Oxidation (M)	2601.1873	0.18730814	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	2	1	2.5	0.5		1	1			19.513	19.513	3	8.3903E-05	13131	DP1141_7	95.5	73.652			184100000	6	78	6	7;8	7;8;9;10	8	60;61;62	4	9606
AAGTAAALAFLSQESR	Acetyl (Protein N-term)	1604.8158	0.81583463	79	O75607	NPM3	Nucleoplasmin-3	yes	yes	1	0	0	5	0					1	24.173	24.173	2	8.2071E-06	20672	DP1141_10	149.23	107.03			7608200	7	79	7	9	11	11		1	9606
AAGVEAAAEVAATEIK	Acetyl (Protein N-term)	1541.7937	0.7937022	263	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	yes	yes	1	0	0	3.5	0.5			1	1		23.177	23.177	2	2.8668E-31	18666	DP1141_9	176.78	133.97			29020000	8	263	8	10;11	12;13;14	13		3	9606
AAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPK	Acetyl (Protein N-term);Oxidation (M)	3406.6198	0.61984352	263	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	yes	yes	1	1	1	5	0					1	23.443	23.443	3	3.3492E-15	19444	DP1141_10	80.496	64.354			4990700	9	263	9	12	15;16	15	213	2	9606
AAGVNVEPFWPGLFAK	Unmodified	1701.8879	0.88787736	112	P05386	RPLP1	60S acidic ribosomal protein P1	yes	yes	0	0	0	5	0					1	23.107	23.107	2	0.0013875	19082	DP1141_10	144.7	120.42			31410000	10	112	10	13	17;18	17		2	9606
AAIDWFDGK	Unmodified	1021.4869	0.48689592	209	P35637;Q92804	FUS;TAF15	RNA-binding protein FUS;TATA-binding protein-associated factor 2N	yes	no	0	0	0	3	0			1			20.31	20.31	2	2.3902E-08	14353	DP1141_8	155	44.686			71472000	11	209	11	14	19	19		1	9606
AANATTNPSQLLPLELVDK	Acetyl (Protein N-term)	2036.079	0.078985188	620	Q9Y4Y9	LSM5	U6 snRNA-associated Sm-like protein LSm5	yes	yes	1	0	0	5	0					1	23.577	23.577	2	9.0277E-06	19806	DP1141_10	146.59	116.56			6896500	12	620	12	15	20;21	20		2	9606
AAPEEPQQRPPEAVAAAPAGTTSSR	Unmodified	2488.2306	0.23062824	515	Q96JP5	ZFP91	E3 ubiquitin-protein ligase ZFP91	yes	yes	0	0	1	5	0					1	15.506	15.506	3	0.018072	7297	DP1141_10	49.318	31.001			9771300	13	515	13	16	22	22		1	9606
AAPGAEFAPNK	Unmodified	1071.5349	0.53490874	401	Q15233	NONO	Non-POU domain-containing octamer-binding protein	yes	yes	0	0	0	3	0			1			15.554	15.554	2	0.023196	6889	DP1141_8	78.264	31.27			25130000	14	401	14	17	23	23		1	9606
AAPGAEFAPNKR	Unmodified	1227.636	0.63601977	401	Q15233	NONO	Non-POU domain-containing octamer-binding protein	yes	yes	0	0	1	4	0.816			1	1	1	14.644	14.644	3	8.9731E-22	5402	DP1141_8	173.64	154.4			124050000	15	401	15	18;19;20	24;25;26;27	25		4	9606
AAQAGPTQPGPPR	Unmodified	1246.6418	0.64183343	541	Q9BUL5	PHF23	PHD finger protein 23	yes	yes	0	0	0	3.5	0.5			1	1		14.031	14.031	2	5.4747E-10	4469	DP1141_8	164.97	121.89			8832900	16	541	16	21;22	28;29;30;31;32;33	30		6	9606
AAQQQEEQEEKEEEDDEQTLHR	Unmodified	2698.159	0.15903902	325	P78318	IGBP1	Immunoglobulin-binding protein 1	yes	yes	0	0	1	4	0				1		15.324	15.324	4	1.4565E-06	6268	DP1141_9	91.589	75.493			15185000	17	325	17	23	34	34		1	9606
AASAAAASAAAASAASGSPGPGEGSAGGEKR	Acetyl (Protein N-term)	2584.2113	0.21134936	372	Q13263	TRIM28	Transcription intermediary factor 1-beta	yes	yes	1	0	1	2	0		1				18.199	18.199	3	0	11268	DP1141_7	286.7	251.66			176220000	18	372	18	24	35;36	35		2	9606
AASDIAMTELPPTHPIR	Oxidation (M)	1834.9247	0.92473315	290	P62258	YWHAE	14-3-3 protein epsilon	yes	yes	0	1	0	4.5	0.5				1	1	16.99	16.99	3	0.022152	9550	DP1141_10	58.814	30.002			22230000	19	290	19	25;26	37;38	37	233	1	9606
AASVHTVGEDTEETPHR	Unmodified	1834.8446	0.84456858	528	Q99575	POP1	Ribonucleases P/MRP protein subunit POP1	yes	yes	0	0	0	1.33	0.471	2	1				13.918	13.918	3;4	0.00010325	4431	DP1141_7	109.1	86.117			14325000	20	528	20	27;28;29	39;40;41;42	41		4	9606
AATASAGAGGIDGKPR	Acetyl (Protein N-term)	1440.7321	0.732105	344	Q02978	SLC25A11	Mitochondrial 2-oxoglutarate/malate carrier protein	yes	yes	1	0	1	3.33	1.7	1			1	1	15.351	15.351	2	0	6880	DP1141_10	256.95	206.47			59721000	21	344	21	30;31;32	43;44;45	43		3	9606
AATGEEVSAEDLGGADLHCR	Unmodified	2056.912	0.91199621	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3.33	0.471			2	1		17.245	17.245	2;3	2.7645E-07	9457	DP1141_9	121.26	73.348			2800600000	22	567	22	33;34;35	46;47;48;49;50;51	51		6	9606
AATGEEVSAEDLGGADLHCRK	Unmodified	2185.007	0.0069592315	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	1	3	0			1			16.326	16.326	4	0.017423	7952	DP1141_8	48.376	38.765			16335000	23	567	23	36	52	52		0	9606
AAVENLPTFLVELSR	Unmodified	1657.9039	0.90392136	395	Q14974	KPNB1	Importin subunit beta-1	yes	yes	0	0	0	2.5	0.5		1	1			23.451	23.451	2	5.2361E-100	19167	DP1141_7	213.63	180.57			35433000	24	395	24	37;38	53;54	53		2	9606
AAVLLEQER	Unmodified	1027.5662	0.56620887	374	Q13435	SF3B2	Splicing factor 3B subunit 2	yes	yes	0	0	0	2	0		1				16.534	16.534	2	2.7365E-05	8517	DP1141_7	141.52	67.217			0	25	374	25	39	55	55		1	9606
AAVLQQVLER	Acetyl (Protein N-term)	1167.6612	0.66117189	144	P12270	TPR	Nucleoprotein TPR	yes	yes	1	0	0	2	0		1				24.042	24.042	2	0.00086672	20049	DP1141_7	127.68	84.028			5159900	26	144	26	40	56	56		1	9606
AAVSAFPTDSLER	Unmodified	1362.6779	0.67794416	44	O14654	IRS4	Insulin receptor substrate 4	yes	yes	0	0	0	1	0	1					18.442	18.442	2	0.023491	10978	DP1141_6	121.61	78.743			0	27	44	27	41	57	57		1	9606
AAYFGIYDTAK	Unmodified	1218.5921	0.59208927	109	P05141	SLC25A5	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed	yes	yes	0	0	0	1	0	1					19.355	19.355	2	0.0030329	12352	DP1141_6	155.58	131.35			5788000	28	109	28	42	58	58		1	9606
ACTELGIR	Unmodified	918.4593	0.45930096	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2.33	1.25	1	1		1		16.061	16.061	2	1.2644E-09	7661	DP1141_7	158.38	43.658			415870000	29	142	29	43;44;45	59;60;61	60		1	9606
ACTILLR	Unmodified	845.47931	0.47930812	246	P49368	CCT3	T-complex protein 1 subunit gamma	yes	yes	0	0	0	3	0			1			17.223	17.223	2	0.03323	9486	DP1141_8	92.692	42.573			22024000	30	246	30	46	62	62		1	9606
ADEAYLIGR	Unmodified	1006.5084	0.50835964	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	3	2	1				1	17.773	17.773	2	2.2383E-51	9901	DP1141_6	191.63	117.37			26589000	31	142	31	47;48	63;64;65	64		2	9606
ADEGISFR	Unmodified	893.4243	0.42429566	348	Q06830	PRDX1	Peroxiredoxin-1	yes	yes	0	0	0	5	0					1	16.893	16.893	2	0.029014	9636	DP1141_10	86.794	33.442			18088000	32	348	32	49	66	66		1	9606
ADFAQACQDAGVR	Unmodified	1407.6201	0.62011171	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	1	0	1					16.75	16.75	2	1.6017999999999998E-32	8226	DP1141_6	165.63	123.29			0	33	142	33	50	67	67		1	9606
ADGELNVDSLITR	Acetyl (Protein N-term)	1443.7205	0.72053726	287	P62140	PPP1CB	Serine/threonine-protein phosphatase PP1-beta catalytic subunit	yes	yes	1	0	0	4	0				1		22.236	22.236	2	0.0046614	17333	DP1141_9	107.34	62.704			121490000	34	287	34	51	68;69	69		2	9606
ADLDKLNIDSIIQR	Acetyl (Protein N-term)	1654.889	0.88899957	212	P36873	PPP1CC	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	yes	yes	1	0	1	4	0				1		21.979	21.979	2	0.0010603	16965	DP1141_9	145.81	108.48			97759000	35	212	35	52	70;71;72	71		3	9606
ADLEMQIESLTEELAYLKK	Oxidation (M)	2239.1294	0.12936578	17	CON__P13645;P13645	KRT10	Keratin, type I cytoskeletal 10	yes	no	0	1	1	2	0		1				23.692	23.692	3	0.00010175	19665	DP1141_7	123.63	91.442		+	7564000	36	17	36	53	73	73	14	1	9606
ADLLGSILSSMEKPPSLGDQETR	Acetyl (Protein N-term);Oxidation (M)	2501.2319	0.23193337	73	O75391	SPAG7	Sperm-associated antigen 7	yes	yes	1	1	1	5	0					1	23.581	23.581	3	1.9535000000000003E-24	19797	DP1141_10	166.34	137.99			12540000	37	73	37	54	74;75	74	57	2	9606
ADQSFTSPPPR	Unmodified	1201.5728	0.57275081	411	Q9HBM6;Q16594	TAF9B;TAF9	Transcription initiation factor TFIID subunit 9B;Transcription initiation factor TFIID subunit 9	yes	no	0	0	0	5	0					1	15.291	15.291	2	0.014827	6804	DP1141_10	102.06	66.624			0	38	411	38	55	76	76		1	9606
ADRDESSPYAAMLAAQDVAQR	Oxidation (M)	2280.0441	0.044073019	291	P62263	RPS14	40S ribosomal protein S14	yes	yes	0	1	1	5	0					1	17.735	17.735	3	2.9031E-07	10921	DP1141_10	108.37	86.976			33886000	39	291	39	56	77	77	234	1	9606
ADVFHAYLSLLK	Unmodified	1375.75	0.7499869	458	Q86VP6	CAND1	Cullin-associated NEDD8-dissociated protein 1	yes	yes	0	0	0	2	0		1				22.288	22.288	2	0.017753	17511	DP1141_7	82.831	54.749			26460000	40	458	40	57	78	78		1	9606
AEAEAQAEELSFPR	Unmodified	1546.7264	0.72635092	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2.75	0.829		2	1	1		18.578	18.578	2;3	0	11873	DP1141_7	369.42	325.98			956080000	41	142	41	58;59;60;61	79;80;81;82;83;84	80		6	9606
AEAESWYQTK	Unmodified	1211.5459	0.54586736	10;101	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;O95678;CON__O95678;CON__Q8VED5;P04259	KRT6A;KRT6C;KRT75;KRT6B	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 75;Keratin, type II cytoskeletal 6B	no	no	0	0	0	4	0				1		16.907	16.907	2	5.8859000000000006E-154	9024	DP1141_9	239.66	186.88		+	32654000	42	10;101	42	62	85;86	85		2	9606
AEDGATPSPSNETPK	Unmodified	1499.674	0.673981	195	P29966	MARCKS	Myristoylated alanine-rich C-kinase substrate	yes	yes	0	0	0	3	0			1			14.086	14.086	2	0.021648	4648	DP1141_8	72.289	38.911			4589900	43	195	43	63	87	87		1	9606
AEDKEWMPVTK	Oxidation (M)	1348.6333	0.63330216	155	P15880	RPS2	40S ribosomal protein S2	yes	yes	0	1	1	4	0				2		15.214	15.214	2;3	0.0056035	6119	DP1141_9	134.56	106.28			25741000	44	155	44	64;65	88;89	88	151	2	9606
AEFVEVTK	Unmodified	921.48075	0.48074791	15	CON__P02769			yes	yes	0	0	0	3	2	1				1	16.28	16.28	2	2.234E-21	8468	DP1141_10	161.9	82.447		+	0	45	15	45	66;67	90;91	90		2	
AELDDTPMR	Unmodified	1046.4703	0.47025958	181	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	yes	yes	0	0	0	3	0			1			16.072	16.072	2	0.010561	7681	DP1141_8	119.27	75.467			2868100	46	181	46	68	92	92		0	9606
AEPGEGTRPATVGDSSAR	Unmodified	1756.834	0.83400389	539	Q9BTC0	DIDO1	Death-inducer obliterator 1	yes	yes	0	0	1	2	0		1				13.99	13.99	3	0.0018128	4469	DP1141_7	84.195	54.019			14045000	47	539	47	69	93	93		0	9606
AEPYCSVLPGFTFIQHLPLSER	Unmodified	2560.2784	0.27843005	540	Q9BUJ2	HNRNPUL1	Heterogeneous nuclear ribonucleoprotein U-like protein 1	yes	yes	0	0	0	2	0		1				22.953	22.953	3	5.4112E-07	18307	DP1141_7	127.1	100.74			28970000	48	540	48	70	94;95	94		2	9606
AFAVVASALGIPSLLPFLK	Unmodified	1913.139	0.13900667	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	2	0		1				25.677	25.677	2	4.0507E-125	22335	DP1141_7	219.89	208.44			4064000	49	78	49	71	96;97	96		2	9606
AFENDVDALCNLR	Unmodified	1535.7038	0.70384134	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3	0			1			20.026	20.026	2	2.2841999999999997E-66	13914	DP1141_8	247.22	204.89			29898000	50	111	50	72	98;99	98		2	9606
AFHNEAQVNPER	Unmodified	1410.664	0.66402543	165	P17987	TCP1	T-complex protein 1 subunit alpha	yes	yes	0	0	0	2.8	1.6	2		1	1	1	14.234	14.234	2;3	0.0014285	4530	DP1141_6	111.94	102.19			162690000	51	165	51	73;74;75;76;77	100;101;102;103;104;105;106	103		5	9606
AFLADPSAFVAAAPVAAATTAAPAAAAAPAK	Unmodified	2751.4596	0.45956554	114	P05388	RPLP0	60S acidic ribosomal protein P0	yes	yes	0	0	0	4	0				1		21.782	21.782	3	1.7911E-38	16624	DP1141_9	165.01	142.31			29935000	52	114	52	78	107;108	108		2	9606
AFVDFLSDEIKEER	Unmodified	1696.8308	0.83081599	350	Q07021	C1QBP	Complement component 1 Q subcomponent-binding protein, mitochondrial	yes	yes	0	0	1	5	0					1	21.126	21.126	3	2.7825999999999996E-52	16224	DP1141_10	193	143.64			129050000	53	350	53	79	109;110	109		2	9606
AFYGDTLVTGFAR	Unmodified	1416.7038	0.70376498	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	2	1	1		1			20.87	20.87	2	5.1193E-140	14731	DP1141_6	242.12	189.4			1183900000	54	567	54	80;81	111;112;113	111		2	9606
AFYPEEISSMVLTK	Oxidation (M)	1629.796	0.79601039	135	P0DMV8;P0DMV9;P34931	HSPA1A;HSPA1B;HSPA1L	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like	yes	no	0	1	0	3.67	0.943			2		1	20.26	20.26	2;3	1.2012E-13	14198	DP1141_8	166.29	133.23			291970000	55	135	55	82;83;84	114;115;116;117;118;119;120	118	126	7	9606
AFYPEEISSMVLTK	Unmodified	1613.8011	0.80109577	135	P0DMV8;P0DMV9;P34931	HSPA1A;HSPA1B;HSPA1L	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like	yes	no	0	0	0	3.5	0.5			1	1		21.709	21.709	2	6.4877E-09	16327	DP1141_8	158.08	109.66			269160000	56	135	55	85;86	121;122;123	121		2	9606
AGAAGGPEEEAEKPVK	Unmodified	1538.7577	0.75765105	486	Q8WW12	PCNP	PEST proteolytic signal-containing nuclear protein	yes	yes	0	0	1	5	0					2	13.904	13.904	2;3	4.1248E-08	4578	DP1141_10	155.88	124.82			248870000	57	486	56	87;88	124;125;126	126		3	9606
AGAGSATLSMAYAGAR	Oxidation (M)	1469.6933	0.69327665	223	P40926	MDH2	Malate dehydrogenase, mitochondrial	yes	yes	0	1	0	2	0		1				16.565	16.565	2	0.022845	8583	DP1141_7	77.593	51.079			7755000	58	223	57	89	127	127	182	0	9606
AGGGGGKR	Unmodified	658.35107	0.35107114	172	P20648	ATP4A	Potassium-transporting ATPase alpha chain 1	yes	yes	0	0	1	2	0		1				31.129	31.129	1	0.035861	29006	DP1141_7	18.805	0.95727			634160	59	172	58	90	128	128		0	9606
AGLELLSDQGYR	Acetyl (Protein N-term)	1362.6779	0.67794416	570	Q9NPD3	EXOSC4	Exosome complex component RRP41	yes	yes	1	0	0	5	0					1	22.644	22.644	2	1.0434999999999999E-66	18484	DP1141_10	200.6	149.54			89778000	60	570	59	91	129;130	129		2	9606
AGLQFPVGR	Unmodified	943.52395	0.52395013	105;133	Q99878;Q96KK5;Q9BTM1;Q16777;Q93077;Q7L7L0;Q6FI13;P20671;P0C0S8;P04908;Q96QV6;P16104;Q8IUE6;Q71UI9;P0C0S5	HIST1H2AJ;HIST1H2AH;H2AFJ;HIST2H2AC;HIST1H2AC;HIST3H2A;HIST2H2AA3;HIST1H2AD;HIST1H2AG;HIST1H2AB;HIST1H2AA;H2AFX;HIST2H2AB;H2AFV;H2AFZ	Histone H2A type 1-J;Histone H2A type 1-H;Histone H2A.J;Histone H2A type 2-C;Histone H2A type 1-C;Histone H2A type 3;Histone H2A type 2-A;Histone H2A type 1-D;Histone H2A type 1;Histone H2A type 1-B/E;Histone H2A type 1-A;Histone H2AX;Histone H2A type 2-B;Histone H2A.V;Histone H2A.Z	no	no	0	0	0	3.33	1.7	1			1	1	18.485	18.485	2	3.1037E-05	12170	DP1141_10	147.69	73.719			577390000	61	105;133	60	92;93;94	131;132;133;134;135;136;137	133		6	9606
AGNFYVPAEPK	Unmodified	1191.5924	0.59242362	167	P18124	RPL7	60S ribosomal protein L7	yes	yes	0	0	0	5	0					1	17.637	17.637	2	0.0064476	10715	DP1141_10	107.45	52.844			23099000	62	167	61	95	138	138		0	9606
AGNGQWASVIR	Unmodified	1157.5942	0.59415496	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	0	3	0			1			18.225	18.225	2	0.0053286	11056	DP1141_8	97.565	63.769			7739300	63	402	62	96	139	139		0	9606
AGTHILCIK	Unmodified	1011.5535	0.55353569	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	1	0	1					15.855	15.855	2	0.0051441	6781	DP1141_6	138.54	102.15			6098200	64	142	63	97	140	140		0	9606
AHEVGAQGGPPVAQVEQDLPISR	Unmodified	2354.1979	0.19787154	388	Q14676	MDC1	Mediator of DNA damage checkpoint protein 1	yes	yes	0	0	0	2	0		1				18.9	18.9	3	1.1839E-100	12282	DP1141_7	205.53	190.49			72788000	65	388	64	98	141;142	141		2	9606
AHQVVEDGYEFFAK	Unmodified	1638.7678	0.7678218	286;212;287	P62140;P62136;P36873	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	no	no	0	0	0	3.67	1.25		1		1	1	18.987	18.987	2;3	6.3763E-87	12335	DP1141_7	194.06	147.21			204940000	66	287;286;212	65	99;100;101	143;144;145	144		3	9606
AHQVVEDGYEFFAKR	Unmodified	1794.8689	0.86893283	286;212;287	P62140;P62136;P36873	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	no	no	0	0	1	3	0			3			18.225	18.225	2;3;4	1.7789E-238	11451	DP1141_8	277.06	234.73			63478000	67	287;286;212	66	102;103;104	146;147;148	146		1	9606
AHSSMVGVNLPQK	Oxidation (M)	1382.6976	0.69763375	97	P00558	PGK1	Phosphoglycerate kinase 1	yes	yes	0	1	0	2	0		1				14.874	14.874	3	0.033078	5937	DP1141_7	54.65	17.966			16811000	68	97	67	105	149	149	80	0	9606
AIADTGANVVVTGGK	Unmodified	1371.7358	0.73579339	257	P50990	CCT8	T-complex protein 1 subunit theta	yes	yes	0	0	0	3.5	0.5			1	1		16.627	16.627	2	0.0070494	8499	DP1141_8	109.39	70.635			123090000	69	257	68	106;107	150;151;152	150		3	9606
AIEAAPQEPEQK	Unmodified	1309.6514	0.65139506	504	Q96CP2	FLYWCH2	FLYWCH family member 2	yes	yes	0	0	0	5	0					1	14.634	14.634	2	0.0062471	5794	DP1141_10	99.788	75.799			10575000	70	504	69	108	153	153		0	9606
AIEALHGHELRPGR	Unmodified	1554.8379	0.83790748	519	Q96PK6	RBM14	RNA-binding protein 14	yes	yes	0	0	1	3	0			1			14.923	14.923	3	0.011211	5783	DP1141_8	113.24	79.239			10716000	71	519	70	109	154	154		0	9606
AIEPPPLDAVIEAEHTLR	Unmodified	1970.0473	0.047291129	357	Q08211	DHX9	ATP-dependent RNA helicase A	yes	yes	0	0	0	1	0	1					21.335	21.335	3	0.024751	15641	DP1141_6	60.093	41.333			6171700	72	357	71	110	155	155		1	9606
AIEVLSDEHAR	Unmodified	1238.6255	0.62551466	569	Q9HCS7	XAB2	Pre-mRNA-splicing factor SYF1	yes	yes	0	0	0	2	0		1				15.765	15.765	3	0.0025717	7236	DP1141_7	100.88	69.12			15686000	73	569	72	111	156	156		1	9606
AIGIGAYLVR	Unmodified	1031.6128	0.61276513	367;40	Q13085;O00763	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	no	no	0	0	0	1.5	0.5	1	1				20.12	20.12	2	0.024372	14339	DP1141_7	79.469	9.4701			447000000	74	367;40	73	112;113	157;158	158		2	9606
AIGPHDVLATLLNNLK	Unmodified	1687.9621	0.96210494	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	3.5	1.12		2	2	2	2	23.439	23.439	2;3	8.505100000000001E-162	18874	DP1141_7	239.48	210.9			495980000	75	78	74	114;115;116;117;118;119;120;121	159;160;161;162;163;164;165;166;167;168;169;170;171;172;173	162		15	9606
AIGYLIPLMDAEYANYYTR	Unmodified	2236.0874	0.087441384	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	2	0		1				23.914	23.914	2	6.527E-07	19955	DP1141_7	166.7	123.41			8890000	76	78	75	122	174	174		1	9606
AIIIFVPVPQLK	Unmodified	1336.8482	0.84824438	285	P62081	RPS7	40S ribosomal protein S7	yes	yes	0	0	0	5	0					1	22.644	22.644	2	0.0025761	18402	DP1141_10	123.98	123.98			63288000	77	285	76	123	175;176	176		2	9606
AIIRHSDLVTK	Unmodified	1251.7299	0.72992016	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	1	0	1					14.559	14.559	3	0.010474	4813	DP1141_6	99.343	73.869			22501000	78	367	77	124	177	177		0	9606
AILVDLEPGTMDSVR	Oxidation (M)	1630.8236	0.82362212	122;381;376	P07437;Q13885;Q9BVA1;Q13509	TUBB;TUBB2A;TUBB2B;TUBB3	Tubulin beta chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain	no	no	0	1	0	3.5	1.12		1	1	1	1	19.653	19.653	2	7.1229E-140	13359	DP1141_9	232.56	162.3			507960000	79	122;381;376	78	125;126;127;128	178;179;180;181;182	181	106	5	9606
AILVDLEPGTMDSVR	Unmodified	1614.8287	0.8287075	122;381;376	P07437;Q13885;Q9BVA1;Q13509	TUBB;TUBB2A;TUBB2B;TUBB3	Tubulin beta chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain	no	no	0	0	0	3.5	0.5			1	1		20.607	20.607	2	3.6722E-100	14842	DP1141_8	215.08	137.35			248190000	80	122;381;376	78	129;130	183;184	183		2	9606
AIQGGTSHHLGQNFSK	Unmodified	1680.8332	0.83321603	123	P07814	EPRS	Bifunctional glutamate/proline--tRNA ligase;Glutamate--tRNA ligase;Proline--tRNA ligase	yes	yes	0	0	0	2	0		1				14.358	14.358	3	0.0011022	5075	DP1141_7	101.75	101.75			33487000	81	123	79	131	185	185		0	9606
AITFLQSATR	Unmodified	1106.6084	0.60840804	207	P35249	RFC4	Replication factor C subunit 4	yes	yes	0	0	0	4	0				1		18.687	18.687	2	0.0055692	11847	DP1141_9	112.11	30.811			10024000	82	207	80	132	186	186		0	9606
AIVNVIGMHK	Oxidation (M)	1096.6063	0.60629955	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	1	0	2	0		1				15.964	15.964	2	0.0119	7497	DP1141_7	98.629	98.629			125800000	83	78	81	133	187	187	63	0	9606
ALAAAGYDVEKNNSR	Unmodified	1577.7798	0.77978347	157	P16403;P10412;P16402;P22492;Q02539	HIST1H1C;HIST1H1E;HIST1H1D;HIST1H1T;HIST1H1A	Histone H1.2;Histone H1.4;Histone H1.3;Histone H1t;Histone H1.1	yes	no	0	0	1	4	0				1		15.324	15.324	3	0.018997	6368	DP1141_9	115.37	71.575			23924000	84	157	82	134	188	188		1	9606
ALAVSDLNR	Unmodified	957.52434	0.52434406	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	3	1.41	1	1	1	1	1	16.618	16.618	2	3.4677000000000004E-29	8622	DP1141_7	178.6	64.898			1784499999.9999998	85	142	83	135;136;137;138;139	189;190;191;192;193;194;195	192		5	9606
ALAVVYGPHEIR	Unmodified	1323.7299	0.72992016	570	Q9NPD3	EXOSC4	Exosome complex component RRP41	yes	yes	0	0	0	5	0					1	17.137	17.137	3	0.0043607	9969	DP1141_10	111.27	85.374			23771000	86	570	84	140	196	196		0	9606
ALDEYYDK	Unmodified	1015.4498	0.44984171	216	P38606	ATP6V1A	V-type proton ATPase catalytic subunit A	yes	yes	0	0	0	5	0					1	16.576	16.576	2	0.017017	8956	DP1141_10	89.752	74.12			5802100	87	216	85	141	197	197		1	9606
ALEEANADLEVK	Unmodified	1300.6511	0.65106071	16;9	CON__P02533;P02533;CON__Q6IFX2;CON__P19012;P19012;CON__P08779;P08779	KRT14;KRT15;KRT16	Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 15;Keratin, type I cytoskeletal 16	no	no	0	0	0	4	0				1		16.979	16.979	2	3.3578E-05	9081	DP1141_9	137.46	83.966		+	0	88	9;16	86	142	198	198		1	9606
ALEESNYELEGK	Unmodified	1380.6409	0.64088996	17	CON__P13645;P13645;CON__P02535-1	KRT10	Keratin, type I cytoskeletal 10	yes	no	0	0	0	3	1.41	1	1	1	1	1	16.9	16.9	2	4.1342E-81	9129	DP1141_7	210.27	176.35		+	1859599999.9999998	89	17	87	143;144;145;146;147	199;200;201;202;203;204;205;206;207	202		9	9606
ALELSGTAVPPDLEK	Unmodified	1538.8192	0.81918867	445	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	yes	yes	0	0	0	1	0	1					19.055	19.055	2	0.020125	12138	DP1141_6	75.819	37.825			6939900	90	445	88	148	208	208		1	9606
ALEPTGQSGEAVK	Unmodified	1285.6514	0.65139506	488	Q8WX92	NELFB	Negative elongation factor B	yes	yes	0	0	0	4	0				1		14.706	14.706	2	4.1223E-05	5365	DP1141_9	138.25	65.762			0	91	488	89	149	209	209		1	9606
ALFPEPR	Unmodified	828.44939	0.4493882	514	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	yes	yes	0	0	0	2	0		1				17.799	17.799	2	0.021023	10597	DP1141_7	101.21	58.438			33468000	92	514	90	150	210;211	211		2	9606
ALFPGDSEIDQLFR	Unmodified	1606.7991	0.79912193	186	P24941;Q00526	CDK2;CDK3	Cyclin-dependent kinase 2;Cyclin-dependent kinase 3	yes	no	0	0	0	4	0				1		23.085	23.085	2	0.0069285	18532	DP1141_9	91.469	63.456			3395100	93	186	91	151	212	212		1	9606
ALGEPITLFGEGPAER	Unmodified	1655.8519	0.85188578	56	O43172	PRPF4	U4/U6 small nuclear ribonucleoprotein Prp4	yes	yes	0	0	0	3	0			1			20.987	20.987	2	0.0016687	15381	DP1141_8	152.67	137.57			22267000	94	56	92	152	213	213		1	9606
ALMDMMGGVLEVK	3 Oxidation (M)	1440.6663	0.66625855	473	Q8NDM7	CFAP43	Cilia- and flagella-associated protein 43	yes	yes	0	3	0	5	0					1	19.824	19.824	2	0.033877	14179	DP1141_10	50.353	12.077			0	95	473	93	153	214	214	349;350;351	1	9606
ALPNNTSSSPQPK	Unmodified	1339.6732	0.67319314	104	P04637	TP53	Cellular tumor antigen p53	yes	yes	0	0	0	3.25	1.48	1		1	1	1	13.888	13.888	2	0.0016031	4175	DP1141_9	123.86	85.11			19168000	96	104	94	154;155;156;157	215;216;217;218;219;220	220		6	9606
ALQDEWDAVMLHSFTLR	Oxidation (M)	2046.9833	0.98331066	603	Q9UMS4	PRPF19	Pre-mRNA-processing factor 19	yes	yes	0	1	0	3	0			1			21.445	21.445	3	0.032707	16117	DP1141_8	47.64	36.265			13058000	97	603	95	158	221	221	419	1	9606
ALTSFLPAPTQLSQDQLEAEEK	Acetyl (Protein N-term)	2457.2275	0.22749992	377	Q13573	SNW1	SNW domain-containing protein 1	yes	yes	1	0	0	4	1			1		1	24.067	24.067	2;3	3.94E-139	19878	DP1141_8	221.85	184.5			21851000	98	377	96	159;160	222;223;224;225	225		4	9606
ALTVPELTQQMFDAK	Oxidation (M)	1706.8549	0.85492225	323;376	P68371;P04350;Q13509	TUBB4B;TUBB4A;TUBB3	Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-3 chain	no	no	0	1	0	1	0	1					19.658	19.658	2	0.033768	13184	DP1141_6	108.56	19.207			9594700	99	323;376	97	161	226	226	249	1	9606
ALTVPELTQQMFDAK	Unmodified	1690.86	0.86000763	323;376	P68371;P04350;Q13509	TUBB4B;TUBB4A;TUBB3	Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-3 chain	no	no	0	0	0	3.5	0.5			1	1		21.905	21.905	2	3.5276E-10	16608	DP1141_8	163.45	103.19			33236000	100	323;376	97	162;163	227;228;229	227		3	9606
ALTVPELTQQMFDSK	Unmodified	1706.8549	0.85492225	381	Q13885;Q9BVA1	TUBB2A;TUBB2B	Tubulin beta-2A chain;Tubulin beta-2B chain	yes	no	0	0	0	2	0		1				19.8	19.8	2	0.005174	13688	DP1141_7	93.959	3.0337			25516000	101	381	98	164	230	230		1	9606
ALTVPELTQQVFDAK	Unmodified	1658.8879	0.88793694	122	P07437	TUBB	Tubulin beta chain	yes	yes	0	0	0	4	0.816			1	1	1	21.609	21.609	2	1.6871E-32	16262	DP1141_9	182.92	122.75			650720000	102	122	99	165;166;167	231;232;233;234;235;236	235		6	9606
ALVLDCHYPEDEVGQEDEAESDIFSIR	Unmodified	3135.3979	0.39788908	350	Q07021	C1QBP	Complement component 1 Q subcomponent-binding protein, mitochondrial	yes	yes	0	0	0	5	0					1	21.409	21.409	3	9.3796E-12	16694	DP1141_10	126.29	115.77			89753000	103	350	100	168	237;238	237		2	9606
ALVNQLHER	Unmodified	1078.5883	0.5883413	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3	0			1			15.022	15.022	2	8.6415E-92	5913	DP1141_8	235.15	174.39			262160000	104	567	101	169	239	239		0	9606
AMGEQAVALAR	Oxidation (M)	1131.5706	0.57064232	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	1	0	3	0			1			15.524	15.524	2	0.00020594	6690	DP1141_8	148.94	96.541			74302000	105	110	102	170	240	240	92	1	9606
AMGIMNSFVNDIFER	2 Oxidation (M)	1774.8018	0.80184082	65	Q99880;Q99879;Q99877;Q93079;Q5QNW6;P62807;P58876;P57053;O60814;Q8N257;Q16778;P33778;P23527;P06899	HIST1H2BL;HIST1H2BM;HIST1H2BN;HIST1H2BH;HIST2H2BF;HIST1H2BC;HIST1H2BD;H2BFS;HIST1H2BK;HIST3H2BB;HIST2H2BE;HIST1H2BB;HIST1H2BO;HIST1H2BJ	Histone H2B type 1-L;Histone H2B type 1-M;Histone H2B type 1-N;Histone H2B type 1-H;Histone H2B type 2-F;Histone H2B type 1-C/E/F/G/I;Histone H2B type 1-D;Histone H2B type F-S;Histone H2B type 1-K;Histone H2B type 3-B;Histone H2B type 2-E;Histone H2B type 1-B;Histone H2B type 1-O;Histone H2B type 1-J	yes	no	0	2	0	3.33	1.7	1			1	1	21.509	21.509	2	1.3613E-35	16180	DP1141_9	165.66	119.79			390560000	106	65	103	171;172;173	241;242;243;244;245	245	52;53	5	9606
AMGIMNSFVNDIFER	Oxidation (M)	1758.8069	0.8069262	65	Q99880;Q99879;Q99877;Q93079;Q5QNW6;P62807;P58876;P57053;O60814;Q8N257;Q16778;P33778;P23527;P06899	HIST1H2BL;HIST1H2BM;HIST1H2BN;HIST1H2BH;HIST2H2BF;HIST1H2BC;HIST1H2BD;H2BFS;HIST1H2BK;HIST3H2BB;HIST2H2BE;HIST1H2BB;HIST1H2BO;HIST1H2BJ	Histone H2B type 1-L;Histone H2B type 1-M;Histone H2B type 1-N;Histone H2B type 1-H;Histone H2B type 2-F;Histone H2B type 1-C/E/F/G/I;Histone H2B type 1-D;Histone H2B type F-S;Histone H2B type 1-K;Histone H2B type 3-B;Histone H2B type 2-E;Histone H2B type 1-B;Histone H2B type 1-O;Histone H2B type 1-J	yes	no	0	1	0	5	0					1	22.209	22.209	2	0.01121	17873	DP1141_10	123.67	92.603			12750000	107	65	103	174	246	246	52;53	1	9606
AMKPPGGESSNLFGSPEEATPSSRPNR	Oxidation (M)	2815.3195	0.3195196	563	Q9H910	HN1L	Hematological and neurological expressed 1-like protein	yes	yes	0	1	2	5	0					1	16.316	16.316	4	7.7159E-06	8483	DP1141_10	79.69	58.799			42900000	108	563	104	175	247;248	247	401	2	9606
AMPVTKPITVTK	Oxidation (M)	1300.7425	0.74245868	516	Q96KM6	ZNF512B	Zinc finger protein 512B	yes	yes	0	1	1	2	0		1				14.259	14.259	3	0.0066145	4982	DP1141_7	83.182	38.57			2162400	109	516	105	176	249	249	364	0	9606
AMTGVEQWPYR	Oxidation (M)	1352.6183	0.6183208	246	P49368	CCT3	T-complex protein 1 subunit gamma	yes	yes	0	1	0	3	0			1			18.16	18.16	2	0.01499	11062	DP1141_8	120.87	77.234			6226900	110	246	106	177	250	250	197	0	9606
ANSANTNTVPK	Acetyl (Protein N-term)	1157.5677	0.56766543	267	P52655	GTF2A1	Transcription initiation factor IIA subunit 1;Transcription initiation factor IIA alpha chain;Transcription initiation factor IIA beta chain	yes	yes	1	0	0	4	0				1		15.224	15.224	2	0.0014063	5866	DP1141_9	104.05	37.749			34270000	111	267	107	178	251	251		0	9606
ANTFVAELK	Unmodified	991.53385	0.53384611	223	P40926	MDH2	Malate dehydrogenase, mitochondrial	yes	yes	0	0	0	4	0				1		17.887	17.887	2	0.00091503	10538	DP1141_9	140.14	87.737			19277000	112	223	108	179	252	252		1	9606
APAMFNIR	Oxidation (M)	934.46947	0.46947171	280	P61247	RPS3A	40S ribosomal protein S3a	yes	yes	0	1	0	4.5	0.5				1	1	16.76	16.76	2	0.035492	9258	DP1141_10	113.08	70.365			93100000	113	280	109	180;181	253;254	253	229	2	9606
APIRPDIVNFVHTNLR	Unmodified	1861.0323	0.032250187	211	P36578	RPL4	60S ribosomal protein L4	yes	yes	0	0	1	4	0				1		19.288	19.288	3	0.0095581	12872	DP1141_9	134.88	103.91			86174000	114	211	110	182	255	255		1	9606
APKPDGPGGGPGGSHMGGNYGDDR	Oxidation (M)	2267.9614	0.96140602	209	P35637	FUS	RNA-binding protein FUS	yes	yes	0	1	1	4	0.816			2	2	2	13.43	13.43	3;4	0.0002067	3089	DP1141_8	75.225	68.705			154470000	115	209	111	183;184;185;186;187;188	256;257;258;259;260;261;262;263;264;265;266;267;268;269;270;271	263	175	16	9606
APKPDGPGGGPGGSHMGGNYGDDR	Unmodified	2251.9665	0.9664914	209	P35637	FUS	RNA-binding protein FUS	yes	yes	0	0	1	4.33	0.943			1		2	14.459	14.459	3;4	1.0859E-05	5564	DP1141_10	100.85	93.11			57411000	116	209	111	189;190;191	272;273;274;275;276	273		5	9606
APPYQEPPWGGPATAPYSLETLK	Unmodified	2469.2216	0.22162668	544	Q9BWU0	SLC4A1AP	Kanadaptin	yes	yes	0	0	0	2	0		1				21.5	21.5	2	0.0017202	16458	DP1141_7	78.326	56.465			7675400	117	544	112	192	277	277		1	9606
APSSLSDAVPQR	Unmodified	1226.6255	0.62551466	464	Q8IX01	SUGP2	SURP and G-patch domain-containing protein 2	yes	yes	0	0	0	2	0		1				16.165	16.165	2	1.1336E-14	7972	DP1141_7	172.98	96.699			88014000	118	464	113	193	278	278		0	9606
APSTYGGGLSVSSR	Unmodified	1337.6575	0.65754307	16	CON__P08779;P08779	KRT16	Keratin, type I cytoskeletal 16	yes	no	0	0	0	4	0				1		16.508	16.508	2	1.3522E-97	8299	DP1141_9	215.04	121.9		+	86673000	119	16	114	194	279	279		1	9606
AQAAAPASVPAQAPK	Unmodified	1376.7412	0.74121312	239	P47914	RPL29	60S ribosomal protein L29	yes	yes	0	0	0	5	0					1	14.843	14.843	2	0.014213	6232	DP1141_10	94.767	67.286			13447000	120	239	115	195	280	280		1	9606
AQAVHPGYGFLSENK	Unmodified	1616.7947	0.79470526	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	0	0	3	0			1			17.323	17.323	3	0.0080423	9737	DP1141_8	83.869	58.634			85691000	121	110	116	196	281	281		0	9606
AQAVHPGYGFLSENKEFAR	Unmodified	2120.0439	0.043937085	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	0	1	2.33	0.943	1		2			18.035	18.035	3;4	0.0008619	10854	DP1141_8	112.91	104.38			190850000	122	110	117	197;198;199	282;283;284;285	285		3	9606
AQAVTQPVPLANKPVPAQSTFPSK	Unmodified	2475.3486	0.34855853	250	P49750	YLPM1	YLP motif-containing protein 1	yes	yes	0	0	1	2	0		1				17.4	17.4	3	0.0012184	10130	DP1141_7	90.978	74.932			30257000	123	250	118	200	286	286		1	9606
AQDQGEKENPMR	Acetyl (Protein N-term)	1443.6412	0.64124108	313	P62913	RPL11	60S ribosomal protein L11	yes	yes	1	0	1	5	0					1	14.843	14.843	2	4.8985E-22	6006	DP1141_10	174.77	137.7			56639000	124	313	119	201	287;288;289	288		3	9606
AQELGHSQSALASAQR	Unmodified	1652.823	0.82304527	396	Q14980	NUMA1	Nuclear mitotic apparatus protein 1	yes	yes	0	0	0	2	0		1				14.741	14.741	3	0.019277	5642	DP1141_7	81.428	58.542			0	125	396	120	202	290	290		1	9606
AQEPESGLSEETQVK	Unmodified	1630.7686	0.76860967	329	P78527	PRKDC	DNA-dependent protein kinase catalytic subunit	yes	yes	0	0	0	1	0	1					15.955	15.955	2	0.0058351	7136	DP1141_6	106.26	74.91			3143800	126	329	121	203	291	291		1	9606
AQIHDLVLVGGSTR	Unmodified	1464.8049	0.80487601	135	P0DMV8;P0DMV9	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	yes	no	0	0	0	3.25	0.829		1	1	2		17.765	17.765	2;3	4.4662E-14	10381	DP1141_9	172.76	145.78			930360000	127	135	122	204;205;206;207	292;293;294;295;296	295		4	9606
AQNSELASTANMLR	Oxidation (M)	1520.7253	0.72530506	115	P05412	JUN	Transcription factor AP-1	yes	yes	0	1	0	4	0				1		16.892	16.892	2	0.027202	8989	DP1141_9	103.21	65.613			13295000	128	115	123	208	297	297	102	1	9606
AQVVHLLSTMDSPAST	Oxidation (M)	1671.8138	0.81378572	40	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	yes	yes	0	1	0	1	0	1					18.097	18.097	2	0.013509	10461	DP1141_6	114.71	81.168			3963000	129	40	124	209	298	298	32	1	9606
AQYEDIAQK	Unmodified	1064.5138	0.51383895	102	P04264	KRT1	Keratin, type II cytoskeletal 1	yes	yes	0	0	0	4	0				1		15.124	15.124	2	0.0017001	6016	DP1141_9	125.81	64.842		+	93478000	130	102	125	210	299;300	300		2	9606
ASAVSELSPR	Unmodified	1015.5298	0.52982336	612	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	yes	yes	0	0	0	2	0.816	1	1	1			15.944	15.944	2	2.206E-40	7553	DP1141_7	182.98	118.78			142420000	131	612	126	211;212;213	301;302;303;304;305;306	303		6	9606
ASAVSPANLPAVLLQPR	Acetyl (Protein N-term)	1744.9836	0.98356866	259	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	yes	yes	1	0	0	2.57	1.4	2	2	1	1	1	23.504	23.504	2;3	9.1514E-45	19700	DP1141_10	184.34	145.08			68214000	132	259	127	214;215;216;217;218;219;220	307;308;309;310;311;312;313;314;315;316	308		9	9606
ASESSKPWPDATYGTGSASR	Unmodified	2053.9341	0.93411186	612	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	yes	yes	0	0	1	2	0		2				16.565	16.565	2;3	6.846800000000001E-130	8617	DP1141_7	221.81	202.52			388070000	133	612	128	221;222	317;318	317		2	9606
ASGNYATVISHNPETK	Unmodified	1687.8166	0.81656291	314	P62917	RPL8	60S ribosomal protein L8	yes	yes	0	0	0	5	0					1	15.736	15.736	3	0.0013521	7623	DP1141_10	184	157.89			42110000	134	314	129	223	319;320;321	320		3	9606
ASGNYATVISHNPETKK	Unmodified	1815.9115	0.91152593	314	P62917	RPL8	60S ribosomal protein L8	yes	yes	0	0	1	5	0					1	14.924	14.924	4	0.019813	6107	DP1141_10	50.827	23.178			14903000	135	314	130	224	322	322		0	9606
ASGPPVSELITK	Unmodified	1197.6605	0.66050319	157	P16403;P10412;P16402	HIST1H1C;HIST1H1E;HIST1H1D	Histone H1.2;Histone H1.4;Histone H1.3	yes	no	0	0	0	4	0				1		17.987	17.987	2	0.0050838	10591	DP1141_9	108.31	79.143			38909000	136	157	131	225	323	323		1	9606
ASGQAFELILSPR	Unmodified	1387.746	0.74596415	159	P16949	STMN1	Stathmin	yes	yes	0	0	0	5	0					1	20.825	20.825	2	0.0077379	15797	DP1141_10	89.301	49.364			19802000	137	159	132	226	324	324		1	9606
ASIGQSPGLPSTTFK	Unmodified	1489.7777	0.77765821	424	Q5VT52	RPRD2	Regulation of nuclear pre-mRNA domain-containing protein 2	yes	yes	0	0	0	2	0		1				18.259	18.259	2	8.6701E-11	11337	DP1141_7	161.48	138.9			19129000	138	424	133	227	325	325		0	9606
ASKCLKASFSSGSLK	Acetyl (Protein N-term)	1611.829	0.82904185	26	CON__Q497I4			yes	yes	1	0	2	1	0	1					17.455	17.455	3	0.023637	9557	DP1141_6	48.608	13.571		+	25208000	139	26	134	228	326	326		0	
ASKGAGMSFSRK	Acetyl (Protein N-term);Oxidation (M)	1283.6292	0.62921983	428	Q5XPI4	RNF123	E3 ubiquitin-protein ligase RNF123	yes	yes	1	1	2	5	0					1	20.651	20.651	2	0.027592	15423	DP1141_10	64.82	19.739			0	140	428	135	229	327	327	323	1	9606
ASKPLPPAPAPDEYLVSPITGEK	Unmodified	2376.2577	0.25767783	405	Q15459	SF3A1	Splicing factor 3A subunit 1	yes	yes	0	0	1	2	0		1				19.2	19.2	3	0.0021252	12790	DP1141_7	86.825	57.514			36812000	141	405	136	230	328;329	328		2	9606
ASLENSLEETKGR	Unmodified	1432.7158	0.71578623	16;9	CON__P02533;P02533;CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8	KRT14;KRT16	Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 16	no	no	0	0	1	4	0				1		15.964	15.964	3	0.011972	7267	DP1141_9	128.08	67.44		+	9601400	142	9;16	137	231	330	330		0	9606
ASLSLAPVNIFK	Acetyl (Protein N-term)	1300.7391	0.73908786	328	P78371	CCT2	T-complex protein 1 subunit beta	yes	yes	1	0	0	3	0			1			23.903	23.903	2	0.00072203	19780	DP1141_8	124.92	94.604			10249000	143	328	138	232	331	331		1	9606
ASPGAGRAPPELPER	Acetyl (Protein N-term)	1545.79	0.78995423	136	P0DPD7;P0DPD8			yes	no	1	0	1	3	0			1			19.026	19.026	3	0.009029	12469	DP1141_8	58.595	11.556			2159400000	144	136	139	233	332	332		1	9606
ASPSPTDPVVPAVPIGPPPAGFR	Unmodified	2225.1845	0.18445331	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2.5	0.957	1	2	2	1		20.663	20.663	2;3	4.6011E-238	15009	DP1141_7	250.81	231.49			541260000	145	142	140	234;235;236;237;238;239	333;334;335;336;337;338;339;340;341;342;343;344;345	339		13	9606
ASTEGANNMPK	Acetyl (Protein N-term)	1160.5132	0.51318702	228	P43004	SLC1A2	Excitatory amino acid transporter 2	yes	yes	1	0	0	1	0	1					15.699	15.699	2	0.0075753	6476	DP1141_6	96.665	65.591			0	146	228	141	240	346	346		1	9606
ASVVLALR	Acetyl (Protein N-term)	869.53345	0.53345218	582	Q9P0M9	MRPL27	39S ribosomal protein L27, mitochondrial	yes	yes	1	0	0	3.25	1.48	1		1	1	1	16.825	16.825	2	0.014665	8825	DP1141_8	77.374	14.068			33821000000	147	582	142	241;242;243;244	347;348;349;350	349		3	9606
ATAEVLNIGK	Acetyl (Protein N-term)	1056.5815	0.58152458	178	P22234	PAICS	Multifunctional protein ADE2;Phosphoribosylaminoimidazole-succinocarboxamide synthase;Phosphoribosylaminoimidazole carboxylase	yes	yes	1	0	0	4	0				1		20.387	20.387	2	0.0044954	14171	DP1141_9	90.601	55.245			2720900	148	178	143	245	351	351		1	9606
ATAGDTHLGGEDFDNR	Unmodified	1674.7234	0.72339081	135;161	P0DMV8;P0DMV9;P34931;P17066;P48741	HSPA1A;HSPA1B;HSPA1L;HSPA6;HSPA7	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like;Heat shock 70 kDa protein 6;Putative heat shock 70 kDa protein 7	no	no	0	0	0	3	0.816		1	1	1		15.938	15.938	3	1.1539E-06	7339	DP1141_9	127.57	119.59			3019399999.9999995	149	135;161	144	246;247;248	352;353;354	354		1	9606
ATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAK	Acetyl (Protein N-term)	3693.858	0.8579808	374	Q13435	SF3B2	Splicing factor 3B subunit 2	yes	yes	1	0	1	3	0			1			19.989	19.989	4	8.2321E-18	13949	DP1141_8	95.152	78.784			13492000	150	374	145	249	355	355		1	9606
ATENDIYNFFSPLNPMR	Oxidation (M)	2043.936	0.93602612	272	P55795	HNRNPH2	Heterogeneous nuclear ribonucleoprotein H2	yes	yes	0	1	0	3	0			1			22.738	22.738	2	0.0015497	17967	DP1141_8	114.87	102.7			4116700	151	272	146	250	356	356	224	1	9606
ATENDIYNFFSPLNPVR	Unmodified	1995.969	0.96904081	266;200	P52597;P31943	HNRNPF;HNRNPH1	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed	no	no	0	0	0	4.33	0.471				2	1	23.204	23.204	2;3	0	18681	DP1141_9	364.46	307.29			86570000	152	266;200	147	251;252;253	357;358;359;360;361	358		5	9606
ATIAGGGVIPHIHK	Unmodified	1369.783	0.78301836	133	Q71UI9;P0C0S5	H2AFV;H2AFZ	Histone H2A.V;Histone H2A.Z	yes	no	0	0	0	5	0					1	16.216	16.216	3	0.013481	8286	DP1141_10	80.318	44.724			60592000	153	133	148	254	362	362		0	9606
ATISNDGATILK	Unmodified	1202.6507	0.65066678	533	Q99832	CCT7	T-complex protein 1 subunit eta	yes	yes	0	0	0	3	0			1			16.923	16.923	2	3.6747E-09	9109	DP1141_8	155.53	90.068			36186000	154	533	149	255	363	363		1	9606
ATKVDARR	Unmodified	915.52501	0.52501276	456	Q86U10	ASPG	60 kDa lysophospholipase;L-asparaginase;Platelet-activating factor acetylhydrolase	yes	yes	0	0	2	5	0					1	17.037	17.037	2	0.00026504	9688	DP1141_10	115.46	14.247			124240000	155	456	150	256	364	364		0	9606
ATLEVILRPK	Unmodified	1138.7074	0.7073938	571	Q9NQT4	EXOSC5	Exosome complex component RRP46	yes	yes	0	0	1	5	0					1	17.637	17.637	2	5.2203E-21	10744	DP1141_10	175.51	154.54			78684000	156	571	151	257	365;366	366		2	9606
ATLVDHGIR	Unmodified	980.54033	0.54032847	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					14.758	14.758	2	0.0011407	5102	DP1141_6	157.33	88.131			19717000	157	367	152	258	367	367		0	9606
ATNLCFAER	Unmodified	1080.5022	0.50222841	494	Q92797	SYMPK	Symplekin	yes	yes	0	0	0	2	0		1				16.903	16.903	2	0.022396	9177	DP1141_7	82.75	52.138			16853000	158	494	153	259	368	368		1	9606
ATQQQHDFTLTQTADGR	Unmodified	1916.8977	0.89766678	329	P78527	PRKDC	DNA-dependent protein kinase catalytic subunit	yes	yes	0	0	0	1	0	1					16.155	16.155	3	1.1212E-15	7194	DP1141_6	130.87	105.42			21577000	159	329	154	260	369	369		1	9606
ATSVLPR	Unmodified	742.43374	0.43373813	584	Q9P0W8	SPATA7	Spermatogenesis-associated protein 7	yes	yes	0	0	0	5	0					1	16.813	16.813	1	0.011753	9397	DP1141_10	103.29	13.612			84402000	160	584	155	261	370	370		1	9606
AVAFFLESIAMHDIIAAEK	Oxidation (M)	2091.0711	0.071063038	329	P78527	PRKDC	DNA-dependent protein kinase catalytic subunit	yes	yes	0	1	0	2	0		1				23.103	23.103	3	0.0029925	18682	DP1141_7	78.166	65.802			5716400	161	329	156	262	371	371	251	1	9606
AVCMLSNTTAIAEAWAR	Unmodified	1863.8971	0.89713819	321;442;322	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	no	no	0	0	0	3	0			1			21.729	21.729	2	0.0068173	16544	DP1141_8	92.856	36.306			57965000	162	321;322;442	157	263	372	372		1	9606
AVDTDMIDYEK	Oxidation (M)	1314.5649	0.56494782	72	O75356	ENTPD5	Ectonucleoside triphosphate diphosphohydrolase 5	yes	yes	0	1	0	1	0	1					19.149	19.149	3	0.033382	12100	DP1141_6	59.067	40.395			0	163	72	158	264	373	373	56	1	9606
AVFPSIVGR	Unmodified	944.54435	0.54435122	277;318	P60709;Q6S8J3;P68133;P68032;A5A3E0;P63267;P62736;P0CG38;P63261	ACTB;POTEE;ACTA1;ACTC1;POTEF;ACTG2;ACTA2;POTEI;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;POTE ankyrin domain family member E;Actin, alpha skeletal muscle;Actin, alpha cardiac muscle 1;POTE ankyrin domain family member F;Actin, gamma-enteric smooth muscle;Actin, aortic smooth muscle;POTE ankyrin domain family member I;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	no	no	0	0	0	2.75	1.48	1	1	1		1	19.027	19.027	2	0.0017001	12655	DP1141_7	125.81	67.21			229450000	164	277;318	159	265;266;267;268	374;375;376;377	376		4	9606
AVFVDLEPTVIDEIR	Unmodified	1714.9142	0.91415169	322	P68366	TUBA4A	Tubulin alpha-4A chain	yes	yes	0	0	0	1	0	1					22.394	22.394	2	0.0092522	17097	DP1141_6	106.26	58.07			6293700	165	322	160	269	378	378		1	9606
AVFVDLEPTVIDEVR	Unmodified	1700.8985	0.89850163	321;442	P68363;Q71U36	TUBA1B;TUBA1A	Tubulin alpha-1B chain;Tubulin alpha-1A chain	no	no	0	0	0	5	0					1	21.809	21.809	2	0.027434	17176	DP1141_10	65.232	19.324			77431000	166	321;442	161	270	379	379		1	9606
AVIGIGIEEEDRK	Unmodified	1427.762	0.76200815	86	O94906	PRPF6	Pre-mRNA-processing factor 6	yes	yes	0	0	1	2	0		1				17.211	17.211	3	0.0030808	9619	DP1141_7	131.12	101.81			0	167	86	162	271	380	380		1	9606
AVLCPPPVK	Unmodified	979.55247	0.55247306	278	P63000;P60763	RAC1;RAC3	Ras-related C3 botulinum toxin substrate 1;Ras-related C3 botulinum toxin substrate 3	yes	no	0	0	0	5	0					1	16.316	16.316	2	0.01306	8507	DP1141_10	105.2	28.723			5722400	168	278	163	272	381	381		0	9606
AVLNNVIFCHQEDSNWPLSEGK	Unmodified	2556.2067	0.20672167	497	Q92878	RAD50	DNA repair protein RAD50	yes	yes	0	0	0	2	0		1				20.728	20.728	3	0.0029522	15132	DP1141_7	67.655	43.244			18710000	169	497	164	273	382	382		1	9606
AVLQPSINEEIQTVFNK	Unmodified	1929.0207	0.020742027	555	Q9H147	DNTTIP1	Deoxynucleotidyltransferase terminal-interacting protein 1	yes	yes	0	0	0	4	0				1		21.762	21.762	2	7.8394E-10	16575	DP1141_9	158.04	87.1			5650600	170	555	165	274	383	383		1	9606
AVNYVGAGTVEFIMDSK	Oxidation (M)	1815.8713	0.8713006	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	1	0	2.6	1.02	1	1	2	1		20.198	20.198	2;3	1.1188999999999999E-22	14182	DP1141_8	171.36	111.06			527150000	171	521	166	275;276;277;278;279	384;385;386;387;388;389;390	387	369	7	9606
AVPKEDIYSGGGGGGSR	Unmodified	1605.7747	0.7746981	369	Q13151	HNRNPA0	Heterogeneous nuclear ribonucleoprotein A0	yes	yes	0	0	1	4	0				1		14.933	14.933	3	0.017125	5689	DP1141_9	80.361	59.112			39980000	172	369	167	280	391	391		0	9606
AVSILPLLGHGVPR	Unmodified	1427.8613	0.86126868	613	Q9Y2W2	WBP11	WW domain-binding protein 11	yes	yes	0	0	0	3	1		1		1		20.247	20.247	3	0.0098966	14290	DP1141_7	78.903	46.287			21287000	173	613	168	281;282	392;393	392		2	9606
AVSKPSRPDMNPIR	Oxidation (M)	1582.825	0.82495953	468	Q8N1G2	CMTR1	Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1	yes	yes	0	1	2	1	0	1					13.696	13.696	3	0.020055	3593	DP1141_6	80.69	55.369			769360	174	468	169	283	394	394	347	1	9606
AVTEQGHELSNEER	Unmodified	1597.7332	0.73322721	201	P31946	YWHAB	14-3-3 protein beta/alpha;14-3-3 protein beta/alpha, N-terminally processed	yes	yes	0	0	0	5	0					1	14.056	14.056	3	0.003447	4955	DP1141_10	107.37	81.007			29763000	175	201	170	284	395	395		1	9606
AVVGDAQYHHFR	Unmodified	1398.6793	0.67928157	240	P47929	LGALS7	Galectin-7	yes	yes	0	0	0	5	0					1	14.995	14.995	3	0.0030995	6293	DP1141_10	113.69	83.683			12156000	176	240	171	285	396	396		0	9606
AVVGVVAGGGR	Unmodified	940.54541	0.54541385	314	P62917	RPL8	60S ribosomal protein L8	yes	yes	0	0	0	5	0					1	15.415	15.415	2	0.0038278	6998	DP1141_10	129.68	79.556			53076000	177	314	172	286	397	397		1	9606
AVVIVDDR	Unmodified	885.49198	0.4919813	181;401	Q15233;P23246	NONO;SFPQ	Non-POU domain-containing octamer-binding protein;Splicing factor, proline- and glutamine-rich	no	no	0	0	0	3.67	1.25		1		1	1	15.938	15.938	2	5.7085E-06	7391	DP1141_9	133.81	82.24			233850000	178	401;181	173	287;288;289	398;399;400	400		3	9606
AVVKTPSR	Acetyl (Protein N-term)	898.52362	0.52361577	416	Q4G0U5	CFAP221	Cilia- and flagella-associated protein 221	yes	yes	1	0	1	5	0					1	17.738	17.738	2	0.016671	10557	DP1141_10	88.643	28.349			109670000	179	416	174	290	401	401		0	9606
AVVMDLLR	Unmodified	915.52117	0.52117293	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	2					20.035	20.035	1;2	3.8841E-30	13399	DP1141_6	182.13	68.103			6517200	180	367	175	291;292	402;403	402		2	9606
AVVVCPKDEDYK	Unmodified	1421.6861	0.68606601	337	Q00839	HNRNPU	Heterogeneous nuclear ribonucleoprotein U	yes	yes	0	0	1	1	0	1					15.117	15.117	3	0.029564	5588	DP1141_6	91.313	57.443			0	181	337	176	293	404	404		1	9606
AVVVCPKDEDYKQR	Unmodified	1705.8458	0.84575455	337	Q00839	HNRNPU	Heterogeneous nuclear ribonucleoprotein U	yes	yes	0	0	2	2	0		1				14.458	14.458	4	0.003805	5202	DP1141_7	101.72	79.226			8993000	182	337	177	294	405	405		0	9606
AWEDWAIYPEPFLIK	Unmodified	1876.94	0.93997251	49	O15042	U2SURP	U2 snRNP-associated SURP motif-containing protein	yes	yes	0	0	0	2	0		1				24.285	24.285	2	0.016798	20496	DP1141_7	99.215	61.194			5565800	183	49	178	295	406	406		1	9606
AYGGAYDVMSSK	Oxidation (M)	1263.5442	0.5441528	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	1	0	5	0					1	15.506	15.506	2	0.025485	7253	DP1141_10	110.38	88.531			23122000	184	111	179	296	407	407	100	1	9606
AYHEQLSVAEITNACFEPANQMVK	Oxidation (M)	2765.2789	0.27890034	321;442;322	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	no	no	0	1	0	3	0			1			19.454	19.454	3	7.6402E-85	13029	DP1141_8	200.23	185.21			23059000	185	321;322;442	180	297	408;409	408	246	2	9606
AYIAYELNSVQHR	Unmodified	1562.7841	0.78414057	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	2					17.955	17.955	2;3	7.2292E-67	10050	DP1141_6	202.31	152.88			266540000	186	367	181	298;299	410;411;412;413	411		4	9606
AYVEANQMLGDLIK	Oxidation (M)	1579.7916	0.79159371	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	1	0	2	1	1		1			19.491	19.491	2	0.026943	12757	DP1141_6	103.08	75.219			60730000	187	142	182	300;301	414;415;416	414	136	3	9606
AYVWDNNK	Unmodified	1008.4665	0.46649483	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					17.118	17.118	2	0.011111	8865	DP1141_6	102.71	56.288			15728000	188	367	183	302	417	417		1	9606
AYVWDNNKDLAEWLEK	Unmodified	1992.9581	0.95814177	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	5	0					1	21.554	21.554	3	0.0083902	16753	DP1141_10	117.13	70.813			0	189	367	184	303	418	418		1	9606
CGGGTQSRK	Unmodified	949.43996	0.4399625	549	Q9C0I4	THSD7B	Thrombospondin type-1 domain-containing protein 7B	yes	yes	0	0	1	1	0	1					20.241	20.241	1	0.019658	14007	DP1141_6	57.177	7.9667			6017000	190	549	185	304	419	419		1	9606
CGLPLFYQSQPK	Unmodified	1436.7122	0.71222118	562	Q9H5V9	CXorf56	UPF0428 protein CXorf56	yes	yes	0	0	0	5	0					1	19.841	19.841	2	0.020435	14294	DP1141_10	79.974	38.98			9546400	191	562	186	305	420	420		1	9606
CIGKPGGSLDNSEQK	Unmodified	1588.7515	0.75151981	621	Q9Y5L4	TIMM13	Mitochondrial import inner membrane translocase subunit Tim13	yes	yes	0	0	1	5	0					1	14.124	14.124	3	2.6285999999999997E-21	4981	DP1141_10	162.64	124.7			78711000	192	621	187	306	421;422	422		2	9606
CLAAEDVVFIGPDTHAIQAMGDKIESK	Oxidation (M)	2930.4154	0.41539382	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	1	1	3	0			1			19.396	19.396	4	3.2949E-12	13007	DP1141_8	127.96	104.04			49674000	193	110	188	307	423	423	93	1	9606
CLAAEDVVFIGPDTHAIQAMGDKIESK	Unmodified	2914.4205	0.4204792	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	0	1	3	0			1			20.803	20.803	4	0.0033408	15043	DP1141_8	58.284	37.606			10833000	194	110	188	308	424	424		0	9606
CLLLHPAGHAEPAAGSHR	Unmodified	1892.9428	0.94278325	522	Q96S55	WRNIP1	ATPase WRNIP1	yes	yes	0	0	0	3	0			1			14.822	14.822	4	0.010081	5763	DP1141_8	55.864	34.024			15303000	195	522	189	309	425	425		1	9606
CLPPSEAASDNHLK	Unmodified	1537.7195	0.7194914	385	Q14241	TCEB3	Transcription elongation factor B polypeptide 3	yes	yes	0	0	0	2	0		1				14.658	14.658	3	0.012773	5597	DP1141_7	73.219	44.004			8726200	196	385	190	310	426	426		1	9606
CNFESNFPR	Unmodified	1169.4924	0.492392	514	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	yes	yes	0	0	0	2	0		1				17.699	17.699	2	0.018265	10542	DP1141_7	127.46	127.46			23385000	197	514	191	311	427	427		0	9606
CPFTGNVSIR	Unmodified	1149.5601	0.56007764	295	P62280	RPS11	40S ribosomal protein S11	yes	yes	0	0	0	5	0					1	17.538	17.538	2	0.0025628	10451	DP1141_10	141.52	61.058			31805000	198	295	192	312	428	428		1	9606
CSDSDGLAPPQHLIR	Unmodified	1664.7941	0.79405333	104	P04637	TP53	Cellular tumor antigen p53	yes	yes	0	0	0	3.5	0.5			1	1		17.055	17.055	3	0.00076786	9327	DP1141_9	105	86.899			205730000	199	104	193	313;314	429;430	430		2	9606
CTGGEVGATSALAPK	Unmodified	1417.6871	0.68712864	197	P30050	RPL12	60S ribosomal protein L12	yes	yes	0	0	0	5	0					1	16.116	16.116	2	2.3146E-05	8146	DP1141_10	151.13	111.58			27631000	200	197	194	315	431	431		1	9606
CVACETPKPGTCVK	Unmodified	1605.7313	0.73131842	252	P49790	NUP153	Nuclear pore complex protein Nup153	yes	yes	0	0	1	2	0		1				14.162	14.162	3	0.0043512	4775	DP1141_7	161.25	132.3			74639000	201	252	195	316	432;433;434	434		3	9606
CVIFEIPGAPDDEAVR	Unmodified	1786.856	0.85598488	513	Q96I25	RBM17	Splicing factor 45	yes	yes	0	0	0	3	0			1			21.228	21.228	2	3.2107E-06	15721	DP1141_8	125.54	82.739			48195000	202	513	196	317	435	435		0	9606
CYLFGGLANDSEDPKNNIPR	Unmodified	2279.0641	0.06408018	259	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	yes	yes	0	0	1	2	0		1				19.501	19.501	3	0.012729	13255	DP1141_7	88.551	71.936			17514000	203	259	197	318	436	436		1	9606
DAANLAKEKQR	Unmodified	1242.668	0.66804818	55	O43150	ASAP2	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2	yes	yes	0	0	2	3	0			1			19.726	19.726	2	0.0094561	13135	DP1141_8	98.582	45.089			57331000	204	55	198	319	437	437		0	9606
DAEAWFNEK	Unmodified	1108.4825	0.48253882	17	CON__P13645;P13645;Q7Z3Y7;CON__Q148H6;CON__Q7Z3Y7;CON__Q7Z3Y8;CON__Q7Z3Z0;Q7Z3Y8;Q7Z3Z0	KRT10;KRT28;KRT27;KRT25	Keratin, type I cytoskeletal 10;Keratin, type I cytoskeletal 28;Keratin, type I cytoskeletal 27;Keratin, type I cytoskeletal 25	yes	no	0	0	0	3	1		1		1		19.294	19.294	2	3.7116E-29	12767	DP1141_9	178.3	127.59		+	268590000	205	17	199	320;321	438;439;440	439		3	9606
DAEDVDLNHYR	Unmodified	1345.5899	0.58985744	404	Q15435	PPP1R7	Protein phosphatase 1 regulatory subunit 7	yes	yes	0	0	0	4	0				1		16.569	16.569	2	4.6929999999999996E-66	8392	DP1141_9	200.05	154.89			10728000	206	404	200	322	441	441		1	9606
DAEEWFFTK	Unmodified	1171.5186	0.51858998	9	CON__P02533;P02533;CON__Q6IFX2	KRT14	Keratin, type I cytoskeletal 14	yes	no	0	0	0	4	0				1		21.488	21.488	2	4.3238E-21	16214	DP1141_9	174.52	156.53		+	24142000	207	9	201	323	442	442		1	9606
DAETWFLSK	Unmodified	1095.5237	0.52367535	16	CON__P08779;P08779	KRT16	Keratin, type I cytoskeletal 16	yes	no	0	0	0	4	0				1		20.887	20.887	2	0.0070169	15164	DP1141_9	101.72	37.154		+	99355000	208	16	202	324	443	443		1	9606
DAGTIAGLNVMR	Oxidation (M)	1232.6183	0.6183208	139	P11021	HSPA5	78 kDa glucose-regulated protein	yes	yes	0	1	0	3	0			1			18.025	18.025	2	0.025519	10834	DP1141_8	107.57	65.239			27192000	209	139	203	325	444	444	133	1	9606
DAGVIAGLNVLR	Unmodified	1196.6877	0.68772099	135	P0DMV8;P0DMV9;P34931	HSPA1A;HSPA1B;HSPA1L	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like	yes	no	0	0	0	3	0			1			20.828	20.828	2	0.0065066	15147	DP1141_8	99.013	58.946			747510000	210	135	204	326	445;446	445		2	9606
DAHQSLLATR	Unmodified	1110.5782	0.57817054	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2	0		1				15.359	15.359	2	2.3328E-05	6692	DP1141_7	151.83	104.17			541250000	211	142	205	327	447	447		0	9606
DAKDKLESEMEDAYHEHQANLLR	Oxidation (M)	2757.2664	0.2664214	181	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	yes	yes	0	1	2	2	0		1				17.003	17.003	5	0.0067424	9226	DP1141_7	51.568	36.562			19657000	212	181	206	328	448	448	158	1	9606
DALSDLALHFLNK	Unmodified	1455.7722	0.7721789	258	P50991	CCT4	T-complex protein 1 subunit delta	yes	yes	0	0	0	3	0			1			23.199	23.199	2	0.00081352	18713	DP1141_8	133.81	75.178			27873000	213	258	207	329	449	449		1	9606
DAPAESVAYHAQNNPPVPPKPQPK	Unmodified	2551.2819	0.28193553	559	Q9H2P0	ADNP	Activity-dependent neuroprotector homeobox protein	yes	yes	0	0	1	2	0		1				15.84	15.84	3	0.025255	7483	DP1141_7	53.454	32.607			14372000	214	559	208	330	450	450		1	9606
DCQLNAHKDHQYQFLEDAVR	Unmodified	2486.1397	0.13970474	372	Q13263	TRIM28	Transcription intermediary factor 1-beta	yes	yes	0	0	1	2	0		1				17.999	17.999	4	2.5156E-09	10851	DP1141_7	103.9	103.9			127780000	215	372	209	331	451	451		0	9606
DDDIAALVVDNGSGMCK	Acetyl (Protein N-term)	1820.7921	0.792064	277	P60709	ACTB	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed	yes	yes	1	0	0	2.5	1.5	1			1		22.681	22.681	2	0.00012237	17995	DP1141_9	107.65	91.173			8640400	216	277	210	332;333	452;453;454	454		3	9606
DDGLFSGDPNWFPK	Unmodified	1593.71	0.70997257	213	P37802	TAGLN2	Transgelin-2	yes	yes	0	0	0	5	0					1	22.799	22.799	2	7.6369E-30	18623	DP1141_10	177.44	144.44			47443000	217	213	211	334	455;456;457	456		3	9606
DDGLFSGDPNWFPKK	Unmodified	1721.8049	0.80493559	213	P37802	TAGLN2	Transgelin-2	yes	yes	0	0	1	5	0					1	20.825	20.825	3	0.01494	15777	DP1141_10	68.262	29.246			10081000	218	213	212	335	458	458		1	9606
DEALSDGDDLR	Unmodified	1204.5208	0.52077482	341	Q01831	XPC	DNA repair protein complementing XP-C cells	yes	yes	0	0	0	1	0	1					16.635	16.635	3	0.020617	7838	DP1141_6	73.885	38.44			1893300	219	341	213	336	459	459		0	9606
DEPIHILNVAIK	Unmodified	1360.7715	0.77145062	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	2					19.756	19.756	2;3	3.8307E-66	13044	DP1141_6	167.93	94.269			1368800000	220	367	214	337;338	460;461	460		2	9606
DETEFYLGKR	Unmodified	1256.6037	0.60371659	166	P18077	RPL35A	60S ribosomal protein L35a	yes	yes	0	0	1	5	0					1	17.538	17.538	2	0.014673	10575	DP1141_10	132.08	89.22			16477000	221	166	215	339	462	462		0	9606
DFFNYLPLSSQDPAPVR	Unmodified	1964.9632	0.96322715	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3.33	0.471			2	1		22.834	22.834	2;3	1.3906000000000001E-167	18053	DP1141_8	295.26	202.48			90089000	222	111	216	340;341;342	463;464;465;466	464		4	9606
DFPYEEDSRPR	Unmodified	1409.6212	0.62115757	513	Q96I25	RBM17	Splicing factor 45	yes	yes	0	0	1	3.5	0.5			1	1		16.713	16.713	2;3	0.013679	8710	DP1141_9	93.111	67.489			60229000	223	513	217	343;344	467;468	468		1	9606
DFTATFGPLDSLNTR	Unmodified	1653.7999	0.79985021	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	3	1.41	1	1	1	1	1	22.029	22.029	2	1.2126E-161	16976	DP1141_7	286.86	265.29			425390000	224	142	218	345;346;347;348;349	469;470;471;472;473;474;475;476;477;478	473		9	9606
DFTVASPAEFVTR	Unmodified	1438.7092	0.70924429	367;40	Q13085;O00763	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	no	no	0	0	0	2.67	1.7	1	1			1	20.812	20.812	2	1.6788000000000002E-233	14319	DP1141_6	256.38	182.21			727830000	225	367;40	219	350;351;352	479;480;481;482;483	480		5	9606
DHAATTAGAASLAGGHHR	Unmodified	1699.8139	0.81387757	194	P29083	GTF2E1	General transcription factor IIE subunit 1	yes	yes	0	0	0	3	0			1			12.857	12.857	4	0.013989	3096	DP1141_8	50.053	39.237			1383800	226	194	220	353	484	484		1	9606
DHAVVVGVYRPPPK	Unmodified	1532.8463	0.8463469	176	P22087	FBL	rRNA 2'-O-methyltransferase fibrillarin	yes	yes	0	0	1	4	0				1		15.559	15.559	3	0.01635	6825	DP1141_9	97.957	76.045			54990000	227	176	221	354	485	485		1	9606
DHLPSSPGLLTVGEDMQPK	Oxidation (M)	2035.9885	0.98845562	4	A8MUA0		Putative UPF0607 protein ENSP00000381514	yes	yes	0	1	0	4	0				1		15.179	15.179	4	0.021786	6068	DP1141_9	49.049	14.139			7389400	228	4	222	355	486	486	3	0	9606
DHSVQLPKPVHKPNR	Unmodified	1750.9591	0.95908524	572	Q9NRL2	BAZ1A	Bromodomain adjacent to zinc finger domain protein 1A	yes	yes	0	0	2	2	0		1				13.904	13.904	4	0.00072667	4467	DP1141_7	93.649	70.738			3321100	229	572	223	356	487	487		1	9606
DIDIHEVR	Unmodified	995.50361	0.50360861	337	Q00839	HNRNPU	Heterogeneous nuclear ribonucleoprotein U	yes	yes	0	0	0	2	0		1				15.982	15.982	2	0.018192	7562	DP1141_7	98.299	37.338			37144000	230	337	224	357	488	488		1	9606
DIENQYETQITQIEHEVSSSGQEVQSSAK	Unmodified	3263.5066	0.5065879	19	CON__P35527;P35527	KRT9	Keratin, type I cytoskeletal 9	yes	no	0	0	0	2.5	1.5	1			1		21.942	21.942	3	5.6235E-18	16444	DP1141_6	107.65	78.87		+	20585000	231	19	225	358;359	489;490	489		2	9606
DIGEGNLSTAAAAALAAAAVK	Unmodified	1883.9953	0.99525556	480	Q8TAQ2	SMARCC2	SWI/SNF complex subunit SMARCC2	yes	yes	0	0	0	2	0		1				22.522	22.522	3	0.028991	17804	DP1141_7	37.4	10.809			14509000	232	480	226	360	491	491		1	9606
DIIVIGNDITYR	Unmodified	1390.7456	0.7456298	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					20.732	20.732	2	9.1207E-11	14586	DP1141_6	161.51	126.24			249140000	233	367	227	361	492	492		1	9606
DIPGLTDTTVPR	Unmodified	1283.6721	0.67213051	302	P62753	RPS6	40S ribosomal protein S6	yes	yes	0	0	0	1	0	1					19.211	19.211	2	0.0050895	12052	DP1141_6	105.98	70.067			2834700	234	302	228	362	493	493		1	9606
DIPSLPPLPPLPPLPPLDR	Unmodified	2043.1768	0.17684874	250	P49750	YLPM1	YLP motif-containing protein 1	yes	yes	0	0	0	2	0		1				24.285	24.285	2	4.5508E-25	20497	DP1141_7	173.72	148.48			7125200	235	250	229	363	494;495;496	495		3	9606
DIPVLVATDVAAR	Unmodified	1338.7507	0.75071518	460	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	yes	yes	0	0	0	2	0		1				20.501	20.501	2	2.8699E-06	14742	DP1141_7	152.04	99.786			77719000	236	460	230	364	497;498	497		2	9606
DISEVIALGVPNPR	Unmodified	1478.8093	0.80929269	377	Q13573	SNW1	SNW domain-containing protein 1	yes	yes	0	0	0	3.5	0.5			1	1		21.609	21.609	2	2.6081E-81	16203	DP1141_8	205.18	171.29			23576000	237	377	231	365;366	499;500;501	500		3	9606
DIVENICGR	Unmodified	1074.5128	0.51279309	225	P42166	TMPO	Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin	yes	yes	0	0	0	3	0			1			17.123	17.123	2	0.033822	10255	DP1141_8	75.213	20.663			10832000	238	225	232	367	502	502		1	9606
DKEVEFGGPAPR	Unmodified	1300.6412	0.64116473	250	P49750	YLPM1	YLP motif-containing protein 1	yes	yes	0	0	1	2	0		1				15.749	15.749	2	8.172E-16	7214	DP1141_7	175.93	106.12			0	239	250	233	368	503	503		1	9606
DKLPPSMRK	Acetyl (Protein N-term);Oxidation (M)	1128.5961	0.59612879	617	Q9Y3Q4	HCN4	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4	yes	yes	1	1	2	3	0			1			18.913	18.913	2	0.035772	12206	DP1141_8	43.246	11.717			0	240	617	234	369	504	504	425	1	9606
DKPHVNVGTIGHVDHGK	Unmodified	1808.9282	0.92817905	247	P49411	TUFM	Elongation factor Tu, mitochondrial	yes	yes	0	0	1	4	0				1		14.281	14.281	4	0.015362	4725	DP1141_9	142.4	113.76			24877000	241	247	235	370	505	505		1	9606
DLAILQCHGELDPMVPVR	Oxidation (M)	2078.0289	0.028880648	90	O95372	LYPLA2	Acyl-protein thioesterase 2	yes	yes	0	1	0	5	0					2	20.026	20.026	2;3	0.0025563	14558	DP1141_10	87.287	64.303			114040000	242	90	236	371;372	506;507	506	77	2	9606
DLALVNDQLLGFVR	Unmodified	1571.8671	0.86714192	415	Q29RF7	PDS5A	Sister chromatid cohesion protein PDS5 homolog A	yes	yes	0	0	0	2	0		1				23.393	23.393	2	0.0018384	19159	DP1141_7	138.71	104.82			10511000	243	415	237	373	508	508		1	9606
DLDFAQQK	Unmodified	963.46616	0.46616048	464	Q8IX01	SUGP2	SURP and G-patch domain-containing protein 2	yes	yes	0	0	0	5	0					1	17.137	17.137	2	5.1744E-06	9825	DP1141_10	133.47	76.016			12170000	244	464	238	374	509	509		1	9606
DLEKPFLLPVEAVYSVPGR	Unmodified	2128.1568	0.15684158	247	P49411	TUFM	Elongation factor Tu, mitochondrial	yes	yes	0	0	1	4	0				1		22.337	22.337	3	0.010667	17431	DP1141_9	95.206	84.702			9525600	245	247	239	375	510;511	510		2	9606
DLILNPR	Unmodified	839.4865	0.48650199	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	0	1.5	0.5	1	1				17.899	17.899	2	0.0010528	10678	DP1141_7	118.06	60.245			124310000	246	402	240	376;377	512;513;514	513		3	9606
DLKDYFTK	Unmodified	1028.5179	0.51786169	532	Q99729	HNRNPAB	Heterogeneous nuclear ribonucleoprotein A/B	yes	yes	0	0	1	4	0				1		18.518	18.518	2	0.0037869	11592	DP1141_9	125.82	55.819			4486300	247	532	241	378	515	515		1	9606
DLLDTVLPHLYNETK	Unmodified	1769.92	0.91996535	458	Q86VP6	CAND1	Cullin-associated NEDD8-dissociated protein 1	yes	yes	0	0	0	2	0		1				22.45	22.45	2	1.1984E-14	17734	DP1141_7	167.44	104.98			9543400	248	458	242	379	516	516		1	9606
DLLHPSLEEEKKK	Unmodified	1564.8461	0.84607213	443	Q71UM5	RPS27L	40S ribosomal protein S27-like	yes	yes	0	0	2	5	0					1	15.658	15.658	3	0.0013949	7407	DP1141_10	122.18	96.648			42457000	249	443	243	380	517	517		0	9606
DLLHPSPEEEKRK	Unmodified	1576.8209	0.82092001	227	P42677	RPS27	40S ribosomal protein S27	yes	yes	0	0	2	3	2	1				1	14.447	14.447	3	1.9424E-09	5469	DP1141_10	158.34	121.76			97701000	250	227	244	381;382	518;519;520	518		3	9606
DLTTAGAVTQCYR	Unmodified	1454.6824	0.68237762	342	Q02543	RPL18A	60S ribosomal protein L18a	yes	yes	0	0	0	1	0	1					17.609	17.609	2	0.0046147	9813	DP1141_6	114.89	79.449			1902500	251	342	245	383	521	521		1	9606
DLWYLETEKPPPPAR	Unmodified	1810.9254	0.92538508	259	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	yes	yes	0	0	1	2	0		1				19.6	19.6	2	0.025222	13600	DP1141_7	101.47	68.468			17720000	252	259	246	384	522	522		1	9606
DMAGLLKPTACTMLVSSLR	2 Oxidation (M)	2095.0476	0.047567179	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	2	1	1	0	1					19.415	19.415	3	0.003768	12531	DP1141_6	78.456	53.002			5133700	253	142	247	385	523	523	137;138	1	9606
DMAGLLKPTACTMLVSSLR	Oxidation (M)	2079.0527	0.052652557	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	1	1	2	0		1				20.601	20.601	3	4.4443E-05	14891	DP1141_7	118.96	94.509			75474000	254	142	247	386	524;525	525	137;138	2	9606
DMPIQAFLLYQEPVLGPVR	Oxidation (M)	2201.1555	0.15546137	13	CON__P02666			yes	yes	0	1	0	3.71	1.03		1	2	2	2	23.612	23.612	2;3	0	19831	DP1141_10	353.65	320.33		+	91783000	255	13	248	387;388;389;390;391;392;393	526;527;528;529;530;531;532;533;534;535;536;537	526	12	12	
DNHLLGTFDLTGIPPAPR	Unmodified	1933.0058	0.005760665	139	P11021	HSPA5	78 kDa glucose-regulated protein	yes	yes	0	0	0	3	0			1			21.128	21.128	3	7.2527E-05	15482	DP1141_8	116.61	93.083			74816000	256	139	249	394	538;539	538		2	9606
DNHSPVPIITPTDPIDR	Unmodified	1885.9534	0.95339074	40	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	yes	yes	0	0	0	1	0	1					19.055	19.055	3	0.016356	11958	DP1141_6	70.802	35.711			7219100	257	40	250	395	540	540		0	9606
DPLLLAIIPK	Unmodified	1091.6954	0.69543213	565	Q9HAV4	XPO5	Exportin-5	yes	yes	0	0	0	2	0		1				22.92	22.92	2	0.011156	18326	DP1141_7	95.909	85.772			3387200	258	565	251	396	541;542	541		2	9606
DPQELVASFSER	Unmodified	1376.6572	0.65720872	594	Q9UHR5	SAP30BP	SAP30-binding protein	yes	yes	0	0	0	4	0				1		20.422	20.422	2	0.0072664	14360	DP1141_9	90.05	51.3			17752000	259	594	252	397	543	543		1	9606
DPQQPAQQQQPAQQPK	Unmodified	1815.8864	0.88637381	82	O75909	CCNK	Cyclin-K	yes	yes	0	0	0	3	0			1			13.443	13.443	2	0.0024053	3645	DP1141_8	136.96	115.18			2062000	260	82	253	398	544;545;546	545		3	9606
DPSLPLLELQDIMTSVSGR	Oxidation (M)	2086.0616	0.061620564	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	0	1.33	0.471	2	1				23.522	23.522	2;3	2.0445E-34	18649	DP1141_6	181.75	151.19			14144000	261	367	254	399;400;401	547;548;549;550;551	547	265	5	9606
DQSAVVVQGLPEGVAFK	Unmodified	1742.9203	0.9202997	327	P78347	GTF2I	General transcription factor II-I	yes	yes	0	0	0	2	0		1				20.491	20.491	2	2.2488999999999997E-19	14764	DP1141_7	154.23	112.69			0	262	327	255	402	552	552		1	9606
DREEDEEDAYERR	Unmodified	1710.7081	0.70813467	251	P49756	RBM25	RNA-binding protein 25	yes	yes	0	0	2	2	0		1				14.544	14.544	2	9.7385E-33	5339	DP1141_7	165.63	130.74			0	263	251	256	403	553	553		1	9606
DRLLASTLVHSVK	Unmodified	1437.8304	0.83036248	580	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	yes	yes	0	0	1	2	0		1				17.599	17.599	3	0.028073	10129	DP1141_7	93.237	70.745			37898000	264	580	257	404	554	554		0	9606
DSPALDKMIPSR	Oxidation (M)	1344.6708	0.6707503	625				yes	no	0	1	1	4	0				1		23.63	23.63	2	0.035947	19291	DP1141_9	83.647	49.725	+		28138000	265	625	258	405	555	555	429	0	9606
DSTFDLPADSIAPFHICYYGR	Unmodified	2444.1107	0.11069602	468	Q8N1G2	CMTR1	Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1	yes	yes	0	0	0	2	0		1				22.315	22.315	3	5.0064E-05	17453	DP1141_7	99.813	85.798			5846200	266	468	259	406	556	556		1	9606
DSTLIMQLLR	Oxidation (M)	1204.6486	0.64855829	316;290;201	P31946;P27348;Q04917;P61981;P31947;P63104;P62258	YWHAB;YWHAQ;YWHAH;YWHAG;SFN;YWHAZ;YWHAE	14-3-3 protein beta/alpha;14-3-3 protein beta/alpha, N-terminally processed;14-3-3 protein theta;14-3-3 protein eta;14-3-3 protein gamma;14-3-3 protein gamma, N-terminally processed;14-3-3 protein sigma;14-3-3 protein zeta/delta;14-3-3 protein epsilon	no	no	0	1	0	3.5	1.12		1	1	1	1	22.163	22.163	2	0.013798	17224	DP1141_9	111.95	81.377			72410000	267	201;316;290	260	407;408;409;410	557;558;559;560;561;562	562	170	6	9606
DTAASGYGTQNIR	Unmodified	1352.6321	0.6320566	614	Q9Y314	NOSIP	Nitric oxide synthase-interacting protein	yes	yes	0	0	0	4	0				1		15.747	15.747	2	2.9011999999999997E-21	7029	DP1141_9	169.65	76.492			3695600	268	614	261	411	563	563		0	9606
DTGILDSIGR	Unmodified	1045.5404	0.54038805	99	P02686	MBP	Myelin basic protein	yes	yes	0	0	0	5	0					1	19.426	19.426	2	8.963E-24	13550	DP1141_10	190.26	108.02			146190000	269	99	262	412	564	564		0	9606
DTGKTPVEPEVAIHR	Unmodified	1647.858	0.8580338	279	P60866	RPS20	40S ribosomal protein S20	yes	yes	0	0	1	5	0					1	15.506	15.506	3	4.416E-83	7247	DP1141_10	191.63	166.3			39188000	270	279	263	413	565;566	566		2	9606
DTKRCLEMK	Oxidation (M)	1195.5689	0.56892776	579	Q9NY28	GALNT8	Probable polypeptide N-acetylgalactosaminyltransferase 8	yes	yes	0	1	2	2	0		1				15.16	15.16	2	0.020866	6270	DP1141_7	77.923	22.553			12915000	271	579	264	414	567	567	411	0	9606
DTLLSVEIVHELKGEGK	Unmodified	1866.0098	0.0098429899	468	Q8N1G2	CMTR1	Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1	yes	yes	0	0	1	2	0		1				20.2	20.2	3	0.0027007	14434	DP1141_7	155.06	130.01			17999000	272	468	265	415	568	568		1	9606
DTPGHGSGWAETPR	Unmodified	1466.6539	0.65385468	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	3	1.22		2	1		1	15.515	15.515	2;3	9.6412E-16	6936	DP1141_7	153.54	117.88			401810000	273	78	266	416;417;418;419	569;570;571;572	571		4	9606
DTPLFSEAR	Unmodified	1034.5033	0.50327426	40	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	yes	yes	0	0	0	1	0	1					18.155	18.155	2	0.015676	10472	DP1141_6	104.06	60.288			24759000	274	40	267	420	573	573		0	9606
DTPTSAGPNSFNK	Unmodified	1334.6103	0.61025853	486	Q8WW12	PCNP	PEST proteolytic signal-containing nuclear protein	yes	yes	0	0	0	5	0					1	15.411	15.411	2	1.0321E-10	6876	DP1141_10	161.51	128.47			90735000	275	486	268	421	574;575	574		2	9606
DTSYLFITGPDVVK	Unmodified	1553.7977	0.79772495	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3	0			1			21.529	21.529	2	0.020281	16241	DP1141_8	90.913	62.736			121950000	276	111	269	422	576	576		1	9606
DVDAAYMNK	Unmodified	1025.4488	0.44879585	10;101;18;22	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;O95678;CON__O95678;CON__P13647;P13647;P04259;CON__Q14CN4-1;CON__Q6IME9;Q14CN4	KRT6A;KRT6C;KRT75;KRT5;KRT6B;KRT72	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 75;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 72	no	no	0	0	0	4	0				1		16.008	16.008	2	0.024211	7528	DP1141_9	95.352	12.681		+	51921000	277	10;18;101;22	270	423	577	577		0	9606
DVDAAYMNKVELQAK	Oxidation (M)	1709.8294	0.82943578	10;101;22	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;P04259;CON__Q14CN4-1;CON__Q6IME9;Q14CN4	KRT6A;KRT6C;KRT6B;KRT72	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 72	no	no	0	1	1	4	0				1		16.599	16.599	3	1.9438E-05	8531	DP1141_9	152.16	32.282		+	34078000	278	10;101;22	271	424	578	578	11	1	9606
DVDDGLQAAEEVGYPVMIK	Oxidation (M)	2063.9721	0.97213685	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	0	1	0	1					20.997	20.997	2	9.5663E-46	14693	DP1141_6	188.63	143.8			48729000	279	367	272	425	579;580	579	266	2	9606
DVDDGLQAAEEVGYPVMIK	Unmodified	2047.9772	0.97722223	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					21.898	21.898	2	2.9804E-05	16133	DP1141_6	116.96	86.523			8711500	280	367	272	426	581;582	582		2	9606
DVFLAWVASR	Unmodified	1162.6135	0.61349341	85	O94842	TOX4	TOX high mobility group box family member 4	yes	yes	0	0	0	2.5	0.5		1	1			22.883	22.883	2	0.0070205	18313	DP1141_7	118.18	76.95			5626900	281	85	273	427;428	583;584	583		1	9606
DVHTLLDR	Unmodified	967.50869	0.50869399	570	Q9NPD3	EXOSC4	Exosome complex component RRP41	yes	yes	0	0	0	5	0					1	16.893	16.893	2	9.2961E-07	9485	DP1141_10	149.4	70.785			105370000	282	570	274	429	585;586	585		2	9606
DVNAAIAAIK	Unmodified	984.5604	0.56039521	322	P68366	TUBA4A	Tubulin alpha-4A chain	yes	yes	0	0	0	4	0				1		18.529	18.529	2	0.023011	11700	DP1141_9	81.296	14.867			13636000	283	322	275	430	587	587		1	9606
DVNAAIATIK	Unmodified	1014.571	0.5709599	321;442	P68363;Q71U36;P0DPH8;P0DPH7;Q6PEY2	TUBA1B;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	no	no	0	0	0	3	0.816		1	1	1		17.937	17.937	2	0.0037363	10726	DP1141_9	109.66	44.906			1158600000	284	321;442	276	431;432;433	588;589;590	590		2	9606
DVPLGTPLCIIVEK	Unmodified	1552.8535	0.85346569	138	P10515	DLAT	Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial	yes	yes	0	0	0	3	0			1			22.37	22.37	2	0.035788	16597	DP1141_8	65.695	34.347			24329000	285	138	277	434	591	591		1	9606
DYFEQYGK	Unmodified	1048.4502	0.45017606	130	P09651;Q32P51;A0A2R8Y4L2	HNRNPA1;HNRNPA1L2	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2	yes	no	0	0	0	4	0				1		18.187	18.187	2	0.014358	11034	DP1141_9	91.9	70.928			13472000	286	130	278	435	592	592		1	9606
DYLHYIR	Unmodified	978.49232	0.49231565	295	P62280	RPS11	40S ribosomal protein S11	yes	yes	0	0	0	5	0					1	17.955	17.955	2	0.011981	11233	DP1141_10	122.98	70.342			0	287	295	279	436	593	593		1	9606
DYQELMNTK	Oxidation (M)	1156.507	0.50703901	102	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	KRT1	Keratin, type II cytoskeletal 1	no	no	0	1	0	2.5	1.12	1	1	1	1		15.594	15.594	2	1.0062E-12	6364	DP1141_6	163.15	98.944		+	374290000	288	102	280	437;438;439;440	594;595;596;597;598	594	83	5	9606
DYQELMNTK	Unmodified	1140.5121	0.51212439	102	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	KRT1	Keratin, type II cytoskeletal 1	no	no	0	0	0	3	0			1			17.718	17.718	2	0.00049575	10447	DP1141_8	132.76	77.982		+	16763000	289	102	280	441	599	599		1	9606
DYQELMNVK	Oxidation (M)	1154.5278	0.52777445	20	CON__P35908v2;CON__P35908;P35908;CON__Q5XKE5;Q5XKE5;CON__P12035;CON__Q01546;P12035;Q01546	KRT2;KRT79;KRT3;KRT76	Keratin, type II cytoskeletal 2 epidermal;Keratin, type II cytoskeletal 79;Keratin, type II cytoskeletal 3;Keratin, type II cytoskeletal 2 oral	yes	no	0	1	0	2	0		1				16.694	16.694	2	0.033309	8839	DP1141_7	93.429	73.725		+	72013000	290	20	281	442	600	600	24	0	9606
EAAAALVEEETRR	Unmodified	1443.7318	0.73177065	83	O75934	BCAS2	Pre-mRNA-splicing factor SPF27	yes	yes	0	0	1	5	0					1	16.881	16.881	2	3.1945E-279	9496	DP1141_10	235.01	135.2			53762000	291	83	282	443	601	601		1	9606
EAALIALR	Unmodified	855.5178	0.51780212	573	Q9NRP7	STK36	Serine/threonine-protein kinase 36	yes	yes	0	0	0	3	0			1			16.612	16.612	2	0.021515	8293	DP1141_8	88.643	14.204			1085300000	292	573	283	444	602	602		1	9606
EADGGGVGRGKDISTITGHR	Unmodified	1981.993	0.99296415	524	Q96T23	RSF1	Remodeling and spacing factor 1	yes	yes	0	0	2	5	0					1	19.901	19.901	2	0.017245	14295	DP1141_10	90.697	39.445			0	293	524	284	445	603	603		1	9606
EAETDEIKILLEESRAQQK	Unmodified	2229.1489	0.14885567	481	Q8TDY2	RB1CC1	RB1-inducible coiled-coil protein 1	yes	yes	0	0	2	3	0			2			14.527	14.527	3;4	0.011072	5379	DP1141_8	55.912	25.829			599220000	294	481	285	446;447	604;605	605		2	9606
EALENANTNTEVLK	Unmodified	1544.7682	0.76821573	561	Q9H444	CHMP4B	Charged multivesicular body protein 4b	yes	yes	0	0	0	4	0				1		16.605	16.605	2	0.0020357	8545	DP1141_9	150.09	87.512			16197000	295	561	286	448	606	606		1	9606
EALGGQALYPHVLVK	Unmodified	1593.8879	0.88787736	540	Q9BUJ2	HNRNPUL1	Heterogeneous nuclear ribonucleoprotein U-like protein 1	yes	yes	0	0	0	2	0		1				18.668	18.668	2	0.0010286	11978	DP1141_7	164.48	107.31			0	296	540	287	449	607	607		1	9606
EANNFLWPFK	Unmodified	1264.6241	0.6240581	167	P18124	RPL7	60S ribosomal protein L7	yes	yes	0	0	0	5	0					1	22.481	22.481	2	0.013295	18242	DP1141_10	91.069	57.324			27415000	297	167	288	450	608	608		1	9606
EAPPMEKPEVVK	Oxidation (M)	1368.6959	0.69590241	306	P62841	RPS15	40S ribosomal protein S15	yes	yes	0	1	1	3	2	1				1	13.939	13.939	3	0.0058792	4715	DP1141_10	115.29	69.378			15554000	298	306	289	451;452	609;610;611	609	240	2	9606
EASFEYLQNEGER	Unmodified	1570.69	0.68996541	367;40	Q13085;O00763	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	no	no	0	0	0	1	0	1					18.355	18.355	2	1.7961000000000002E-29	11006	DP1141_6	176.95	162.53			116850000	299	367;40	290	453	612;613;614;615	614		4	9606
EATKEVHTQAENAEFMR	Oxidation (M)	2005.9164	0.91635331	129	P09601	HMOX1	Heme oxygenase 1	yes	yes	0	1	1	5	0					1	16.116	16.116	3	0.028307	8341	DP1141_10	55.66	29.423			5718100	300	129	291	454	616	616	123	0	9606
EAYPGDVFYLHSR	Unmodified	1552.731	0.73104237	187	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	yes	yes	0	0	0	4	1			1		1	19.013	19.013	3	0.002957	12410	DP1141_8	104.17	67.031			59205000	301	187	292	455;456	617;618	618		1	9606
EDGNEEDKENQGDETQGQQPPQR	Unmodified	2627.0968	0.096773109	319	P67809	YBX1	Nuclease-sensitive element-binding protein 1	yes	yes	0	0	1	4	0				1		12.853	12.853	3	2.0227000000000002E-267	2890	DP1141_9	259.64	253.64			27383000	302	319	293	457	619;620;621;622	620		4	9606
EDLESSGLQR	Unmodified	1132.536	0.53603095	596	Q9UK76	HN1	Hematological and neurological expressed 1 protein;Hematological and neurological expressed 1 protein, N-terminally processed	yes	yes	0	0	0	5	0					1	15.826	15.826	2	0.0066842	7801	DP1141_10	120.15	57.69			10341000	303	596	294	458	623	623		1	9606
EDQTEYLEER	Unmodified	1310.5626	0.56263964	126	P08238;P07900;Q58FF6;Q58FF7	HSP90AB1;HSP90AA1;HSP90AB4P;HSP90AB3P	Heat shock protein HSP 90-beta;Heat shock protein HSP 90-alpha;Putative heat shock protein HSP 90-beta 4;Putative heat shock protein HSP 90-beta-3	yes	no	0	0	0	3	0			1			16.684	16.684	2	5.252E-05	8642	DP1141_8	150.27	105.92			6675300	304	126	295	459	624	624		1	9606
EDSQRPGAHLTVK	Unmodified	1436.7372	0.73719038	130	P09651;Q32P51	HNRNPA1;HNRNPA1L2	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2	yes	no	0	0	1	4	0				1		13.54	13.54	3	0.028179	3648	DP1141_9	90.412	50.832			4212600	305	130	296	460	625	625		1	9606
EDSVKPGAHLTVK	Unmodified	1379.7409	0.74087877	262	P51991	HNRNPA3	Heterogeneous nuclear ribonucleoprotein A3	yes	yes	0	0	1	4	0				1		14.111	14.111	2	0.010959	4518	DP1141_9	102.05	80.002			3610400	306	262	297	461	626	626		1	9606
EEAISNMVVALK	Oxidation (M)	1318.6803	0.68025235	367;40	Q13085;O00763	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	no	no	0	1	0	1	0	1					17.655	17.655	2	4.5448E-40	9841	DP1141_6	188.91	123.45			122300000	307	367;40	298	462	627;628	627	33	2	9606
EEAISNMVVALK	Unmodified	1302.6853	0.68533773	367;40	Q13085;O00763	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	no	no	0	0	0	1	0	1					19.856	19.856	2	1.8894E-21	13125	DP1141_6	172.98	129.54			97948000	308	367;40	298	463	629	629		1	9606
EEEEFNTGPLSVLTQSVK	Unmodified	2005.9844	0.9844161	298	P62316	SNRPD2	Small nuclear ribonucleoprotein Sm D2	yes	yes	0	0	0	5	0					1	21.989	21.989	2	5.0492E-20	17389	DP1141_10	155.86	97.758			0	309	298	299	464	630	630		1	9606
EEEIAALVIDNGSGMCK	Acetyl (Protein N-term);Oxidation (M)	1892.8496	0.84957888	318	P63261	ACTG1	Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	yes	yes	1	1	0	4	0				1		23.301	23.301	2	0.00015116	18856	DP1141_9	125.84	80.075			10889000	310	318	300	465	631;632	631	245	2	9606
EEFLIPIYHQVAVQFADLHDTPGR	Unmodified	2794.4079	0.40786432	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	4	1.22		1		1	2	22.488	22.488	3;4	2.6678E-11	17729	DP1141_7	131.56	98.191			12133000	311	367	301	466;467;468;469	633;634;635;636;637	636		5	9606
EEGIGPENLR	Unmodified	1112.5462	0.54620171	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1.5	0.5	1	1				16.908	16.908	2	1.0956E-13	8435	DP1141_6	166.52	115.45			211910000	312	367	302	470;471	638;639;640;641;642	639		5	9606
EEPSNPFLAFVEK	Unmodified	1505.7402	0.74021007	447	Q7LBC6	KDM3B	Lysine-specific demethylase 3B	yes	yes	0	0	0	2.5	0.5		1	1			22.616	22.616	2	0.0061576	17961	DP1141_7	91.469	50.389			17363000	313	447	303	472;473	643;644	643		2	9606
EEQQLHRQERDR	Unmodified	1622.7873	0.78732847	352	Q07283	TCHH	Trichohyalin	yes	no	0	0	2	5	0					1	18.762	18.762	2	0.013379	12544	DP1141_10	106.4	66.526			0	314	352	304	474	645	645		1	9606
EFGAGPLFNQILPLLMSPTLEDQER	Oxidation (M)	2830.4211	0.42113112	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	1	0	2	0		1				25.155	25.155	3	1.1908E-11	21616	DP1141_7	124.31	93.544			5386600	315	78	305	475	646	646	64	1	9606
EFLHAQEEVKR	Unmodified	1384.7099	0.709913	230	P43686	PSMC4	26S protease regulatory subunit 6B	yes	yes	0	0	1	4	0				1		14.933	14.933	3	0.014204	5756	DP1141_9	78.488	24.891			13952000	316	230	306	476	647	647		1	9606
EFLIKLGLVNDK	Unmodified	1387.8075	0.80750177	564	Q9HAU5	UPF2	Regulator of nonsense transcripts 2	yes	yes	0	0	1	5	0					1	20.626	20.626	2	0.018206	15219	DP1141_10	106.88	32.715			6342400	317	564	307	477	648	648		0	9606
EFQSPDEEMKK	Unmodified	1366.6075	0.60748134	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	1.67	0.471	1	2				15.059	15.059	2;3	0.0023573	6139	DP1141_7	146.11	115.9			310530000	318	78	308	478;479;480	649;650;651;652;653	652		5	9606
EFTEAVEAK	Unmodified	1022.492	0.49204087	206	P35232	PHB	Prohibitin	yes	yes	0	0	0	5	0					1	15.736	15.736	2	0.010204	7564	DP1141_10	98.458	64.455			38796000	319	206	309	481	654	654		1	9606
EGLPLMVFANWR	Oxidation (M)	1447.7282	0.7282056	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	0	2.5	1.12	1	1	1	1		22.706	22.706	2	2.5302E-05	17977	DP1141_9	153.08	124.39			86839000	320	367	310	482;483;484;485	655;656;657;658;659;660	660	267	5	9606
EGLPLMVFANWR	Unmodified	1431.7333	0.73329097	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	2.5	0.5		1	1			23.906	23.906	2	3.4096E-40	19797	DP1141_7	185.72	149.81			16650000	321	367	310	486;487	661;662;663;664	661		4	9606
EGMNIVEAMER	2 Oxidation (M)	1309.5642	0.56423631	315	P62937	PPIA	Peptidyl-prolyl cis-trans isomerase A;Peptidyl-prolyl cis-trans isomerase A, N-terminally processed	yes	yes	0	2	0	1	0	1					15.29	15.29	2	0.026917	5986	DP1141_6	82.029	44.964			6261500	322	315	311	488	665	665	243;244	1	9606
EGPAVVGQFIQDVK	Unmodified	1485.7827	0.78274359	458	Q86VP6	CAND1	Cullin-associated NEDD8-dissociated protein 1	yes	yes	0	0	0	2	0		1				20.501	20.501	2	0.0038674	14849	DP1141_7	108.98	65.215			44828000	323	458	312	489	666	666		1	9606
EGPLCDELIR	Unmodified	1200.5809	0.58087266	399	Q15029	EFTUD2	116 kDa U5 small nuclear ribonucleoprotein component	yes	yes	0	0	0	2	0		1				18.8	18.8	2	0.012178	12245	DP1141_7	93.598	63.28			33421000	324	399	313	490	667	667		1	9606
EGRVILERALVR	Unmodified	1409.8467	0.84668125	301	P62699	YPEL5	Protein yippee-like 5	yes	yes	0	0	2	5	0					1	22.515	22.515	2	0.0089348	18264	DP1141_10	97.597	75.258			7527600	325	301	314	491	668	668		0	9606
EGSIEIDIPVPK	Unmodified	1295.6973	0.69728262	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	0	3	1.41	1	1	1	1	1	20.014	20.014	2	0.0024805	13894	DP1141_9	151.22	106.84			561590000	326	521	315	492;493;494;495;496	669;670;671;672;673;674;675;676;677;678;679;680	678		12	9606
EGTLTQVPLAPPPPGAPPSPAPAR	Unmodified	2317.243	0.24303082	243	P48634	PRRC2A	Protein PRRC2A	yes	yes	0	0	0	2	0		1				19.1	19.1	3	0.026368	12769	DP1141_7	41.017	27.59			6113200	327	243	316	497	681	681		1	9606
EHALLAYTLGVK	Unmodified	1313.7343	0.73433683	320	P68104;Q5VTE0;Q05639	EEF1A1;EEF1A1P5;EEF1A2	Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3;Elongation factor 1-alpha 2	yes	no	0	0	0	4	0				2		19.088	19.088	2;3	2.2779999999999997E-66	12377	DP1141_9	201.61	161.99			14753000	328	320	317	498;499	682;683	682		1	9606
EHFQHVAAPYIAK	Unmodified	1509.7728	0.7728476	559	Q9H2P0	ADNP	Activity-dependent neuroprotector homeobox protein	yes	yes	0	0	0	4	0				1		16.008	16.008	3	0.027711	7581	DP1141_9	68.463	37.466			18303000	329	559	318	500	684	684		0	9606
EHHFGSSGMTLHER	Unmodified	1623.7212	0.72122274	612	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	yes	yes	0	0	0	2.67	0.943		2		1		14.689	14.689	3;4	0.00088589	5633	DP1141_7	126.09	111.14			91788000	330	612	319	501;502;503	685;686;687	685		2	9606
EHLELLKHMHTVGEK	Oxidation (M)	1815.9302	0.93015288	448	Q7Z2E3	APTX	Aprataxin	yes	yes	0	1	1	2	0		1				15.409	15.409	3	0.015295	6579	DP1141_7	64.224	33.01			2621100	331	448	320	504	688	688	334	0	9606
EHVEPVFGFPQFVR	Unmodified	1686.8518	0.85182621	81	O75792	RNASEH2A	Ribonuclease H2 subunit A	yes	yes	0	0	0	4	0				1		21.03	21.03	3	0.0011827	15437	DP1141_9	104.17	78.853			2153800	332	81	321	505	689	689		1	9606
EIAEAYLGK	Unmodified	992.51786	0.51786169	140	P11142	HSPA8	Heat shock cognate 71 kDa protein	yes	yes	0	0	0	3	0			1			17.323	17.323	2	0.019994	9644	DP1141_8	96.492	26.493			47927000	333	140	322	506	690	690		0	9606
EIAQDFKTDLR	Unmodified	1334.683	0.68302954	324	Q71DI3;Q16695;P84243;P68431	HIST2H3A;HIST3H3;H3F3A;HIST1H3A	Histone H3.2;Histone H3.1t;Histone H3.3;Histone H3.1	yes	no	0	0	1	5	0					2	17.237	17.237	2;3	1.1836E-51	9991	DP1141_10	194.12	118.02			55217000	334	324	323	507;508	691;692	692		2	9606
EIEELKELLPEIR	Unmodified	1609.8927	0.89268797	245	P49321	NASP	Nuclear autoantigenic sperm protein	yes	yes	0	0	1	2	0		1				21.248	21.248	2	4.0394999999999995E-80	15829	DP1141_7	168.85	131.13			7504800	335	245	324	509	693	693		1	9606
EIEFLPSR	Unmodified	989.5182	0.51819605	40	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	yes	yes	0	0	0	1	0	1					19.055	19.055	2	0.0010543	11937	DP1141_6	130.04	52.117			9225700	336	40	325	510	694	694		0	9606
EIETYHNLLEGGQEDFESSGAGK	Unmodified	2509.1245	0.12449141	19	CON__P35527;P35527	KRT9	Keratin, type I cytoskeletal 9	yes	no	0	0	0	2	1	1		1			19.39	19.39	3	1.6278E-55	12587	DP1141_6	133.21	113.81		+	82603000	337	19	326	511;512	695;696;697	695		2	9606
EIFLSQPILLELEAPLK	Unmodified	1952.1234	0.12341618	286;212;287	P62140;P62136;P36873	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	no	no	0	0	0	3.5	1.12		1	1	1	1	24.447	24.447	2	3.2653E-247	20378	DP1141_8	255.54	236.96			97583000	338	287;286;212	327	513;514;515;516	698;699;700;701;702;703	701		6	9606
EIIDLVLDR	Unmodified	1084.6128	0.61282471	321;442	P68363;Q71U36	TUBA1B;TUBA1A	Tubulin alpha-1B chain;Tubulin alpha-1A chain	no	no	0	0	0	1.67	0.943	2		1			21.33	21.33	2	1.1423E-43	15431	DP1141_6	176.09	74.76			945910000	339	321;442	328	517;518;519	704;705;706;707	704		4	9606
EIISNLAK	Unmodified	886.51238	0.51238239	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	2	0		1				16.594	16.594	2	0.0002199	8616	DP1141_7	128.86	4.2669			1394900000	340	78	329	520	708;709	708		2	9606
EILGTAQSVGCNVDGR	Unmodified	1674.7995	0.79953264	197	P30050	RPL12	60S ribosomal protein L12	yes	yes	0	0	0	5	0					1	17.538	17.538	2	0.017208	10478	DP1141_10	84.169	56.741			68869000	341	197	330	521	710	710		0	9606
EITALAPSTMK	Oxidation (M)	1176.606	0.60602477	277;318	P60709;P68133;P68032;P63267;P62736;P63261	ACTB;ACTA1;ACTC1;ACTG2;ACTA2;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, alpha skeletal muscle;Actin, alpha cardiac muscle 1;Actin, gamma-enteric smooth muscle;Actin, aortic smooth muscle;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	no	no	0	1	0	3	1		1		1		16.137	16.137	2	0.021674	7699	DP1141_9	112.3	70.419			63351000	342	277;318	331	522;523	711;712	712	228	0	9606
EITALAPSTMK	Unmodified	1160.6111	0.61111015	277;318	P60709;P68133;P68032;P63267;P62736;P63261	ACTB;ACTA1;ACTC1;ACTG2;ACTA2;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, alpha skeletal muscle;Actin, alpha cardiac muscle 1;Actin, gamma-enteric smooth muscle;Actin, aortic smooth muscle;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	no	no	0	0	0	3	1		1		1		17.394	17.394	2	0.0047861	9922	DP1141_7	104.42	80.901			68314000	343	277;318	331	524;525	713;714	713		1	9606
EIVHLQAGQCGNQIGAK	Unmodified	1821.9156	0.91556545	323	P68371;P04350	TUBB4B;TUBB4A	Tubulin beta-4B chain;Tubulin beta-4A chain	yes	no	0	0	0	2.5	1.5	1			1		16.232	16.232	3	0.00021706	7451	DP1141_6	103.66	0			143070000	344	323	332	526;527	715;716	715		2	9606
EKAQELSDWIHQLESEK	Unmodified	2069.0065	0.006548526	148	P13805	TNNT1	Troponin T, slow skeletal muscle	yes	yes	0	0	1	5	0					1	20.591	20.591	2	0.0038641	15333	DP1141_10	110.39	25.729			0	345	148	333	528	717	717		1	9606
EKLCYVALDFEQEMATAASSSSLEK	Unmodified	2806.3041	0.30411203	277;318	P60709;Q6S8J3;P63261	ACTB;POTEE;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;POTE ankyrin domain family member E;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	no	no	0	0	1	4.5	0.5				1	1	18.806	18.806	5	0.023361	12655	DP1141_10	34.817	9.9208			545090000	346	277;318	334	529;530	718;719	718		2	9606
EKPQTLPSAVK	Unmodified	1196.6765	0.6764876	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	1	3.5	0.5			1	1		14.327	14.327	2	1.5272E-12	4931	DP1141_8	178.54	74.485			54211000	347	365	335	531;532	720;721	720		1	9606
EKPQTLPSAVKGDEK	Unmodified	1625.8625	0.86245047	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	2	2.92	1.38	3	2	3	3	2	14.008	14.008	2;3;4	5.647E-138	4455	DP1141_8	227.06	153.17			2320900000	348	365	336	533;534;535;536;537;538;539;540;541;542;543;544;545	722;723;724;725;726;727;728;729;730;731;732;733;734;735;736;737;738;739;740;741;742;743;744;745;746;747	741		26	9606
EKSRMNLPK	Oxidation (M)	1117.5914	0.59137776	393	Q14746	COG2	Conserved oligomeric Golgi complex subunit 2	yes	yes	0	1	2	2	0		1				16.176	16.176	2	0.02004	7605	DP1141_7	82.75	25.94			8363000	349	393	337	546	748	748	302	0	9606
EKVDSQYPPVQR	Unmodified	1444.731	0.73104237	252	P49790	NUP153	Nuclear pore complex protein Nup153	yes	yes	0	0	1	3.5	0.5			1	1		14.611	14.611	3	0.016398	5423	DP1141_8	91.313	69.238			26755000	350	252	338	547;548	749;750	749		2	9606
EKYGINTDPPK	Unmodified	1260.635	0.63501672	615	Q9Y3B4	SF3B6	Splicing factor 3B subunit 6	yes	yes	0	0	1	5	0					1	15.24	15.24	3	0.025636	6531	DP1141_10	94.363	18.854			54211000	351	615	339	549	751;752	752		2	9606
EKYIDQELNK	Unmodified	1278.6456	0.6455814	417	Q58FG0	HSP90AA5P	Putative heat shock protein HSP 90-alpha A5	yes	yes	0	0	1	1	0	1					14.804	14.804	2	0.01804	5135	DP1141_6	122.19	35.354			0	352	417	340	550	753	753		1	9606
ELAEDGYSGVEVR	Unmodified	1422.6627	0.66268803	182	P23396	RPS3	40S ribosomal protein S3	yes	yes	0	0	0	5	0					1	17.538	17.538	2	1.9604E-66	10595	DP1141_10	199.33	142.9			184940000	353	182	341	551	754;755	755		2	9606
ELALALQEALEPAVR	Unmodified	1621.9039	0.90392136	418	Q5RKV6	EXOSC6	Exosome complex component MTR3	yes	yes	0	0	0	5	0					1	22.108	22.108	2	1.9322E-31	17434	DP1141_10	182.41	144.73			14388000	354	418	342	552	756;757	756		2	9606
ELAPAVSVLQLFCSSPK	Unmodified	1844.9706	0.97062071	588	Q9UBF2;Q9Y678	COPG2;COPG1	Coatomer subunit gamma-2;Coatomer subunit gamma-1	yes	no	0	0	0	3	0			1			23.665	23.665	2	0.011883	19205	DP1141_8	83.729	48.206			5472100	355	588	343	553	758	758		1	9606
ELEPGDGPIAVIVCPTR	Unmodified	1821.9295	0.92948418	460	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	yes	yes	0	0	0	2	0		1				20.8	20.8	2	0.0031569	15390	DP1141_7	108.59	75.736			17749000	356	460	344	554	759;760	760		2	9606
ELEQVCNPIISGLYQGAGGPGPGGFGAQGPK	Unmodified	3054.4869	0.48691928	135	P0DMV8;P0DMV9	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	yes	no	0	0	0	3	0			1			21.781	21.781	3	7.8814E-12	16463	DP1141_8	101.71	80.219			0	357	135	345	555	761	761		1	9606
ELGITALHIK	Unmodified	1093.6495	0.64954457	291	P62263	RPS14	40S ribosomal protein S14	yes	yes	0	0	0	5	0					1	18.337	18.337	2	0.0062267	11955	DP1141_10	120.87	38.197			14779000	358	291	346	556	762	762		1	9606
ELGPDGEEAEGPGAGDGPPR	Unmodified	1905.8341	0.83406347	168	P18615	NELFE	Negative elongation factor E	yes	yes	0	0	0	4	0				1		16.556	16.556	2	1.829E-12	8510	DP1141_9	190.57	156.49			11833000	359	168	347	557	763;764	764		2	9606
ELGQITQK	Unmodified	915.50255	0.50254598	623				yes	yes	0	0	0	1	0	1					17.655	17.655	2	0.018941	9947	DP1141_6	97.602	8.2327	+		3305600	360	623	348	558	765	765		1	9606
ELHGQNPVVTPCNK	Unmodified	1591.7777	0.77767498	413	Q16630	CPSF6	Cleavage and polyadenylation specificity factor subunit 6	yes	yes	0	0	0	3	0			1			14.624	14.624	3	0.026557	5249	DP1141_8	65.092	31.124			50741000	361	413	349	559	766	766		0	9606
ELIIGDR	Unmodified	814.45487	0.45486751	187	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	yes	yes	0	0	0	3.5	1.5		1			1	17.024	17.024	2	0.022555	9265	DP1141_7	100.74	31.359			47967000	362	187	350	560;561	767;768	768		2	9606
ELINLIQCR	Unmodified	1157.6227	0.62267789	595	Q9UK61	FAM208A	Protein FAM208A	yes	yes	0	0	0	2	0		1				19.7	19.7	2	0.0040625	13724	DP1141_7	104.75	57.089			40147000	363	595	351	562	769	769		1	9606
ELIPNIPFQMLLR	Oxidation (M)	1598.8854	0.88543452	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	1	0	2.75	0.829		2	1	1		23.143	23.143	2;3	0.0028794	18644	DP1141_7	137.95	90.766			611710000	364	142	352	563;564;565;566	770;771;772;773	770	139	4	9606
ELIPNIPFQMLLR	Unmodified	1582.8905	0.8905199	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2	0		1				24.042	24.042	2	2.7133E-09	20160	DP1141_7	157.66	132.81			45378000	365	142	352	567	774;775	774		2	9606
ELLDLAMQNAWFR	Oxidation (M)	1621.7923	0.79226242	460	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	yes	yes	0	1	0	2	0		1				22.455	22.455	2	1.348E-09	17642	DP1141_7	161.27	120.77			26986000	366	460	353	568	776	776	339	1	9606
ELLDLAMQNAWFR	Unmodified	1605.7973	0.79734779	460	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	yes	yes	0	0	0	2	0		1				23.592	23.592	2	0.0038131	19412	DP1141_7	140.83	112.26			6768000	367	460	353	569	777	777		1	9606
ELNEALELK	Unmodified	1057.5655	0.56554017	104	P04637	TP53	Cellular tumor antigen p53	yes	yes	0	0	0	4	1			1		1	17.905	17.905	2	0.00060054	10695	DP1141_8	135.71	67.814			64513000	368	104	354	570;571	778;779	779		2	9606
ELQSVKPQEAPK	Unmodified	1352.73	0.72997974	498	Q92917	GPKOW	G patch domain and KOW motifs-containing protein	yes	yes	0	0	1	3	0			1			14.017	14.017	3	0.016741	4468	DP1141_8	108.9	54.56			10345000	369	498	355	572	780	780		1	9606
ELSMENQCSLDMKSKLNTSK	2 Oxidation (M)	2374.0814	0.081446082	423	Q5TC82	RC3H1	Roquin-1	yes	yes	0	2	2	3	0			1			21.729	21.729	2	0.018582	16427	DP1141_8	55.899	31.203			66244000	370	423	356	573	781	781	319;320	1	9606
ELSQCNCIDLSK	Unmodified	1465.6541	0.65411395	421	Q5TAX3	ZCCHC11	Terminal uridylyltransferase 4	yes	yes	0	0	0	1	0	1					15.259	15.259	2	0.010979	5847	DP1141_6	96.665	0			167660000	371	421	357	574	782	782		0	9606
ELTLQAMADGVNKGR	Unmodified	1601.8195	0.8195398	158	P16519	PCSK2	Neuroendocrine convertase 2	yes	yes	0	0	1	5	0					1	18.624	18.624	2	0.0078674	12323	DP1141_10	106.62	16.792			0	372	158	358	575	783	783		1	9606
ELTTEIDNNIEQISSYKSEITELRR	Unmodified	2980.4989	0.49892375	17	CON__P13645;P13645	KRT10	Keratin, type I cytoskeletal 10	yes	no	0	0	2	4	0				1		20.914	20.914	4	0.0029713	15331	DP1141_9	48.244	22.088		+	7437600	373	17	359	576	784	784		1	9606
EMWTEVPK	Oxidation (M)	1034.4743	0.47428232	298	P62316	SNRPD2	Small nuclear ribonucleoprotein Sm D2	yes	yes	0	1	0	5	0					1	16.898	16.898	2	0.031953	9498	DP1141_10	81.191	35.175			0	374	298	360	577	785	785	236	1	9606
ENNVDAVHPGYGFLSER	Unmodified	1902.886	0.88603946	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2	0		1				18.6	18.6	3	4.4588E-10	11862	DP1141_7	157.8	124.5			497110000	375	142	361	578	786	786		1	9606
ENSKYLDEELMVLSSNSMSLTTR	Oxidation (M)	2662.2466	0.24659716	487	Q8WWI1	LMO7	LIM domain only protein 7	yes	yes	0	1	1	2	0		1				18.9	18.9	4	0.028343	12075	DP1141_7	40.952	13.342			126430000	376	487	362	579	787	787	358	0	9606
ENSLLVLDTASHSIK	Unmodified	1625.8625	0.86245047	437	Q6VVB1	NHLRC1	E3 ubiquitin-protein ligase NHLRC1	yes	yes	0	0	0	2	0		1				13.99	13.99	4	0.022943	4366	DP1141_7	40.751	9.171			28784000	377	437	363	580	788	788		1	9606
EPLYEKDSSVAAR	Unmodified	1463.7256	0.72562264	61	O43809	NUDT21	Cleavage and polyadenylation specificity factor subunit 5	yes	yes	0	0	1	5	0					1	15.32	15.32	3	0.0092661	6867	DP1141_10	128.57	101.94			76131000	378	61	364	581	789	789		1	9606
EPSPPIDEVINTPR	Unmodified	1562.794	0.79403656	64	O60684	KPNA6	Importin subunit alpha-7	yes	yes	0	0	0	3	0			1			18.903	18.903	2	0.011574	12189	DP1141_8	110.93	81.165			0	379	64	365	582	790	790		1	9606
EQAQILDNYTLK	Unmodified	1434.7355	0.73545904	629				yes	yes	0	0	0	4	0				1		17.088	17.088	2	0.013176	9174	DP1141_9	86.136	20.858	+		33340000	380	629	366	583	791	791		1	9606
EQEPMPTVDSHEPR	Oxidation (M)	1666.7257	0.72569899	563	Q9H910	HN1L	Hematological and neurological expressed 1-like protein	yes	yes	0	1	0	5	0					1	14.305	14.305	3	0.00098176	5182	DP1141_10	120.6	113.16			28854000	381	563	367	584	792;793	792	402	2	9606
EQEPMPTVDSHEPR	Unmodified	1650.7308	0.73078437	563	Q9H910	HN1L	Hematological and neurological expressed 1-like protein	yes	yes	0	0	0	5	0					1	15.415	15.415	3	0.025496	7140	DP1141_10	61.212	44.011			7236500	382	563	367	585	794	794		1	9606
EQGVLSFWR	Unmodified	1120.5665	0.56654322	109	P05141;P12236	SLC25A5;SLC25A6	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed;ADP/ATP translocase 3;ADP/ATP translocase 3, N-terminally processed	yes	no	0	0	0	1	0	1					21.256	21.256	2	0.0012874	15357	DP1141_6	127.02	44.569			12876000	383	109	368	586	795;796	796		2	9606
EQIVPKPEEEVAQKK	Unmodified	1750.9465	0.94651445	169	P18621	RPL17	60S ribosomal protein L17	yes	yes	0	0	2	5	0					1	14.843	14.843	3	7.2116E-06	6141	DP1141_10	153.32	120.8			19658000	384	169	369	587	797;798	797		2	9606
EQNRLAQMNAITQHAK	Unmodified	1851.9374	0.93736352	624				yes	yes	0	0	1	4	0				1		17.088	17.088	3	0.013623	9275	DP1141_9	100.18	60.674	+		243760000	385	624	370	588	799	799		1	9606
EQSSYHGNQQSYPQEVHGSSR	Unmodified	2404.0428	0.042827466	591	Q9UGU0	TCF20	Transcription factor 20	yes	yes	0	0	0	2	0		1				14.024	14.024	4	0.029633	4549	DP1141_7	41.257	25.665			1796400	386	591	371	589	800	800		0	9606
EREEFLIPIYHQVAVQFADLHDTPGR	Unmodified	3079.5516	0.55156844	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	4	0				1		21.796	21.796	4	1.0822E-11	16662	DP1141_9	113.23	91.107			2290600	387	367	372	590	801	801		1	9606
ERPQDRPEDLDVPPALADFIHQQR	Unmodified	2841.4158	0.41580324	340	Q01780	EXOSC10	Exosome component 10	yes	yes	0	0	2	2.5	0.5		1	1			20.298	20.298	4	6.5591E-08	14504	DP1141_7	137.23	118.69			28617000	388	340	373	591;592	802;803	802		1	9606
ESFADVLPEAAALVK	Unmodified	1558.8243	0.82427405	424	Q5VT52	RPRD2	Regulation of nuclear pre-mRNA domain-containing protein 2	yes	yes	0	0	0	2	0		1				22.522	22.522	2	0.0036447	17802	DP1141_7	132.56	102.79			12689000	389	424	374	593	804	804		1	9606
ESLCQAALGLILK	Unmodified	1414.7854	0.78538612	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	0	2.5	1.12	1	1	1	1		23.448	23.448	2	0.0038811	19155	DP1141_7	119.62	90.372			387030000	390	521	375	594;595;596;597	805;806;807;808;809;810	806		6	9606
ESQPAIWNR	Unmodified	1099.5411	0.54105675	388	Q14676	MDC1	Mediator of DNA damage checkpoint protein 1	yes	yes	0	0	0	2	0		1				17.393	17.393	2	0.027979	9535	DP1141_7	77.282	50.32			22320000	391	388	376	598	811	811		1	9606
ESTLHLVLR	Unmodified	1066.6135	0.61349341	134	P62987;P62979;P0CG47;P0CG48;A0A2R8Y422	UBA52;RPS27A;UBB;UBC	Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Polyubiquitin-B;Ubiquitin;Polyubiquitin-C;Ubiquitin	yes	no	0	0	0	5	0					1	17.562	17.562	2	9.8983E-56	10594	DP1141_10	180.93	131.83			0	392	134	377	599	812	812		1	9606
ESYSVYVYK	Unmodified	1136.539	0.53899107	65	Q99880;Q99879;Q99877;Q93079;Q5QNW6;P62807;P58876;P57053;O60814	HIST1H2BL;HIST1H2BM;HIST1H2BN;HIST1H2BH;HIST2H2BF;HIST1H2BC;HIST1H2BD;H2BFS;HIST1H2BK	Histone H2B type 1-L;Histone H2B type 1-M;Histone H2B type 1-N;Histone H2B type 1-H;Histone H2B type 2-F;Histone H2B type 1-C/E/F/G/I;Histone H2B type 1-D;Histone H2B type F-S;Histone H2B type 1-K	yes	no	0	0	0	5	0					1	17.838	17.838	2	0.0043146	11069	DP1141_10	122.74	69.956			65282000	393	65	378	600	813	813		1	9606
ETDPVKSPPLPEHQK	Unmodified	1700.8733	0.87334951	514	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	yes	yes	0	0	1	2	0		1				14.759	14.759	3	0.023574	5604	DP1141_7	83.633	56.535			28272000	394	514	379	601	814	814		1	9606
ETGYVVERPSTTK	Unmodified	1465.7413	0.7412727	580	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	yes	yes	0	0	1	2	0		1				14.759	14.759	3	1.4372E-11	5692	DP1141_7	147.58	120.99			83555000	395	580	380	602	815	815		0	9606
ETLIEIR	Unmodified	872.49673	0.49673232	624				yes	yes	0	0	0	1	0	1					18.654	18.654	2	0.03233	11398	DP1141_6	97.596	17.219	+		15407000	396	624	381	603	816	816		1	9606
ETNLDSLPLVDTHSKR	Unmodified	1823.9377	0.93774068	127	P08670	VIM	Vimentin	yes	yes	0	0	1	3	0			1			17.424	17.424	3	0.009369	9964	DP1141_8	75.574	50.257			16643000	397	127	382	604	817	817		0	9606
ETSHASLPQPEPPGGGGSK	Unmodified	1831.8701	0.87005504	591	Q9UGU0	TCF20	Transcription factor 20	yes	yes	0	0	0	2	0		1				15.303	15.303	3	0.031573	6491	DP1141_7	45.916	16.903			4655000	398	591	383	605	818	818		1	9606
EVASNSELVQSSR	Unmodified	1404.6845	0.68448611	16	CON__P08779;P08779	KRT16	Keratin, type I cytoskeletal 16	yes	no	0	0	0	4	0				1		15.224	15.224	2	0.0077779	6365	DP1141_9	89.266	24.612		+	9822900	399	16	384	606	819	819		1	9606
EVATNSELVQSGK	Unmodified	1360.6834	0.68342347	9;21	CON__P02533;P02533;CON__Q04695;Q04695;CON__Q9QWL7	KRT14;KRT17	Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 17	no	no	0	0	0	2.5	1.5	1			1		15.242	15.242	2	3.0558E-135	6172	DP1141_9	231.07	184.25		+	316660000	400	9;21	385	607;608	820;821	821		2	9606
EVCEQNQQLLR	Unmodified	1415.6827	0.68271197	89	O95239	KIF4A	Chromosome-associated kinesin KIF4A	yes	yes	0	0	0	2	0		1				16.224	16.224	2	2.5436E-15	7996	DP1141_7	153.08	78.91			0	401	89	386	609	822	822		1	9606
EVDEQMLNVQNK	Oxidation (M)	1461.677	0.67695789	122;323;381	P07437;P68371;Q13885;Q9BVA1	TUBB;TUBB4B;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-2A chain;Tubulin beta-2B chain	no	no	0	1	0	3.5	1.12		1	1	1	1	15.543	15.543	2	4.4692999999999995E-228	6770	DP1141_9	256.47	182.62			261890000	402	122;323;381	387	610;611;612;613	823;824;825;826;827	826	107	5	9606
EVFFMNTQSIVQLVQR	Oxidation (M)	1953.9982	0.99823245	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	0	1	0	2					21.968	21.968	2;3	3.5112E-83	16541	DP1141_6	206.1	180.08			91878000	403	367	388	614;615	828;829;830	828	268	3	9606
EVKMEARK	Oxidation (M)	1005.5277	0.52771487	568	Q9HCH0	NCKAP5L	Nck-associated protein 5-like	yes	yes	0	1	2	5	0					1	17.687	17.687	2	0.025477	11097	DP1141_10	62.464	21.035			17068000	404	568	389	616	831	831	409	0	9606
EVMLILIR	Unmodified	985.59942	0.59942325	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	2	0		1				21.3	21.3	2	1.1679E-06	15962	DP1141_7	148.07	148.07			95238000	405	78	390	617	832	832		1	9606
EVMLVGIGDK	Oxidation (M)	1075.5583	0.5583463	210	P36542	ATP5C1	ATP synthase subunit gamma, mitochondrial	yes	yes	0	1	0	4	0				1		17.868	17.868	2	0.01768	10526	DP1141_9	96.143	35.383			0	406	210	391	618	833	833	176	1	9606
EVMPLLLAYLK	Oxidation (M)	1304.7414	0.74139604	483	Q8TEX9	IPO4	Importin-4	yes	yes	0	1	0	2	0		1				22.35	22.35	2	0.022988	17444	DP1141_7	80.438	27.652			6156100	407	483	392	619	834	834	357	0	9606
EVSFQSTGESEWK	Unmodified	1512.6733	0.67325272	350	Q07021	C1QBP	Complement component 1 Q subcomponent-binding protein, mitochondrial	yes	yes	0	0	0	5	0					1	18.337	18.337	2	0	11766	DP1141_10	274.53	187.65			95062000	408	350	393	620	835;836	836		2	9606
EYEAEGIAK	Unmodified	1008.4764	0.47639081	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3	0			1			15.221	15.221	2	0.02281	6216	DP1141_8	122.74	78.05			15532000	409	567	394	621	837	837		0	9606
EYEAEGIAKDGAK	Unmodified	1379.6569	0.65687437	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	1	3	0			2			14.49	14.49	2;3	6.1917E-205	5214	DP1141_8	270.54	185.38			12729000	410	567	395	622;623	838;839;840	840		3	9606
EYSSELNAPSQESDSHPR	Unmodified	2031.877	0.87699092	251	P49756	RBM25	RNA-binding protein 25	yes	yes	0	0	0	3	0			1			15.32	15.32	3	0.014151	6557	DP1141_8	69.805	58.424			21735000	411	251	396	624	841	841		1	9606
FAAGHDAEGSHSHVHFDEK	Unmodified	2076.9038	0.90381479	550	Q9GZN8	C20orf27	UPF0687 protein C20orf27	yes	yes	0	0	0	5	0					1	14.123	14.123	4	0.0075774	5032	DP1141_10	76.158	62.908			12204000	412	550	397	625	842	842		1	9606
FAAQNLHQNLIR	Unmodified	1423.7684	0.76843093	552	Q9H0C8	ILKAP	Integrin-linked kinase-associated serine/threonine phosphatase 2C	yes	yes	0	0	0	4	0				1		17.007	17.007	3	0.0038467	9068	DP1141_9	101.97	69.985			79776000	413	552	398	626	843	843		0	9606
FADGEVVR	Unmodified	891.44503	0.4450311	392	Q14739	LBR	Lamin-B receptor	yes	yes	0	0	0	1	0	1					15.663	15.663	2	0.00052993	6473	DP1141_6	149.4	69.17			12395000	414	392	399	627	844	844		0	9606
FADLSEAANR	Unmodified	1092.52	0.51998696	127	P08670	VIM	Vimentin	yes	yes	0	0	0	3	0			1			16.684	16.684	2	0.035339	8720	DP1141_8	117.81	41.333			34442000	415	127	400	628	845	845		0	9606
FAGYVTSIAATELEDDDDDYSSSTSLLGQK	Unmodified	3197.4412	0.44119368	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	2	0		1				22.35	22.35	3	0.0009067	17474	DP1141_7	47.12	20.085			6813100	416	78	401	629	846	846		1	9606
FALPQYLK	Unmodified	978.55385	0.55385327	12	CON__P02663			yes	yes	0	0	0	2	0		1				19.9	19.9	2	0.034831	13853	DP1141_7	85.359	42.963		+	19347000	417	12	402	630	847	847		1	
FANPFPAAVR	Unmodified	1088.5767	0.57671398	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3.25	1.48	1		1	1	1	19.237	19.237	2	0.0023975	12312	DP1141_6	104.75	74.671			431210000	418	111	403	631;632;633;634	848;849;850;851;852;853	850		6	9606
FASFIDK	Unmodified	826.4225	0.42250475	20;10;101;18;22;27	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;O95678;CON__O95678;CON__Q8VED5;P05787;CON__P05787;CON__Q7Z794;CON__Q9DCV7;CON__Q6NXH9;CON__Q9R0H5;CON__Q6ISB0;CON__P19013;CON__Q9H552;CON__P07744;CON__Q9NSB2;CON__Q3KNV1;CON__P08729;Q7Z794;P19013;P08729;Q9NSB2;CON__P13647;P13647;CON__Q6IFZ6;P04259;CON__P35908v2;CON__P35908;P35908;CON__Q5XKE5;Q5XKE5;CON__P12035;CON__Q01546;P12035;Q01546;CON__Q14CN4-1;CON__Q6IME9;Q14CN4;CON__Q3SY84;CON__Q7RTS7;CON__Q32MB2;Q3SY84;Q7RTS7;Q86Y46	KRT6A;KRT6C;KRT75;KRT8;KRT77;KRT4;KRT7;KRT84;KRT5;KRT6B;KRT2;KRT79;KRT3;KRT76;KRT72;KRT71;KRT74;KRT73	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 75;Keratin, type II cytoskeletal 8;Keratin, type II cytoskeletal 1b;Keratin, type II cytoskeletal 4;Keratin, type II cytoskeletal 7;Keratin, type II cuticular Hb4;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 2 epidermal;Keratin, type II cytoskeletal 79;Keratin, type II cytoskeletal 3;Keratin, type II cytoskeletal 2 oral;Keratin, type II cytoskeletal 72;Keratin, type II cytoskeletal 71;Keratin, type II cytoskeletal 74;Keratin, type II cytoskeletal 73	no	no	0	0	0	2.5	1.5	1			1		17.987	17.987	2	0.00044192	10157	DP1141_6	138.37	66.652		+	89847000	419	10;18;27;101;20;22	404	635;636	854;855;856	854		3	9606
FEEEFIK	Unmodified	940.4542	0.45419881	622	Q9Y5X1	SNX9	Sorting nexin-9	yes	yes	0	0	0	3	0			1			18.182	18.182	2	5.205E-20	11084	DP1141_8	162.07	96.804			0	420	622	405	637	857	857		1	9606
FEEEGNPYYSSAR	Unmodified	1547.6529	0.65285163	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3	0			1			17.123	17.123	2	5.695099999999999E-40	9405	DP1141_8	184.24	116.02			86589000	421	567	406	638	858	858		1	9606
FEIVYNLLSLR	Unmodified	1365.7656	0.76563696	77	O75489	NDUFS3	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial	yes	yes	0	0	0	5	0					1	23.423	23.423	2	0.016849	19586	DP1141_10	91.469	50.475			2541100	422	77	407	639	859	859		0	9606
FELQHGTEEQQEEVR	Unmodified	1857.8493	0.8493196	86	O94906	PRPF6	Pre-mRNA-processing factor 6	yes	yes	0	0	0	2	0		1				16.034	16.034	3	0.00042899	7683	DP1141_7	145.49	114.85			7908600	423	86	408	640	860	860		1	9606
FELTGIPPAPR	Unmodified	1196.6554	0.65535823	140	P11142	HSPA8	Heat shock cognate 71 kDa protein	yes	yes	0	0	0	3	0			1			19.225	19.225	2	0.020727	12681	DP1141_8	82.279	6.5406			530720000	424	140	409	641	861	861		1	9606
FEPPQSDSDGQR	Unmodified	1361.5848	0.58477206	49	O15042	U2SURP	U2 snRNP-associated SURP motif-containing protein	yes	yes	0	0	0	2.5	0.5		1	1			14.941	14.941	2	0.0019358	5918	DP1141_8	125.48	99.096			59540000	425	49	410	642;643	862;863;864	864		3	9606
FEPYANPTKR	Unmodified	1221.6142	0.6142217	263	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	yes	yes	0	0	1	4	0.816			1	1	1	15.193	15.193	3	0.0080297	6163	DP1141_8	91.658	60.972			46451000	426	263	411	644;645;646	865;866;867	866		1	9606
FESPEVAER	Unmodified	1062.4982	0.49818889	263	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	yes	yes	0	0	0	4	0.816			1	1	1	15.923	15.923	2	0.0043648	7363	DP1141_8	104.44	51.651			80449000	427	263	412	647;648;649	868;869;870;871	869		4	9606
FFVAPFPEVFGK	Unmodified	1383.7227	0.72270951	11	CON__P02662			yes	yes	0	0	0	3.5	1.12		1	1	1	1	23.096	23.096	2	0.0017265	18476	DP1141_8	125.97	94.098		+	211030000	428	11	413	650;651;652;653	872;873;874;875;876;877;878	875		7	
FGALTAEK	Unmodified	835.44397	0.44396847	90	O95372	LYPLA2	Acyl-protein thioesterase 2	yes	yes	0	0	0	5	0					1	15.921	15.921	2	0.014746	7851	DP1141_10	107.9	50.718			0	429	90	414	654	879	879		1	9606
FGAYIVDGLR	Unmodified	1109.5869	0.58694431	367;40	Q13085;O00763	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	no	no	0	0	0	1	0	1					20.04	20.04	2	0.013538	13570	DP1141_6	90.601	35.051			1071399999.9999999	430	367;40	415	655	880;881	881		2	9606
FGFAIGSQTTK	Unmodified	1155.5924	0.59242362	486	Q8WW12	PCNP	PEST proteolytic signal-containing nuclear protein	yes	yes	0	0	0	5	0					1	18.727	18.727	2	8.9351E-09	12552	DP1141_10	157.34	105.49			24999000	431	486	416	656	882	882		1	9606
FGIQAQMVTTDFQKIFPMGDR	2 Oxidation (M)	2461.177	0.17700145	249	P49720	PSMB3	Proteasome subunit beta type-3	yes	yes	0	2	1	2	0		1				15.459	15.459	3	0.032001	6941	DP1141_7	43.955	15.344			22797000	432	249	417	657	883	883	201;202	1	9606
FGQGGAGPVGGQGPR	Unmodified	1340.6585	0.65854613	181	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	yes	yes	0	0	0	2	0		1				15.451	15.451	2	2.8054E-225	6738	DP1141_7	237.51	176.68			0	433	181	418	658	884	884		1	9606
FGQGVHHAAGQAGNEAGR	Unmodified	1762.8248	0.82477661	435	Q6UWP8	SBSN	Suprabasin	yes	no	0	0	0	2.88	1.54	2	2	1	1	2	13.368	13.368	3;4	5.0544E-05	4068	DP1141_10	109.48	98.37			12443000	434	435	419	659;660;661;662;663;664;665;666	885;886;887;888;889;890;891;892;893;894;895;896	886		12	9606
FGVSSESKPEEVKK	Unmodified	1549.7988	0.79878758	252	P49790	NUP153	Nuclear pore complex protein Nup153	yes	yes	0	0	2	3	0.816		1	1	1		14.008	14.008	3	4.019E-30	4539	DP1141_7	179.59	141.14			248800000	435	252	420	667;668;669	897;898;899;900;901	898		5	9606
FHSPPDKDEAEAPSQK	Unmodified	1781.822	0.82204222	170	P18887	XRCC1	DNA repair protein XRCC1	yes	yes	0	0	1	3	0			1			13.805	13.805	3	0.010982	3647	DP1141_8	113.52	98.726			4196600	436	170	421	670	902	902		1	9606
FIDTSQFILNR	Unmodified	1352.7089	0.70885036	62	O60220	TIMM8A	Mitochondrial import inner membrane translocase subunit Tim8 A	yes	yes	0	0	0	5	0					1	20.526	20.526	2	0.0055635	15415	DP1141_10	112.41	71.331			16281000	437	62	422	671	903	903		1	9606
FIGPSPEVVR	Unmodified	1099.6026	0.60259438	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	3	1.41	1	1	1	1	1	17.71	17.71	2	0.0023473	10892	DP1141_10	105.1	74.304			420560000	438	142	423	672;673;674;675;676	904;905;906;907;908;909;910;911;912	904		9	9606
FIGPSPEVVRK	Unmodified	1227.6976	0.69755739	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	1	1.5	0.5	1	1				16.162	16.162	3	6.8679E-22	7908	DP1141_7	173.24	113.07			106920000	439	142	424	677;678	913;914;915	915		3	9606
FIIGSVSEDNSEDEISNLVK	Unmodified	2194.0641	0.064122984	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					21.51	21.51	2	6.0739E-111	15855	DP1141_6	257.76	208.48			107190000	440	367	425	679	916;917	916		2	9606
FKEQEQDDSTVACR	Unmodified	1711.7472	0.74716272	447	Q7LBC6	KDM3B	Lysine-specific demethylase 3B	yes	yes	0	0	1	2	0		1				14.171	14.171	3	4.6017E-49	4823	DP1141_7	199.13	166.69			11042000	441	447	426	680	918	918		0	9606
FLAVGLVDNTVR	Unmodified	1302.7296	0.7295858	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	0	1.5	0.5	1	1				20.22	20.22	2	0.0050804	13822	DP1141_6	135.43	87.826			528470000	442	402	427	681;682	919;920	919		2	9606
FLEQQNQVLETK	Unmodified	1475.762	0.76200815	22	CON__Q14CN4-1;CON__Q6IME9;Q14CN4;CON__Q3SY84;CON__Q7RTS7;CON__Q32MB2;Q3SY84;Q7RTS7;Q86Y46	KRT72;KRT71;KRT74;KRT73	Keratin, type II cytoskeletal 72;Keratin, type II cytoskeletal 71;Keratin, type II cytoskeletal 74;Keratin, type II cytoskeletal 73	yes	no	0	0	0	2	0		1				17.557	17.557	2	0.0063967	10293	DP1141_7	102.07	11.466		+	12300000	443	22	428	683	921	921		1	9606
FLFENQTPAHVYYR	Unmodified	1783.8682	0.86820455	49	O15042	U2SURP	U2 snRNP-associated SURP motif-containing protein	yes	yes	0	0	0	2	0		1				19.135	19.135	2	0.0089885	12705	DP1141_7	113.22	62.132			0	444	49	429	684	922	922		1	9606
FLHKHDLDLICR	Unmodified	1565.8137	0.81366656	286;212	P62136;P36873	PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	no	no	0	0	1	3.75	0.829			2	1	1	17.144	17.144	2;3	1.5256E-39	9317	DP1141_8	187.42	157.64			1960999999.9999998	445	286;212	430	685;686;687;688	923;924;925;926;927;928	924		6	9606
FLILPDMLK	Unmodified	1088.6304	0.63038903	299	P62318	SNRPD3	Small nuclear ribonucleoprotein Sm D3	yes	yes	0	0	0	5	0					1	22.481	22.481	2	0.019894	18158	DP1141_10	84.568	49.13			8596200	446	299	431	689	929	929		1	9606
FLNLNLR	Unmodified	888.51814	0.51813647	71	O75342	ALOX12B	Arachidonate 12-lipoxygenase, 12R-type	yes	yes	0	0	0	4	0				1		18.171	18.171	2	0.014168	11014	DP1141_9	109.88	32.132			0	447	71	432	690	930	930		1	9606
FLNVLSPR	Unmodified	944.54435	0.54435122	164	P17936	IGFBP3	Insulin-like growth factor-binding protein 3	yes	yes	0	0	0	3.67	1.25		1		1	1	19.005	19.005	2	0.016579	12354	DP1141_9	94.662	37.941			209780000	448	164	433	691;692;693	931;932;933	933		3	9606
FLSDVYPDGFK	Unmodified	1286.6183	0.61830402	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	0	0	2	0.816	1	1	1			20.033	20.033	2	3.0232E-52	13874	DP1141_8	191.45	136.08			225170000	449	110	434	694;695;696	934;935;936;937	937		4	9606
FLSSAAAVSK	Unmodified	979.53385	0.53384611	191	P27708	CAD	CAD protein;Glutamine-dependent carbamoyl-phosphate synthase;Aspartate carbamoyltransferase;Dihydroorotase	yes	yes	0	0	0	1	0	1					15.795	15.795	2	0.022524	6707	DP1141_6	81.95	35.998			1279400	450	191	435	697	938	938		1	9606
FLYECPWR	Unmodified	1169.5328	0.53280025	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2	0.816	1	1	1			20.12	20.12	2	2.3108000000000002E-29	13644	DP1141_6	178.84	131.77			678490000	451	142	436	698;699;700	939;940;941;942	939		4	9606
FLYIWPNAR	Unmodified	1178.6237	0.62366417	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	4	0.816			1	1	1	21.409	21.409	2	0.010374	16257	DP1141_9	97.068	47.709			2436200000	452	567	437	701;702;703	943;944;945;946	946		4	9606
FNADEFEDMVAEKR	Oxidation (M)	1715.7461	0.74610008	190	P27635	RPL10	60S ribosomal protein L10	yes	yes	0	1	1	5	0					1	18.291	18.291	3	0.0043724	11925	DP1141_10	61.409	24.465			8688400	453	190	438	704	947	947	165	0	9606
FNEQIEPIYALLR	Unmodified	1604.8562	0.85624288	194	P29083	GTF2E1	General transcription factor IIE subunit 1	yes	yes	0	0	0	3	0			1			22.738	22.738	2	0.011614	17944	DP1141_8	85.958	25.468			4906400	454	194	439	705	948;949	949		2	9606
FPGQLNADLR	Unmodified	1129.588	0.58800695	122;323;381;376	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	no	no	0	0	0	3.5	1.12		1	1	1	1	18.273	18.273	2	0.0019585	11331	DP1141_7	134.26	84.837			700540000	455	122;323;381;376	440	706;707;708;709	950;951;952;953;954;955	951		6	9606
FPGQLNADLRK	Unmodified	1257.683	0.68296996	122;323;381;376	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	no	no	0	0	1	3.5	0.5			2	2		16.823	16.823	2;3	0.0038215	8821	DP1141_8	100.82	40.98			267320000	456	122;323;381;376	441	710;711;712;713	956;957;958;959	956		3	9606
FPNRPQMVK	Unmodified	1115.591	0.59098383	466	Q8IZF0	NALCN	Sodium leak channel non-selective protein	yes	yes	0	0	1	5	0					1	21.126	21.126	2	0.022381	16162	DP1141_10	97.602	1.7868			14471000	457	466	442	714	960	960		0	9606
FPSLLTHNENMVAK	Oxidation (M)	1615.8028	0.8028271	311	P62906	RPL10A	60S ribosomal protein L10a	yes	yes	0	1	0	5	0					1	17.637	17.637	3	0.0032695	10732	DP1141_10	92.792	54.554			53392000	458	311	443	715	961	961	242	0	9606
FPVAPLIPYPLITK	Unmodified	1567.9378	0.93778767	251	P49756	RBM25	RNA-binding protein 25	yes	yes	0	0	0	2	0		1				23.027	23.027	2	0.0074057	18650	DP1141_7	90.653	51.939			13367000	459	251	444	716	962	962		1	9606
FQDELESGK	Unmodified	1051.4822	0.48220447	49	O15042	U2SURP	U2 snRNP-associated SURP motif-containing protein	yes	yes	0	0	0	2	0		1				15.954	15.954	2	0.010269	7516	DP1141_7	90.37	29.398			8270000	460	49	445	717	963	963		1	9606
FQRPGDPQSAQDK	Unmodified	1472.7008	0.70080487	407	Q15637	SF1	Splicing factor 1	yes	yes	0	0	1	3	0			1			14.013	14.013	3	0.014533	4450	DP1141_8	125.84	99.086			45681000	461	407	446	718	964;965	965		2	9606
FRNMVQTAVVPVKK	Oxidation (M)	1631.9181	0.91813163	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	1	2	3.5	0.5			1	1		14.931	14.931	3	0.0085999	5932	DP1141_8	88.224	71.651			33976000	462	365	447	719;720	966;967	966	264	0	9606
FSAVLVEPPPMSLPGAGLSSQELSGGPGDGP	Oxidation (M)	2965.4379	0.4379034	372	Q13263	TRIM28	Transcription intermediary factor 1-beta	yes	yes	0	1	0	2	0		1				22.703	22.703	3	3.0785E-07	18060	DP1141_7	56.332	39.235			11576000	463	372	448	721	968	968	290	1	9606
FSAVLVEPPPMSLPGAGLSSQELSGGPGDGP	Unmodified	2949.443	0.44298878	372	Q13263	TRIM28	Transcription intermediary factor 1-beta	yes	yes	0	0	0	2	0		1				23.914	23.914	3	0.0020491	19873	DP1141_7	43.732	30.03			4048700	464	372	448	722	969	969		1	9606
FSEILETSSTK	Unmodified	1240.6187	0.61869795	438	Q6W2J9	BCOR	BCL-6 corepressor	yes	yes	0	0	0	2	0		1				17.322	17.322	2	0.032334	9803	DP1141_7	94.692	45.896			0	465	438	449	723	970	970		1	9606
FTQDTQPHYIYSPR	Unmodified	1751.8267	0.82673367	384	Q14204	DYNC1H1	Cytoplasmic dynein 1 heavy chain 1	yes	yes	0	0	0	1	0	1					16.914	16.914	3	0.012679	8398	DP1141_6	73.415	46.085			7730900	466	384	450	724	971	971		1	9606
FVADGIFK	Unmodified	895.48035	0.48035398	182	P23396	RPS3	40S ribosomal protein S3	yes	yes	0	0	0	5	0					1	19.227	19.227	2	0.0070811	13240	DP1141_10	106.42	65.495			10609000	467	182	451	725	972	972		0	9606
FVIATSTK	Unmodified	865.49092	0.49091866	343	Q02878	RPL6	60S ribosomal protein L6	yes	yes	0	0	0	4	0				1		16.208	16.208	2	0.015399	7840	DP1141_9	93.195	47.244			22823000	468	343	452	726	973	973		1	9606
FVINYDYPNSSEDYIHR	Unmodified	2130.9647	0.96468371	163	P17844	DDX5	Probable ATP-dependent RNA helicase DDX5	yes	yes	0	0	0	3	0			1			19.426	19.426	3	9.8831E-16	12980	DP1141_8	196.18	176.76			50305000	469	163	453	727	974;975	974		2	9606
FVINYDYPNSSEDYVHR	Unmodified	2116.949	0.94903365	496	Q92841	DDX17	Probable ATP-dependent RNA helicase DDX17	yes	yes	0	0	0	3	0			1			19.125	19.125	3	0.0019928	12579	DP1141_8	117	98.983			19859000	470	496	454	728	976;977	976		2	9606
FVKEPAFEDITLESER	Unmodified	1908.9469	0.94690838	74	O75400	PRPF40A	Pre-mRNA-processing factor 40 homolog A	yes	yes	0	0	1	2	0		1				19.3	19.3	3	6.6333E-42	12984	DP1141_7	185.86	151.36			87675000	471	74	455	729	978	978		0	9606
FVMEVEVDGQK	Oxidation (M)	1295.6068	0.60675306	362	Q96SI9;Q12906	STRBP;ILF3	Spermatid perinuclear RNA-binding protein;Interleukin enhancer-binding factor 3	yes	no	0	1	0	3	0			1			16.542	16.542	2	0.029218	8423	DP1141_8	85.862	47.112			0	472	362	456	730	979	979	262	1	9606
FVPDKEFSGSDRR	Unmodified	1538.7478	0.74775506	377	Q13573	SNW1	SNW domain-containing protein 1	yes	yes	0	0	2	4	0				1		15.124	15.124	3	0.032942	5905	DP1141_9	69.721	44.543			8830600	473	377	457	731	980	980		1	9606
FVTLSATNAK	Unmodified	1050.571	0.5709599	522	Q96S55	WRNIP1	ATPase WRNIP1	yes	yes	0	0	0	3	0			1			16.598	16.598	2	4.2368E-85	8517	DP1141_8	199.29	161.15			0	474	522	458	732	981	981		1	9606
FVTPSEPVAHSR	Unmodified	1325.6728	0.67279921	44	O14654	IRS4	Insulin receptor substrate 4	yes	yes	0	0	0	1	0	1					15.358	15.358	3	0.0027147	5975	DP1141_6	117.09	87.324			23093000	475	44	459	733	982;983;984	984		3	9606
FVVMVTPEDLK	Oxidation (M)	1292.6686	0.66862503	367;40	Q13085;O00763	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	no	no	0	1	0	2.33	1.25	1	1		1		19.312	19.312	2	0.0027105	12447	DP1141_6	146.69	81.228			420890000	476	367;40	460	734;735;736	985;986;987;988;989	987	34	5	9606
FVVMVTPEDLK	Unmodified	1276.6737	0.67371041	367;40	Q13085;O00763	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	no	no	0	0	0	1	0	1					20.341	20.341	2	1.144E-95	13944	DP1141_6	211.45	157.67			279420000	477	367;40	460	737	990;991	990		2	9606
FWEVISDEHGIDPTGTYHGDSDLQLDR	Unmodified	3101.4003	0.40027234	122	P07437	TUBB	Tubulin beta chain	yes	yes	0	0	0	3	0			1			20.427	20.427	4	0.0059744	14448	DP1141_8	41.087	17.175			41547000	478	122	461	738	992	992		1	9606
GADEDDEKEWGDDEEEQPSKR	Unmodified	2462.9946	0.99459945	398	Q15020	SART3	Squamous cell carcinoma antigen recognized by T-cells 3	yes	yes	0	0	2	2	0		1				15.289	15.289	3	1.8721E-44	6480	DP1141_7	166.47	154.55			0	479	398	462	739	993	993		1	9606
GAEIIVCTPGR	Unmodified	1171.6019	0.60194245	445	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	yes	yes	0	0	0	1	0	1					17.153	17.153	2	2.7242999999999998E-21	8853	DP1141_6	169.44	107.76			4500500	480	445	463	740	994	994		1	9606
GAFSPFGNIIDLSMDPPR	Oxidation (M)	1948.9353	0.93529784	168	P18615	NELFE	Negative elongation factor E	yes	yes	0	1	0	4	0				1		22.853	22.853	2	4.0873E-23	18189	DP1141_9	172.58	138.07			8124300	481	168	464	741	995;996;997	995	153	3	9606
GANAVGYTNYPDNVVFK	Unmodified	1827.8792	0.87916317	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2	0		1				19.425	19.425	2	3.0804E-28	13148	DP1141_7	158.01	112.1			0	482	142	465	742	998	998		1	9606
GASQAGMTGYGMPR	Oxidation (M)	1398.602	0.6020188	213	P37802;Q9UI15	TAGLN2;TAGLN3	Transgelin-2;Transgelin-3	yes	no	0	1	0	5	0					1	15.724	15.724	2	0.019373	7573	DP1141_10	99.283	74.157			23969000	483	213	466	743	999	999	178	1	9606
GATYGKPVHHGVNQLK	Unmodified	1704.906	0.90598704	282	P61313	RPL15	60S ribosomal protein L15	yes	yes	0	0	1	5	0					1	12.746	12.746	3	0.0081338	3247	DP1141_10	124.07	104.89			3452300	484	282	467	744	1000	1000		1	9606
GAVEIIFK	Unmodified	875.51165	0.5116541	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	4	1			1		1	19.126	19.126	2	5.7085E-06	13174	DP1141_10	133.81	9.2184			193870000	485	111	468	745;746	1001;1002	1001		2	9606
GAWSNVLR	Unmodified	901.477	0.47699993	109	P05141;P12236;P12235	SLC25A5;SLC25A6;SLC25A4	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed;ADP/ATP translocase 3;ADP/ATP translocase 3, N-terminally processed;ADP/ATP translocase 1	yes	no	0	0	0	5	0					1	18.537	18.537	2	0.018587	12052	DP1141_10	101.21	56.681			8105600	486	109	469	747	1003	1003		0	9606
GCGTVLLSGPR	Unmodified	1115.5757	0.5757277	349	Q07020	RPL18	60S ribosomal protein L18	yes	yes	0	0	0	5	0					1	17.029	17.029	2	3.5814E-30	9831	DP1141_10	176.6	115.84			15024000	487	349	470	748	1004	1004		1	9606
GCTATLGNFAK	Unmodified	1138.5441	0.54409322	155	P15880	RPS2	40S ribosomal protein S2	yes	yes	0	0	0	4	0				1		17.007	17.007	2	0.0076954	9190	DP1141_9	96.034	51.639			125250000	488	155	471	749	1005	1005		1	9606
GDGPICLVLAPTR	Unmodified	1367.7231	0.72312022	163;496	Q92841;P17844	DDX17;DDX5	Probable ATP-dependent RNA helicase DDX17;Probable ATP-dependent RNA helicase DDX5	no	no	0	0	0	3.5	0.5			1	1		20.307	20.307	2	0.0061691	14288	DP1141_9	90.653	53.96			37651000	489	496;163	472	750;751	1006;1007;1008	1008		3	9606
GDGVVLVAPPLR	Unmodified	1191.6976	0.69755739	297	P62310	LSM3	U6 snRNA-associated Sm-like protein LSm3	yes	yes	0	0	0	5	0					1	19.227	19.227	2	0.0063936	13301	DP1141_10	91.265	46.888			16932000	490	297	473	752	1009	1009		1	9606
GDNITLLQSVSN	Unmodified	1259.6357	0.635745	296	P62304	SNRPE	Small nuclear ribonucleoprotein E	yes	yes	0	0	0	5	0					1	20.491	20.491	2	0.020797	15184	DP1141_10	105.17	50.443			0	491	296	474	753	1010	1010		1	9606
GDNQAGGAAAAAAAPEPPPR	Unmodified	1787.8551	0.85507368	44	O14654	IRS4	Insulin receptor substrate 4	yes	yes	0	0	0	2	1	1		1			15.643	15.643	2	0.00079291	6993	DP1141_8	113.72	81.2			0	492	44	475	754;755	1011;1012	1012		2	9606
GDSVIVVLR	Unmodified	956.56548	0.56548059	298	P62316	SNRPD2	Small nuclear ribonucleoprotein Sm D2	yes	yes	0	0	0	5	0					1	18.603	18.603	2	3.1037E-05	12214	DP1141_10	147.69	108.03			16821000	493	298	476	756	1013;1014	1013		2	9606
GDVAEGDLIEHFSQFGTVEK	Unmodified	2177.0277	0.027677899	369	Q13151	HNRNPA0	Heterogeneous nuclear ribonucleoprotein A0	yes	yes	0	0	0	4	0				1		20.915	20.915	3	1.2455E-10	15240	DP1141_9	137.45	112.78			0	494	369	477	757	1015	1015		1	9606
GEAAAERPGEAAVASSPSK	Unmodified	1783.8701	0.87005504	195	P29966	MARCKS	Myristoylated alanine-rich C-kinase substrate	yes	yes	0	0	1	3	0			2			14.131	14.131	3	0.0072415	4682	DP1141_8	96.153	74.312			4999200	495	195	478	758;759	1016;1017;1018	1017		3	9606
GEATVSFDDPPSAK	Unmodified	1419.6518	0.65178899	209	P35637;Q92804	FUS;TAF15	RNA-binding protein FUS;TATA-binding protein-associated factor 2N	yes	no	0	0	0	3	0			1			16.923	16.923	2	3.189E-30	9112	DP1141_8	180.66	154.62			121060000	496	209	479	760	1019	1019		1	9606
GEEGHDPKEPEQLR	Unmodified	1619.754	0.75396265	262	P51991	HNRNPA3	Heterogeneous nuclear ribonucleoprotein A3	yes	yes	0	0	1	4	0				1		13.706	13.706	4	0.025867	3908	DP1141_9	109.6	90.931			2599600	497	262	480	761	1020	1020		1	9606
GEENLMDAQVK	Oxidation (M)	1248.5656	0.56561652	257	P50990	CCT8	T-complex protein 1 subunit theta	yes	yes	0	1	0	3	0			1			15.022	15.022	2	0.026702	6043	DP1141_8	110.53	50.136			14519000	498	257	481	762	1021	1021	205	1	9606
GENLVSMTVEGPPPK	Unmodified	1553.7759	0.77594365	152	P63162;P14678	SNRPN;SNRPB	Small nuclear ribonucleoprotein-associated protein N;Small nuclear ribonucleoprotein-associated proteins B and B'	yes	no	0	0	0	5	0					1	18.637	18.637	2	0.0065232	12239	DP1141_10	114.24	84.181			7759200	499	152	482	763	1022	1022		1	9606
GENLVSMTVEGPPPKDTGIAR	Oxidation (M)	2183.0892	0.089232298	152	P63162;P14678	SNRPN;SNRPB	Small nuclear ribonucleoprotein-associated protein N;Small nuclear ribonucleoprotein-associated proteins B and B'	yes	no	0	1	1	5	0					1	17.237	17.237	3	0.028144	10253	DP1141_10	58.339	36.74			32128000	500	152	483	764	1023	1023	149	1	9606
GENLVSMTVEGPPPKDTGIAR	Unmodified	2167.0943	0.094317676	152	P63162;P14678	SNRPN;SNRPB	Small nuclear ribonucleoprotein-associated protein N;Small nuclear ribonucleoprotein-associated proteins B and B'	yes	no	0	0	1	5	0					1	18.337	18.337	3	0.00047988	11853	DP1141_10	132.87	102.38			16755000	501	152	483	765	1024	1024		1	9606
GFGFVTYATVEEVDAAMNAR	Oxidation (M)	2162.9943	0.99426928	130	P09651;A0A2R8Y4L2	HNRNPA1	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed	yes	no	0	1	0	4	0				1		22.251	22.251	2	5.1104E-05	17354	DP1141_9	115.24	91.423			8479000	502	130	484	766	1025;1026	1025	124	2	9606
GFGFVTYATVEEVDAAMNARPHK	Oxidation (M)	2525.2009	0.20090801	130	P09651;A0A2R8Y4L2	HNRNPA1	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed	yes	no	0	1	1	4.33	0.471				2	1	20.386	20.386	3;4	0.00091742	15123	DP1141_10	64.5	42.064			195620000	503	130	485	767;768;769	1027;1028;1029	1027	124	3	9606
GFMVQTGDPTGTGR	Oxidation (M)	1438.6511	0.65107749	558	Q9H2H8	PPIL3	Peptidyl-prolyl cis-trans isomerase-like 3	yes	yes	0	1	0	5	0					1	16.646	16.646	2	0.011544	8991	DP1141_10	123.01	90.148			19810000	504	558	486	770	1030	1030	399	1	9606
GFSSGSAVVSGGSR	Unmodified	1253.6	0.60002819	20	CON__P35908v2;CON__P35908;P35908	KRT2	Keratin, type II cytoskeletal 2 epidermal	no	no	0	0	0	2.67	1.7	1	1			1	15.614	15.614	2	9.547299999999999E-206	6320	DP1141_6	247.22	214.23		+	56874000	505	20	487	771;772;773	1031;1032;1033;1034;1035	1032		5	9606
GFVDDIIQPSSTR	Unmodified	1433.7151	0.71505795	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3.25	1.48	1		1	1	1	19.815	19.815	2	0	13594	DP1141_8	279.77	223.34			353200000	506	111	488	774;775;776;777	1036;1037;1038;1039;1040;1041	1039		5	9606
GFVVINQK	Unmodified	903.5178	0.51780212	220	Q92526;P40227	CCT6B;CCT6A	T-complex protein 1 subunit zeta-2;T-complex protein 1 subunit zeta	yes	no	0	0	0	3	0			1			17.223	17.223	2	0.00052368	9045	DP1141_8	133.99	79.463			167400000	507	220	489	778	1042	1042		0	9606
GGAEQFMEETER	Oxidation (M)	1398.5722	0.57215846	533	Q99832	CCT7	T-complex protein 1 subunit eta	yes	yes	0	1	0	3	0			1			15.726	15.726	2	1.1514E-13	7158	DP1141_8	163.38	145.87			15996000	508	533	490	779	1043	1043	384	1	9606
GGAYYPVTVK	Unmodified	1053.5495	0.54949617	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3	1.41	1	1	1	1	1	16.912	16.912	2	0.0077711	9057	DP1141_8	100.02	76.946			1240800000	509	567	491	780;781;782;783;784	1044;1045;1046;1047;1048;1049	1047		6	9606
GGDSIGETPTPGASK	Unmodified	1372.647	0.64703797	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	3.25	1.48	1		1	1	1	15.029	15.029	2	1.9247E-42	5888	DP1141_9	189.57	138.51			192250000	510	78	492	785;786;787;788	1050;1051;1052;1053;1054;1055;1056	1056		7	9606
GGDSIGETPTPGASKR	Unmodified	1528.7481	0.74814899	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	2.83	1.34	1	2	1	1	1	14.17	14.17	2;3	9.9712E-17	4804	DP1141_7	151.13	83.92			161890000	511	78	493	789;790;791;792;793;794	1057;1058;1059;1060;1061;1062;1063;1064;1065;1066	1063		10	9606
GGGGGGGGTGSRGGGGGGGGSSYVSSSRSATK	Unmodified	2572.161	0.16104512	27	CON__Q6IFZ6			yes	yes	0	0	2	2	0		1				22.278	22.278	3	0.016859	17396	DP1141_7	38.691	23.21		+	0	512	27	494	795	1067	1067		1	
GGGGNFGPGPGSNFR	Unmodified	1376.6222	0.62216062	179	P22626	HNRNPA2B1	Heterogeneous nuclear ribonucleoproteins A2/B1	yes	yes	0	0	0	4	0				1		17.026	17.026	2	1.3635999999999998E-21	9203	DP1141_9	173.04	145.73			88840000	513	179	495	796	1068;1069;1070	1069		3	9606
GGKPEPPAMPQPVPTA	Oxidation (M)	1588.7919	0.79192806	182	P23396	RPS3	40S ribosomal protein S3	yes	yes	0	1	1	5	0					1	15.736	15.736	2	0.0066181	7617	DP1141_10	100.02	77.824			49443000	514	182	496	797	1071	1071	160	1	9606
GGPTPQEAIQR	Unmodified	1152.5887	0.58873523	561	Q9H444	CHMP4B	Charged multivesicular body protein 4b	yes	yes	0	0	0	4	0				1		15.246	15.246	2	0.0076954	6067	DP1141_9	96.034	68.896			10945000	515	561	497	798	1072	1072		1	9606
GGQDNIPVLK	Unmodified	1039.5662	0.56620887	147	P13637	ATP1A3	Sodium/potassium-transporting ATPase subunit alpha-3	yes	yes	0	0	0	5	0					1	17.037	17.037	2	0.025381	9836	DP1141_10	78.113	29.016			12605000	516	147	498	799	1073	1073		1	9606
GGSGSGPTIEEVD	Unmodified	1203.5255	0.52552585	135	P0DMV8;P0DMV9	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	yes	no	0	0	0	3	0			1			17.323	17.323	2	0.0052585	9831	DP1141_8	107.69	91.022			94978000	517	135	499	800	1074	1074		1	9606
GGSWVVIDSSINPR	Unmodified	1485.7576	0.75759147	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	2.5	1.5	1			1		19.964	19.964	2	7.4063E-67	13844	DP1141_9	199.33	149.14			254070000	518	367	500	801;802	1075;1076;1077	1076		3	9606
GHAVGDIPGVR	Unmodified	1076.5727	0.57269123	292	P62266	RPS23	40S ribosomal protein S23	yes	yes	0	0	0	5	0					1	15.551	15.551	2	0.016367	7266	DP1141_10	85.676	57.663			21149000	519	292	501	803	1078	1078		1	9606
GHENVEAAQAEYIEK	Unmodified	1686.7849	0.78492843	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	5	0					1	15.92	15.92	3	0.010683	7934	DP1141_10	75.018	34.342			247350000	520	111	502	804	1079	1079		0	9606
GHYTEGAELVDSVLDVVR	Unmodified	1957.9745	0.97452012	122;323;381;376	P07437;P68371;Q13885;Q9BVA1;Q13509	TUBB;TUBB4B;TUBB2A;TUBB2B;TUBB3	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain	no	no	0	0	0	4	0				1		22.314	22.314	3	0.0045189	17456	DP1141_9	62.203	62.203			17903000	521	122;323;381;376	503	805	1080	1080		1	9606
GHYTEGAELVDSVLDVVRK	Unmodified	2086.0695	0.069483134	122;323;381;376	P07437;P68371;Q13885;Q9BVA1;Q13509	TUBB;TUBB4B;TUBB2A;TUBB2B;TUBB3	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain	no	no	0	0	1	3	0			1			21.329	21.329	3	0.00015504	15949	DP1141_8	116.87	75.547			134820000	522	122;323;381;376	504	806	1081	1081		1	9606
GIEKPPFELPDFIKR	Unmodified	1784.9825	0.98250603	374	Q13435	SF3B2	Splicing factor 3B subunit 2	yes	yes	0	0	2	2	0		1				20.045	20.045	3	0.022424	14165	DP1141_7	87.447	69.958			10375000	523	374	505	807	1082	1082		1	9606
GILQELFLNK	Unmodified	1173.6758	0.67575932	520	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	yes	yes	0	0	0	2.5	0.5		1	1			23.099	23.099	2	0.0027723	18477	DP1141_8	138.83	84.103			115010000	524	520	506	808;809	1083;1084;1085	1084		3	9606
GIPAPEEERTR	Unmodified	1253.6364	0.6364137	92	O95433	AHSA1	Activator of 90 kDa heat shock protein ATPase homolog 1	yes	yes	0	0	1	4	0				1		14.344	14.344	3	0.01534	4872	DP1141_9	134.84	100.15			9943800	525	92	507	810	1086;1087	1087		2	9606
GIPHLVTHDAR	Unmodified	1214.652	0.65200419	177	P22090;P62701;Q8TD47	RPS4Y1;RPS4X;RPS4Y2	40S ribosomal protein S4, Y isoform 1;40S ribosomal protein S4, X isoform;40S ribosomal protein S4, Y isoform 2	yes	no	0	0	0	5	0					1	14.924	14.924	3	0.0040671	6084	DP1141_10	97.456	58.674			53265000	526	177	508	811	1088;1089	1088		2	9606
GISDLAQHYLMR	Oxidation (M)	1418.6976	0.69763375	246	P49368	CCT3	T-complex protein 1 subunit gamma	yes	yes	0	1	0	3	0			1			19.325	19.325	2	0.0090722	12817	DP1141_8	142.43	114.22			19122000	527	246	509	812	1090	1090	198	1	9606
GISHVIVDEIHER	Unmodified	1502.7841	0.78414057	357	Q08211	DHX9	ATP-dependent RNA helicase A	yes	yes	0	0	0	1	0	1					17.396	17.396	3	0.0072289	9269	DP1141_6	110.8	85.837			4391300	528	357	510	813	1091	1091		0	9606
GIVEFASKPAAR	Unmodified	1244.6877	0.68772099	181	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	yes	yes	0	0	1	2	0		1				16.365	16.365	3	0.018641	8157	DP1141_7	130.41	97.222			28215000	529	181	511	814	1092	1092		1	9606
GIVEFSGKPAAR	Unmodified	1230.6721	0.67207093	401	Q15233	NONO	Non-POU domain-containing octamer-binding protein	yes	yes	0	0	1	3.67	0.471			1	2		15.924	15.924	2;3	1.6394E-05	7324	DP1141_9	153.1	108.46			197080000	530	401	512	815;816;817	1093;1094;1095	1095		3	9606
GLAPDLPEDLYHLIK	Unmodified	1692.9087	0.90867238	294	P62277	RPS13	40S ribosomal protein S13	yes	yes	0	0	0	5	0					1	22.009	22.009	3	0.008997	17513	DP1141_10	79.744	57.884			9644300	531	294	513	818	1096	1096		1	9606
GLAPVQAYLHIPDIIK	Unmodified	1747.0032	0.0032414695	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2.83	1.34	1	2	1	1	1	21.713	21.713	2;3	1.2122E-31	16429	DP1141_7	182.1	156.76			952780000	532	142	514	819;820;821;822;823;824	1097;1098;1099;1100;1101;1102;1103;1104;1105;1106;1107;1108	1103		12	9606
GLGTGTLYIAESR	Unmodified	1336.6987	0.69867961	269	P54105	CLNS1A	Methylosome subunit pICln	yes	yes	0	0	0	4	0				1		18.887	18.887	2	0.013122	12092	DP1141_9	84.658	40.281			11943000	533	269	515	825	1109	1109		1	9606
GLLGLPEEETELDNLTEFNTAHNKR	Unmodified	2839.3988	0.39881578	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	1	2.67	0.471		1	2			20.919	20.919	3;4	2.8536E-13	15389	DP1141_7	109.37	93.572			736050000	534	365	516	826;827;828	1110;1111;1112;1113;1114	1110		5	9606
GLPFGCSK	Unmodified	864.41637	0.41637351	200;272;199	P31943;P55795;P31942	HNRNPH1;HNRNPH2;HNRNPH3	Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H2;Heterogeneous nuclear ribonucleoprotein H3	no	no	0	0	0	3.5	0.5			1	1		17.015	17.015	2	0.0048057	9254	DP1141_9	102.77	61.565			38181000	535	200;272;199	517	829;830	1115;1116	1116		1	9606
GLVMVKPGSIKPHQK	Oxidation (M)	1633.9338	0.9337817	247	P49411	TUFM	Elongation factor Tu, mitochondrial	yes	yes	0	1	2	4	0				1		14.344	14.344	3	0.029314	4893	DP1141_9	67.952	60.112			4430100	536	247	518	831	1117	1117	200	1	9606
GLYAAFDCTATMK	Unmodified	1447.6476	0.64757201	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2	0		1				19.501	19.501	2	0.029078	13401	DP1141_7	73.841	51.28			83099000	537	142	519	832	1118	1118		1	9606
GMGGHGYGGAGDASSGFHGGHFVHMR	2 Oxidation (M)	2574.0666	0.066556571	199	P31942	HNRNPH3	Heterogeneous nuclear ribonucleoprotein H3	yes	yes	0	2	0	4	0				1		15.008	15.008	5	0.0039116	5810	DP1141_9	42.831	28.815			12896000	538	199	520	833	1119	1119	168;169	1	9606
GNFHAVYRDDLKK	Unmodified	1561.8001	0.80012499	108	P05109	S100A8	Protein S100-A8;Protein S100-A8, N-terminally processed	yes	yes	0	0	2	5	0					1	14.712	14.712	3	0.015873	5980	DP1141_10	80.318	37.521			21210000	539	108	521	834	1120	1120		1	9606
GNIPTLNR	Unmodified	883.48756	0.48756462	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					16.155	16.155	2	1.2787E-05	7221	DP1141_6	138.37	50.338			1005699999.9999999	540	367	522	835	1121	1121		1	9606
GNLANVIR	Unmodified	855.49265	0.49265	109	P05141;P12236;P12235;Q9H0C2	SLC25A5;SLC25A6;SLC25A4;SLC25A31	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed;ADP/ATP translocase 3;ADP/ATP translocase 3, N-terminally processed;ADP/ATP translocase 1;ADP/ATP translocase 4;ADP/ATP translocase 4, N-terminally processed	yes	no	0	0	0	1	0	1					16.68	16.68	2	0.0019529	8240	DP1141_6	122.79	76.127			75578000	541	109	523	836	1122	1122		0	9606
GNSRPGTPSAEGGSTSSTLR	Unmodified	1917.914	0.91404512	208	P35269	GTF2F1	General transcription factor IIF subunit 1	yes	yes	0	0	1	4	1			1		1	14.127	14.127	3	8.3045E-05	4629	DP1141_8	119.18	94.248			31530000	542	208	524	837;838	1123;1124	1124		2	9606
GNWAHSGFPEIAFGR	Unmodified	1644.7797	0.77972389	268	P52701	MSH6	DNA mismatch repair protein Msh6	yes	yes	0	0	0	2	0		1				20.2	20.2	3	0.0099699	14412	DP1141_7	76.82	52.306			6937200	543	268	525	839	1125	1125		1	9606
GPASVPSVGK	Unmodified	897.49198	0.4919813	373	Q13428	TCOF1	Treacle protein	yes	yes	0	0	0	2.5	0.5		1	1			14.841	14.841	2	0.020157	5625	DP1141_7	84.615	41.548			45744000	544	373	526	840;841	1126;1127;1128	1126		3	9606
GPFSEISAFK	Unmodified	1081.5444	0.5444108	259	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	yes	yes	0	0	0	2	0		1				20.1	20.1	2	0.0051706	14198	DP1141_7	122.52	61.544			14660000	545	259	527	842	1129	1129		1	9606
GPISDALAHHLR	Unmodified	1285.6891	0.68911797	559	Q9H2P0	ADNP	Activity-dependent neuroprotector homeobox protein	yes	yes	0	0	0	2	0		1				17.699	17.699	3	0.010117	10480	DP1141_7	87.298	58.534			19916000	546	559	528	843	1130	1130		1	9606
GPLPAGTILK	Unmodified	965.59097	0.59096706	259	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	yes	yes	0	0	0	2	0		1				17.906	17.906	2	0.034059	10641	DP1141_7	75.043	53.083			25831000	547	259	529	844	1131	1131		1	9606
GPLQSVQVFGR	Unmodified	1186.6459	0.64585618	289	P62249	RPS16	40S ribosomal protein S16	yes	yes	0	0	0	5	0					1	19.227	19.227	2	1.9559E-40	13401	DP1141_10	185.72	156.55			12500000	548	289	530	845	1132	1132		1	9606
GPLTVEETPR	Unmodified	1097.5717	0.57168818	388	Q14676	MDC1	Mediator of DNA damage checkpoint protein 1	yes	yes	0	0	0	2	0		1				16.265	16.265	2	1.5432E-11	7977	DP1141_7	176.09	140.47			69718000	549	388	531	846	1133	1133		0	9606
GPMNQCLVATGTHEPK	Oxidation (M)	1754.808	0.80798883	345	Q03405	PLAUR	Urokinase plasminogen activator surface receptor	yes	yes	0	1	0	4	0				1		14.84	14.84	3	0.00075578	5532	DP1141_9	106.14	76.925			9441900	550	345	532	847	1134;1135	1134	258	2	9606
GPPDFSSDEEREPTPVLGSGAAAAGR	Unmodified	2569.2045	0.20447307	225	P42166	TMPO	Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin	yes	yes	0	0	1	3.33	0.471			2	1		18.006	18.006	2;3	5.9828E-17	10885	DP1141_9	152.96	140.28			289640000	551	225	533	848;849;850	1136;1137;1138;1139;1140	1139		5	9606
GPPPPPGDENREMDDPSVGPK	Oxidation (M)	2202.9852	0.98516116	374	Q13435	SF3B2	Splicing factor 3B subunit 2	yes	yes	0	1	1	2.5	0.5		1	1			14.929	14.929	3	0.014526	5860	DP1141_7	62.203	45.624			0	552	374	534	851;852	1141;1142	1141	298	2	9606
GPPPPPGDENREMDDPSVGPK	Unmodified	2186.9902	0.99024653	374	Q13435	SF3B2	Splicing factor 3B subunit 2	yes	yes	0	0	1	2	0		1				15.787	15.787	3	0.010713	7272	DP1141_7	101.54	64.365			0	553	374	534	853	1143	1143		1	9606
GPSYGLSAEVK	Unmodified	1106.5608	0.56078914	403	Q99439;Q15417	CNN2;CNN3	Calponin-2;Calponin-3	yes	no	0	0	0	4	0				1		16.821	16.821	2	0.021191	8880	DP1141_9	81.525	52.355			35621000	554	403	535	854	1144	1144		1	9606
GSLGGGFSSGGFSGGSFSR	Unmodified	1706.7649	0.76486169	17	CON__P13645;P13645	KRT10	Keratin, type I cytoskeletal 10	yes	no	0	0	0	1	0	1					19.374	19.374	2	0.011059	12613	DP1141_6	77.192	61.99		+	12405000	555	17	536	855	1145	1145		1	9606
GSLGQGTAPVLPGK	Unmodified	1280.7089	0.70885036	373	Q13428	TCOF1	Treacle protein	yes	yes	0	0	0	2	0		1				16.903	16.903	2	0.014975	9196	DP1141_7	82.417	35.955			49675000	556	373	537	856	1146	1146		1	9606
GSPLVVISQGK	Unmodified	1083.6288	0.62880913	409	Q16555	DPYSL2	Dihydropyrimidinase-related protein 2	yes	yes	0	0	0	5	0					1	17.463	17.463	2	0.028551	10812	DP1141_10	75.652	48.522			27356000	557	409	538	857	1147	1147		1	9606
GSVLEPEGTVEIK	Unmodified	1356.7137	0.71366097	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	3.5	0.5			1	1		18.186	18.186	2	0.00054854	10907	DP1141_9	128.81	44.928			350610000	558	367	539	858;859	1148;1149	1149		2	9606
GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR	Unmodified	3311.3008	0.30084566	102	P04264;CON__P04264	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	0	0	4	0				1		15.722	15.722	3	9.2853E-34	7145	DP1141_9	109.71	74.223		+	150330000	559	102	540	860	1150	1150		1	9606
GSYSCEVTHEGSTVTK	Unmodified	1740.7625	0.76247843	23	CON__Q1RMN8			yes	yes	0	0	0	5	0					1	14.924	14.924	3	0.0025468	6230	DP1141_10	130.47	116.38		+	59566000	560	23	541	861	1151	1151		1	
GTAYVVYEDIFDAK	Unmodified	1589.7613	0.76133944	615	Q9Y3B4	SF3B6	Splicing factor 3B subunit 6	yes	yes	0	0	0	5	0					1	21.95	21.95	2	1.7883E-30	17295	DP1141_10	211.64	179.03			103550000	561	615	542	862	1152;1153	1152		2	9606
GTEDITSPHGIPLDLLDR	Unmodified	1947.9902	0.99017018	608	Q9Y265	RUVBL1	RuvB-like 1	yes	yes	0	0	0	3	0			1			20.498	20.498	3	0.0046533	14532	DP1141_8	115.87	85.183			5293500	562	608	543	863	1154	1154		1	9606
GTGGASAEGGPTGLAHGR	Unmodified	1551.739	0.73898129	509	Q96F45	ZNF503	Zinc finger protein 503	yes	yes	0	0	0	3.5	0.5			1	1		14.22	14.22	3	6.2371E-07	4772	DP1141_8	188.39	151.03			37767000	563	509	544	864;865	1155;1156;1157	1155		3	9606
GTGIVSAPVPK	Unmodified	1024.5917	0.59169534	155	P15880	RPS2	40S ribosomal protein S2	yes	yes	0	0	0	4	0				1		16.208	16.208	2	0.0059105	7803	DP1141_9	101.46	69.93			66436000	564	155	545	866	1158	1158		1	9606
GTPLDTEVPMER	Oxidation (M)	1359.634	0.63403044	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	1	0	3	1.41	1	1	1	1	1	16.896	16.896	2	2.5959E-56	8505	DP1141_6	183.72	162.04			445640000	565	142	546	867;868;869;870;871	1159;1160;1161;1162;1163;1164;1165;1166	1160	140	7	9606
GVAYTLLTPK	Unmodified	1061.6121	0.61209643	460	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	yes	yes	0	0	0	3	0			1			18.725	18.725	2	0.0029763	12007	DP1141_8	139.97	89.267			10990000	566	460	547	872	1167	1167		1	9606
GVISDILDWK	Unmodified	1144.6128	0.61282471	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	3.33	1.25		1	1		1	23.108	23.108	2	0.0026424	18733	DP1141_7	127.46	88.894			45595000	567	367	548	873;874;875	1168;1169;1170	1169		3	9606
GVLNVHPAASASKPSADQIR	Unmodified	2017.0705	0.070486187	491	Q92576	PHF3	PHD finger protein 3	yes	yes	0	0	1	2	0		1				15.865	15.865	4	3.5629E-05	7354	DP1141_7	87.323	62.43			8783400	568	491	549	876	1171	1171		0	9606
GVNLPGAAVDLPAVSEK	Unmodified	1635.8832	0.88318591	151	P14618	PKM	Pyruvate kinase PKM	yes	yes	0	0	0	1	0	1					19.756	19.756	2	0.00055144	13013	DP1141_6	100.22	70.679			9093400	569	151	550	877	1172	1172		1	9606
GVPAGNSDTEGGQPGR	Unmodified	1497.6808	0.68079771	599	Q9UKV3	ACIN1	Apoptotic chromatin condensation inducer in the nucleus	yes	yes	0	0	0	3	0			1			13.626	13.626	2	1.2854E-05	3924	DP1141_8	151.79	134.62			1950100	570	599	551	878	1173	1173		1	9606
GVVMHTFGGYANSK	Oxidation (M)	1482.6925	0.69254837	436	Q6UXN9	WDR82	WD repeat-containing protein 82	yes	yes	0	1	0	4	0				1		15.822	15.822	3	0.0017963	7206	DP1141_9	92.906	79.985			25480000	571	436	552	879	1174	1174	325	1	9606
GVVVVIK	Unmodified	712.48471	0.48471107	235	P46779	RPL28	60S ribosomal protein L28	yes	yes	0	0	0	5	0					1	16.576	16.576	1	0.0048867	8877	DP1141_10	109.88	35.032			14006000	572	235	553	880	1175	1175		1	9606
GYLDKLEPSK	Unmodified	1148.6077	0.60773933	187	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	yes	yes	0	0	1	3	0			1			17.123	17.123	2	1.5164E-39	9361	DP1141_8	183.43	122.95			40902000	573	187	554	881	1176	1176		1	9606
GYLGPPHQGPPMHHASGHDTR	Oxidation (M)	2264.0294	0.029366429	554	Q9H0L4	CSTF2T	Cleavage stimulation factor subunit 2 tau variant	yes	yes	0	1	0	3	0			1			13.573	13.573	5	0.003608	3780	DP1141_8	59.252	40.195			1617400	574	554	555	882	1177	1177	398	1	9606
GYLGPPHQGPPMHHVPGHESR	Oxidation (M)	2302.0814	0.081401999	204	P33240	CSTF2	Cleavage stimulation factor subunit 2	yes	yes	0	1	0	3	0			1			14.267	14.267	5	0.017072	4814	DP1141_8	45.069	17.557			2947100	575	204	556	883	1178	1178	174	0	9606
GYVKDVDDGLQAAEEVGYPVMIK	Oxidation (M)	2511.2203	0.22030605	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	1	2	0		1				20.8	20.8	3	0.027107	15305	DP1141_7	55.208	16.452			9123200	576	367	557	884	1179	1179	266	0	9606
HALIIYDDLSK	Unmodified	1286.6871	0.68705229	187	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	yes	yes	0	0	0	3.5	0.5			1	1		18.471	18.471	2	0.0038195	11354	DP1141_9	123.86	94.313			60075000	577	187	558	885;886	1180;1181	1181		2	9606
HAPHCLSEEEGEQDRPR	Unmodified	2045.8973	0.8973492	70	O75190	DNAJB6	DnaJ homolog subfamily B member 6	yes	yes	0	0	1	4	0				1		13.779	13.779	4	0.017989	3975	DP1141_9	64.798	49.56			6190000	578	70	559	887	1182	1182		0	9606
HCNMVLENVK	Unmodified	1242.5849	0.58491218	298	P62316	SNRPD2	Small nuclear ribonucleoprotein Sm D2	yes	yes	0	0	0	5	0					1	15.712	15.712	2	0.023949	7492	DP1141_10	135.55	107.34			6266800	579	298	560	888	1183	1183		0	9606
HDLDLICR	Unmodified	1040.5073	0.50731378	286;212;287	P62140;P62136;P36873	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	no	no	0	0	0	2.86	1.25	1	2	2	1	1	21.867	21.867	2	2.1555E-95	9491	DP1141_10	214.25	166.33			4066899999.9999995	580	287;286;212	561	889;890;891;892;893;894;895	1184;1185;1186;1187;1188;1189;1190;1191;1192;1193;1194;1195;1196	1185		13	9606
HDTPDPSPLR	Unmodified	1133.5465	0.54653606	537	Q9BRD0	BUD13	BUD13 homolog	yes	yes	0	0	0	3	0			1			14.524	14.524	2	0.0041685	5257	DP1141_8	124.08	86.986			15232000	581	537	562	896	1197	1197		1	9606
HELQANCYEEVKDR	Unmodified	1789.8053	0.8053463	183	P23528	CFL1	Cofilin-1	yes	yes	0	0	1	5	0					1	14.946	14.946	3	0.021392	6292	DP1141_10	94.532	72.205			6548200	582	183	563	897	1198	1198		0	9606
HEPLVLFCESCDTLTCR	Unmodified	2135.9438	0.94383039	372	Q13263	TRIM28	Transcription intermediary factor 1-beta	yes	yes	0	0	0	2	0		1				19.7	19.7	3	0.0058751	13745	DP1141_7	86.367	72.739			31286000	583	372	564	898	1199;1200	1200		2	9606
HESGASIKIDEPLEGSEDR	Unmodified	2067.9709	0.9708913	284	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	yes	yes	0	0	1	3	0			1			16.578	16.578	3	2.3090000000000003E-190	8485	DP1141_8	222.51	174.14			0	584	284	565	899	1201	1201		1	9606
HEVNYQNVVHK	Unmodified	1365.6789	0.67894722	427	Q5VZL5	ZMYM4	Zinc finger MYM-type protein 4	yes	yes	0	0	0	1	0	1					14.359	14.359	3	0.0020111	4486	DP1141_6	107.03	80.057			2403500	585	427	566	900	1202	1202		0	9606
HFSGLEEAVYR	Unmodified	1306.6306	0.63060004	257	P50990	CCT8	T-complex protein 1 subunit theta	yes	yes	0	0	0	3	0			1			17.724	17.724	2	0.0079642	10400	DP1141_8	110.76	57.82			40344000	586	257	567	901	1203	1203		1	9606
HFSQGSALILHQR	Unmodified	1492.7899	0.78989465	160	P17028	ZNF24	Zinc finger protein 24	yes	yes	0	0	0	4	0				1		16.208	16.208	3	0.015519	7823	DP1141_9	68.809	40.003			8385000	587	160	568	902	1204	1204		1	9606
HGEEVTPEDVLSAAMYPDVFAHFK	Oxidation (M)	2704.2479	0.24791778	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	1	0	2.8	0.748		2	2	1		21.808	21.808	3;4	1.8026E-139	16673	DP1141_7	218.74	202.93			516750000	588	142	569	903;904;905;906;907	1205;1206;1207;1208;1209;1210;1211	1205	141	6	9606
HGEEVTPEDVLSAAMYPDVFAHFK	Unmodified	2688.253	0.25300316	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2	0		1				22.703	22.703	3	6.0132000000000004E-33	18129	DP1141_7	171.29	144.24			22855000	589	142	569	908	1212;1213;1214;1215	1213		4	9606
HGINCFINR	Unmodified	1129.5451	0.54509627	328	P78371	CCT2	T-complex protein 1 subunit beta	yes	yes	0	0	0	3	0			1			16.326	16.326	2	2.5605E-40	8084	DP1141_8	189.62	137.93			33532000	590	328	570	909	1216	1216		1	9606
HGLLLPASPVR	Unmodified	1158.6873	0.68732706	506	Q96E09	FAM122A	Protein FAM122A	yes	yes	0	0	0	4	0				1		17.588	17.588	2	0.023267	9948	DP1141_9	78.149	58.008			3878700	591	506	571	910	1217	1217		1	9606
HGSLGFLPR	Unmodified	982.53485	0.53484916	219	P39023	RPL3	60S ribosomal protein L3	yes	yes	0	0	0	1	0	1					17.455	17.455	2	0.027325	9558	DP1141_6	77.923	50.96			15282000	592	219	572	911	1218	1218		1	9606
HGVQELEIELQSQLSK	Unmodified	1836.9581	0.95814177	19	CON__P35527;P35527	KRT9	Keratin, type I cytoskeletal 9	yes	no	0	0	0	2.67	0.943		2		1		20.496	20.496	2;3	5.1189E-162	14719	DP1141_9	237.46	192.85		+	85627000	593	19	573	912;913;914	1219;1220;1221	1221		3	9606
HGYIGEFEIIDDHR	Unmodified	1699.7954	0.79543354	288	P62244	RPS15A	40S ribosomal protein S15a	yes	yes	0	0	0	5	0					1	18.727	18.727	3	1.8987E-41	12562	DP1141_10	157.33	133.5			168590000	594	288	574	915	1222	1222		1	9606
HIAEVSQEVTR	Unmodified	1267.6521	0.65206377	283	P61764	STXBP1	Syntaxin-binding protein 1	yes	yes	0	0	0	3.5	1.5		1			1	14.739	14.739	3	0.011476	5855	DP1141_10	81.017	47.056			24315000	595	283	575	916;917	1223;1224	1223		2	9606
HIANYISGIQTIGHR	Unmodified	1678.8903	0.89033698	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	0	2	0.632	1	3	1			21.659	21.659	2;3	2.2456E-100	10756	DP1141_7	214.58	202.67			357240000	596	402	576	918;919;920;921;922	1225;1226;1227;1228;1229;1230;1231;1232	1228		7	9606
HIDFSLR	Unmodified	886.4661	0.4661009	236	P46781	RPS9	40S ribosomal protein S9	yes	yes	0	0	0	3	2	1				1	17.496	17.496	2	0.0054064	9467	DP1141_6	153.88	47.124			244550000	597	236	577	923;924	1233;1234	1234		1	9606
HIEIQVLGDK	Unmodified	1150.6346	0.63462279	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	0	0	2.5	1.12	1	1	1	1		17.388	17.388	2	8.411E-17	9720	DP1141_9	185.08	115.03			294870000	598	110	578	925;926;927;928	1235;1236;1237;1238;1239	1239		3	9606
HIMGQNVADYMR	2 Oxidation (M)	1465.6442	0.64421797	233	P46777	RPL5	60S ribosomal protein L5	yes	yes	0	2	0	4	0				1		14.933	14.933	3	0.01783	5626	DP1141_9	63.944	42.643			2301800	599	233	579	929	1240	1240	185;186	0	9606
HKKEEEDEELDLNK	Unmodified	1754.8323	0.83227255	451	Q7Z5K2	WAPAL	Wings apart-like protein homolog	yes	yes	0	0	2	2	0		1				14.079	14.079	3	0.013906	4654	DP1141_7	103.13	69.73			9647800	600	451	580	930	1241	1241		0	9606
HKNMSVHLSPCFR	Oxidation (M)	1627.7711	0.77114982	295	P62280	RPS11	40S ribosomal protein S11	yes	yes	0	1	1	5	0					1	14.924	14.924	4	0.025016	6249	DP1141_10	55.261	28.729			12574000	601	295	581	931	1242	1242	235	0	9606
HLAPPPLLSPLLPSIKPTVR	Unmodified	2145.3038	0.30378059	388	Q14676	MDC1	Mediator of DNA damage checkpoint protein 1	yes	yes	0	0	1	2	0		1				20.601	20.601	3	0.014946	14884	DP1141_7	82.121	73.641			31935000	602	388	582	932	1243	1243		1	9606
HLDGEEDGSSDQSQASGTTGGR	Unmodified	2189.9057	0.90572486	605	Q9UNF1	MAGED2	Melanoma-associated antigen D2	yes	yes	0	0	0	3	0			1			13.493	13.493	3	7.7992E-139	3799	DP1141_8	167.05	157.63			4305700	603	605	583	933	1244;1245;1246;1247	1247		4	9606
HLILVVNYSCPNHYEDYVHR	Unmodified	2527.2067	0.20666209	445	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	yes	yes	0	0	0	2	0		1				18.6	18.6	4	0.014283	12045	DP1141_7	53.188	28.278			58791000	604	445	584	934	1248	1248		1	9606
HLIPAANTGESK	Unmodified	1236.6463	0.64625011	290	P62258	YWHAE	14-3-3 protein epsilon	yes	yes	0	0	0	2.5	1.5	1			1		14.486	14.486	2;3	0.0057899	4788	DP1141_6	101.97	44.927			2393800	605	290	585	935;936	1249;1250	1249		1	9606
HLPSTEPDPHVVR	Unmodified	1482.7579	0.75792582	540	Q9BUJ2	HNRNPUL1	Heterogeneous nuclear ribonucleoprotein U-like protein 1	yes	yes	0	0	0	2.5	0.5		1	1			14.908	14.908	3	0.0032514	5980	DP1141_7	96.82	74.039			58399000	606	540	586	937;938	1251;1252;1253	1252		2	9606
HLQLAIR	Unmodified	849.51847	0.51847082	105;133	Q99878;Q96KK5;Q9BTM1;Q16777;Q93077;Q7L7L0;Q6FI13;P20671;P0C0S8;P04908;Q96QV6;P16104;Q71UI9;P0C0S5	HIST1H2AJ;HIST1H2AH;H2AFJ;HIST2H2AC;HIST1H2AC;HIST3H2A;HIST2H2AA3;HIST1H2AD;HIST1H2AG;HIST1H2AB;HIST1H2AA;H2AFX;H2AFV;H2AFZ	Histone H2A type 1-J;Histone H2A type 1-H;Histone H2A.J;Histone H2A type 2-C;Histone H2A type 1-C;Histone H2A type 3;Histone H2A type 2-A;Histone H2A type 1-D;Histone H2A type 1;Histone H2A type 1-B/E;Histone H2A type 1-A;Histone H2AX;Histone H2A.V;Histone H2A.Z	no	no	0	0	0	3	2	1				1	16.236	16.236	2	2.4335E-12	8350	DP1141_10	160.17	56.886			579210000	607	105;133	587	939;940	1254;1255;1256	1254		3	9606
HMFHVAWVDPEDPYK	Oxidation (M)	1885.8458	0.84575455	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	0	1	0	1					18.955	18.955	3	3.4608E-09	11835	DP1141_6	155.98	139.8			97321000	608	367	588	941	1257;1258	1257	269	2	9606
HMNLILCDCDEFRK	Oxidation (M)	1865.8223	0.82225869	152	P63162;P14678	SNRPN;SNRPB	Small nuclear ribonucleoprotein-associated protein N;Small nuclear ribonucleoprotein-associated proteins B and B'	yes	no	0	1	1	5	0					1	17.237	17.237	3	6.4202E-07	9942	DP1141_10	145.29	111.99			6770200	609	152	589	942	1259	1259	150	0	9606
HNFCFMEMNTR	Oxidation (M)	1501.5901	0.59007391	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	1	0	2	1	1		1			17.296	17.296	3	0.00056275	9540	DP1141_8	95.477	89.395			72309000	610	521	590	943;944	1260;1261	1261	370;371	1	9606
HNFCFMEMNTR	2 Oxidation (M)	1517.585	0.58498853	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	2	0	2.5	1.12	1	1	1	1		15.947	15.947	3	0.024891	6918	DP1141_6	57.175	35.315			74477000	611	521	590	945;946;947;948	1262;1263;1264;1265	1262	370;371	1	9606
HNFCFMEMNTR	Unmodified	1485.5952	0.59515929	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	0	3	0			1			18.625	18.625	3	1.0047E-09	11732	DP1141_8	134.75	126.44			46581000	612	521	590	949	1266	1266		1	9606
HPAKPDPSGECNPDLR	Unmodified	1788.8213	0.82133071	410	Q16576	RBBP7	Histone-binding protein RBBP7	yes	yes	0	0	1	4	0				1		13.91	13.91	3	5.3336E-14	4180	DP1141_9	164.53	142.45			11010000	613	410	591	950	1267;1268	1268		2	9606
HPGSFDVVHVK	Unmodified	1220.6302	0.63020611	177	P22090;P62701	RPS4Y1;RPS4X	40S ribosomal protein S4, Y isoform 1;40S ribosomal protein S4, X isoform	yes	no	0	0	0	5	0					1	15.511	15.511	3	0.012127	7250	DP1141_10	79.036	60.768			30050000	614	177	592	951	1269	1269		1	9606
HQEFDNHINSYDHAHK	Unmodified	1990.867	0.86703535	597	Q9UKJ3;Q7Z570;A4D1E1	GPATCH8;ZNF804A;ZNF804B	G patch domain-containing protein 8;Zinc finger protein 804A;Zinc finger protein 804B	yes	no	0	0	0	2	0		1				14.162	14.162	4	0.019378	4826	DP1141_7	54.393	33.393			3674300	615	597	593	952	1270	1270		1	9606
HQEGEIFDTEKEK	Unmodified	1588.7369	0.73691561	343	Q02878	RPL6	60S ribosomal protein L6	yes	yes	0	0	1	4	0				1		14.822	14.822	3	0.0027535	5479	DP1141_9	111.72	92.221			2281800	616	343	594	953	1271	1271		1	9606
HQGLPQEVLNENLLR	Unmodified	1758.9377	0.9376811	11	CON__P02662			yes	yes	0	0	0	3	1		1		1		19.388	19.388	3	1.3178E-14	12884	DP1141_9	168.93	139.91		+	15648000	617	11	595	954;955	1272;1273	1273		2	
HQVIQTVHPVEK	Unmodified	1413.7728	0.7728476	559	Q9H2P0	ADNP	Activity-dependent neuroprotector homeobox protein	yes	yes	0	0	0	2	0.816	1	1	1			14.062	14.062	3	1.1737999999999999E-80	4560	DP1141_7	174.9	123.18			33642000	618	559	596	956;957;958	1274;1275;1276;1277;1278	1277		5	9606
HQVSVEGTNQTDVK	Unmodified	1540.7481	0.74814899	388	Q14676	MDC1	Mediator of DNA damage checkpoint protein 1	yes	yes	0	0	0	1.67	0.471	1	2				13.81	13.81	2;3	2.4403E-14	4281	DP1141_7	136.33	95.851			15988000	619	388	597	959;960;961	1279;1280;1281	1280		3	9606
HRPSEADEEELAR	Unmodified	1537.7121	0.71209784	43	O14617	AP3D1	AP-3 complex subunit delta-1	yes	yes	0	0	1	1.5	0.5	1	1				14.212	14.212	3	4.2016E-31	4422	DP1141_6	186.51	153.31			13392000	620	43	598	962;963	1282;1283;1284	1282		2	9606
HSAAATALPLSHGAAR	Unmodified	1529.8063	0.806273	75	O75420	GIGYF1	PERQ amino acid-rich with GYF domain-containing protein 1	yes	yes	0	0	0	2	0		1				14.638	14.638	3	0.013791	5487	DP1141_7	98.676	70.292			0	621	75	599	964	1285	1285		1	9606
HSDELTSLLGYFPNKK	Unmodified	1847.9418	0.94176342	497	Q92878	RAD50	DNA repair protein RAD50	yes	yes	0	0	1	2	0		1				20.032	20.032	3	6.4073E-55	14081	DP1141_7	170.74	138.46			18290000	622	497	600	965	1286	1286		1	9606
HSGPNSADSANDGFVR	Unmodified	1629.7132	0.71316047	266	P52597	HNRNPF	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed	yes	yes	0	0	0	4.33	0.471				2	1	14.756	14.756	2;3	6.7383E-287	5496	DP1141_9	315.41	292.03			172760000	623	266	601	966;967;968	1287;1288;1289;1290;1291;1292;1293	1292		7	9606
HSNVNLTIFTAR	Unmodified	1371.7259	0.72589741	461	Q9NRW3;Q8IUX4;Q96AK3	APOBEC3C;APOBEC3F;APOBEC3D	DNA dC->dU-editing enzyme APOBEC-3C;DNA dC->dU-editing enzyme APOBEC-3F;DNA dC->dU-editing enzyme APOBEC-3D	yes	no	0	0	0	2	0		1				17.299	17.299	3	0.022958	9410	DP1141_7	72.289	45.14			8586000	624	461	602	969	1294	1294		0	9606
HTGPITCLQFNPK	Unmodified	1511.7555	0.75548298	436	Q6UXN9	WDR82	WD repeat-containing protein 82	yes	yes	0	0	0	4	0				1		17.487	17.487	3	0.002989	9813	DP1141_9	103.46	71.798			48499000	625	436	603	970	1295;1296	1295		2	9606
HTPLVEFEEEESDKR	Unmodified	1843.8588	0.85882166	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	1	2.67	1.25	1		1	1		17.288	17.288	3	3.8906999999999996E-240	9468	DP1141_8	217.2	197.43			307170000	626	521	604	971;972;973	1297;1298;1299;1300;1301;1302;1303;1304;1305	1303		9	9606
HTPLVEFEEEESDKRESE	Unmodified	2188.976	0.97603626	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	2	3	1.29	1	1	2	1	1	17.476	17.476	2;3	0	10447	DP1141_10	305.4	278.06			1243000000	627	521	605	974;975;976;977;978;979	1306;1307;1308;1309;1310;1311;1312;1313;1314;1315;1316;1317;1318;1319;1320;1321;1322;1323	1308		18	9606
HTVDDGLDIRK	Unmodified	1267.6521	0.65206377	458	Q86VP6	CAND1	Cullin-associated NEDD8-dissociated protein 1	yes	yes	0	0	1	3.5	1.5		1			1	14.739	14.739	3	0.003027	5721	DP1141_7	120.86	45.116			24315000	628	458	606	980;981	1324;1325	1325		2	9606
HVEASGGSGPGDSGPSDPR	Unmodified	1764.7663	0.76631825	606	Q9UPT8	ZC3H4	Zinc finger CCCH domain-containing protein 4	yes	yes	0	0	0	3	0			1			12.756	12.756	3	0.00026534	2964	DP1141_8	136.35	119.11			4636800	629	606	607	982	1326	1326		1	9606
HVEVQVFGDHHGNAVYLFER	Unmodified	2352.14	0.13996274	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	0	3.25	0.968		2	3	2	1	19.028	19.028	2;3;4	1.9978E-27	12595	DP1141_8	207.79	182.26			959560000	630	521	608	983;984;985;986;987;988;989;990	1327;1328;1329;1330;1331;1332;1333;1334;1335;1336;1337;1338;1339	1336		13	9606
HVINFDLPSDIEEYVHR	Unmodified	2082.0171	0.017053633	39	O15523;O00571	DDX3Y;DDX3X	ATP-dependent RNA helicase DDX3Y;ATP-dependent RNA helicase DDX3X	yes	no	0	0	0	3	0			1			21.128	21.128	3	0.0016697	15531	DP1141_8	110.6	77.237			20104000	631	39	609	991	1340	1340		1	9606
HVLHVQLNRPNK	Unmodified	1453.8266	0.82661451	366	Q13011	ECH1	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial	yes	yes	0	0	1	4.5	0.5				1	1	14.511	14.511	3	0.019005	5185	DP1141_9	93.667	66.914			26678000	632	366	610	992;993	1341;1342	1342		0	9606
HVNTNPLCDLTPIFK	Unmodified	1767.8978	0.89779012	600	Q9UKX7	NUP50	Nuclear pore complex protein Nup50	yes	yes	0	0	0	3	0			1			20.628	20.628	2	0.009677	14844	DP1141_8	84.892	52.638			7558200	633	600	611	994	1343	1343		0	9606
HVVFIAQR	Unmodified	968.55558	0.55558461	285	P62081	RPS7	40S ribosomal protein S7	yes	yes	0	0	0	5	0					1	15.658	15.658	2	1.7717E-14	7357	DP1141_10	167.23	143.05			70309000	634	285	612	995	1344	1344		1	9606
HWPFMVVNDAGRPK	Oxidation (M)	1668.8195	0.81948022	140	P11142	HSPA8	Heat shock cognate 71 kDa protein	yes	yes	0	1	1	3	0			1			17.824	17.824	3	0.0077523	10542	DP1141_8	106.26	95.087			59389000	635	140	613	996	1345	1345	134	1	9606
HWPFQVINDGDKPK	Unmodified	1679.842	0.8419898	135	P0DMV8;P0DMV9	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	yes	no	0	0	1	3.33	0.471			2	1		18.257	18.257	2;3	2.5124999999999996E-66	11256	DP1141_8	193.11	193.11			425670000	636	135	614	997;998;999	1346;1347;1348;1349;1350;1351	1347		6	9606
HYFIEVNSR	Unmodified	1163.5724	0.57235688	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	3.25	0.829		1	1	2		16.878	16.878	2	2.7904E-33	9127	DP1141_7	171.38	104.7			148800000	637	142	615	1000;1001;1002;1003	1352;1353;1354;1355	1352		4	9606
IAAGEKIPLSQEEITLQGHAFEAR	Unmodified	2607.3657	0.36566515	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	1	2.67	0.471		1	2			18.951	18.951	3;4	6.3858E-84	12349	DP1141_8	201.27	190.87			507200000	638	521	616	1004;1005;1006	1356;1357;1358;1359	1357		3	9606
IAEENIMK	Unmodified	946.47937	0.4793677	386	Q14320	FAM50A	Protein FAM50A	yes	yes	0	0	0	4	0				1		15.922	15.922	2	0.016466	7357	DP1141_9	99.375	43.253			25087000	639	386	617	1007	1360	1360		1	9606
IAIYELLFK	Unmodified	1108.6532	0.65323296	238	P46783	RPS10	40S ribosomal protein S10	yes	yes	0	0	0	5	0					1	23.265	23.265	2	0.0040668	19417	DP1141_10	105.57	89.365			14195000	640	238	618	1008	1361	1361		1	9606
IALTDNALIAR	Unmodified	1169.6768	0.67682195	167	P18124	RPL7	60S ribosomal protein L7	yes	yes	0	0	0	4.5	0.5				1	1	19.027	19.027	2	4.346E-138	12921	DP1141_10	205.59	120.84			31384000	641	167	619	1009;1010	1362;1363	1362		1	9606
IALYGLGSIPDER	Unmodified	1402.7456	0.7456298	254	P49959	MRE11A	Double-strand break repair protein MRE11A	yes	yes	0	0	0	3	0			1			20.671	20.671	2	0.02101	14832	DP1141_8	104.43	63.007			0	642	254	620	1011	1364	1364		1	9606
IAPYVAHNFSK	Unmodified	1245.6506	0.6506072	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2	1.22	2	1		1		16.014	16.014	2;3	0.0014228	7669	DP1141_7	107.45	83.604			1786299999.9999998	643	142	621	1012;1013;1014;1015	1365;1366;1367;1368;1369	1368		4	9606
IASSIVAQTAGIPTLPWSGSGLR	Unmodified	2281.243	0.24303082	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1.33	0.471	2	1				22.251	22.251	2;3	2.3247E-162	16899	DP1141_6	294.97	246.34			131450000	644	367	622	1016;1017;1018	1370;1371;1372;1373	1370		4	9606
IATGHGQQGVTQVVLK	Unmodified	1634.9104	0.91040372	259	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	yes	yes	0	0	0	3.5	0.5			1	1		15.924	15.924	3	0.0041309	7420	DP1141_8	96.673	72.962			115040000	645	259	623	1019;1020	1374;1375	1374		1	9606
IAVEPVNPSELPK	Unmodified	1391.766	0.76603089	399	Q15029	EFTUD2	116 kDa U5 small nuclear ribonucleoprotein component	yes	yes	0	0	0	3	0			1			18.525	18.525	2	0.029211	11531	DP1141_8	73.781	29.578			3284900	646	399	624	1021	1376	1376		1	9606
ICCDLDVLASK	Unmodified	1292.6105	0.61045823	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	4	1			1		1	18.826	18.826	2	0.0050893	12530	DP1141_10	103.26	62.373			22263000	647	111	625	1022;1023	1377;1378	1377		2	9606
ICGDIHGQYYDLLR	Unmodified	1721.8195	0.8195398	286;212	P62136;P36873	PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	no	no	0	0	0	3	1.41	1		2		1	23.617	23.617	3	0.0011801	12695	DP1141_8	149.57	114.49			1295000000	648	286;212	626	1024;1025;1026;1027	1379;1380;1381;1382	1381		3	9606
IDEMPEAAVK	Oxidation (M)	1117.5325	0.53252548	261	P51858	HDGF	Hepatoma-derived growth factor	yes	yes	0	1	0	4	0				1		14.979	14.979	2	0.018556	5683	DP1141_9	91.265	91.265			5565400	649	261	627	1028	1383	1383	210	0	9606
IDEPLEGSEDR	Unmodified	1258.5677	0.56772501	284	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	yes	yes	0	0	0	4	1			1		1	16.121	16.121	2	0.0030177	7896	DP1141_8	126.07	46.951			93786000	650	284	628	1029;1030	1384;1385	1385		2	9606
IDLDAEEENIQEGPK	Unmodified	1698.7948	0.79482442	149	P13866	SLC5A1	Sodium/glucose cotransporter 1	yes	yes	0	0	0	2	0		1				18.399	18.399	2	0.02038	11481	DP1141_7	75.229	20.743			24793000	651	149	629	1031	1386	1386		1	9606
IDPQEPTHSK	Unmodified	1150.5619	0.56185177	518	Q96P31	FCRL3	Fc receptor-like protein 3	yes	yes	0	0	0	5	0					1	14.995	14.995	2	0.02365	6350	DP1141_10	80.438	6.1372			318300000	652	518	630	1032	1387	1387		1	9606
IDTGWLDR	Unmodified	974.48214	0.48214489	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					19.155	19.155	2	2.2911E-14	12159	DP1141_6	166.78	70.99			908310000	653	367	631	1033	1388	1388		1	9606
IEDVTPIPSDSTR	Unmodified	1428.7096	0.70963822	291	P62263	RPS14	40S ribosomal protein S14	yes	yes	0	0	0	5	0					1	17.237	17.237	2	6.302999999999999E-22	10119	DP1141_10	175.33	132.98			111440000	654	291	632	1034	1389;1390	1389		2	9606
IEDVTPIPSDSTRR	Unmodified	1584.8107	0.81074925	291	P62263	RPS14	40S ribosomal protein S14	yes	yes	0	0	1	5	0					1	16.123	16.123	3	0.0033947	8536	DP1141_10	103.44	74.112			40548000	655	291	633	1035	1391	1391		1	9606
IEEDIGELLIPVRRSGDASQELIVICSTR	Unmodified	3267.7133	0.7132904	132	P0C091	FREM3	FRAS1-related extracellular matrix protein 3	yes	yes	0	0	2	2	0		1				20.8	20.8	4	0.0056383	15054	DP1141_7	41.763	16.928			11818000	656	132	634	1036	1392	1392		1	9606
IEGDETSTEAATR	Unmodified	1378.6212	0.62121715	265	P52434	POLR2H	DNA-directed RNA polymerases I, II, and III subunit RPABC3	yes	yes	0	0	0	5	0					1	14.123	14.123	2	4.6655E-14	5070	DP1141_10	162.38	129.96			9593700	657	265	635	1037	1393;1394	1393		2	9606
IEISELNR	Unmodified	972.52401	0.52400971	102;20	P04264;CON__P04264;CON__P35908v2;CON__P35908;P35908	KRT1;KRT2	Keratin, type II cytoskeletal 1;Keratin, type II cytoskeletal 2 epidermal	no	no	0	0	0	2	0		1				17.299	17.299	2	8.9348E-14	9760	DP1141_7	189.62	55.805		+	418360000	658	102;20	636	1038	1395	1395		0	9606
IENLSNLHQLQMLELGSNR	Oxidation (M)	2224.127	0.12701479	404	Q15435	PPP1R7	Protein phosphatase 1 regulatory subunit 7	yes	yes	0	1	0	4	0				1		19.689	19.689	3	0.010591	13473	DP1141_9	62.002	29.452			204360000	659	404	637	1039	1396	1396	310	1	9606
IENVPTGPNNKPK	Unmodified	1406.7518	0.75177781	58	O43447	PPIH	Peptidyl-prolyl cis-trans isomerase H	yes	yes	0	0	1	5	0					1	13.952	13.952	3	0.0022119	4663	DP1141_10	137.01	85.027			9849200	660	58	638	1040	1397	1397		1	9606
IESGGGNILIHHSR	Unmodified	1488.7797	0.77972389	449	Q7Z3U7	MON2	Protein MON2 homolog	yes	yes	0	0	0	2	0		1				14.889	14.889	3	0.02327	6030	DP1141_7	62.287	43.83			5513500	661	449	639	1041	1398	1398		1	9606
IETIEVMEDR	Oxidation (M)	1249.586	0.58601761	262	P51991	HNRNPA3	Heterogeneous nuclear ribonucleoprotein A3	yes	yes	0	1	0	4	0				1		16.598	16.598	2	0.023721	8520	DP1141_9	123.21	70.042			68746000	662	262	640	1042	1399;1400	1400	211	2	9606
IETNENNLESAK	Unmodified	1360.647	0.64703797	351	Q07065	CKAP4	Cytoskeleton-associated protein 4	yes	yes	0	0	0	3	0			1			14.923	14.923	2	3.4739E-52	5790	DP1141_8	191.4	116.29			16686000	663	351	641	1043	1401	1401		1	9606
IEVIEIMTDR	Unmodified	1217.6326	0.63257388	130	P09651;Q32P51;A0A2R8Y4L2	HNRNPA1;HNRNPA1L2	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2	yes	no	0	0	0	4	0				1		20.493	20.493	2	0.0031002	14549	DP1141_9	107.57	65.465			130180000	664	130	642	1044	1402	1402		1	9606
IEVIEIMTDR	Oxidation (M)	1233.6275	0.6274885	130	P09651;Q32P51;A0A2R8Y4L2	HNRNPA1;HNRNPA1L2	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2	yes	no	0	1	0	4	0				1		18.487	18.487	2	7.7932E-12	11417	DP1141_9	177.3	119.45			41984000	665	130	642	1045	1403	1403	125	0	9606
IFCCHGGLSPDLQSMEQIR	Unmodified	2247.0235	0.023477694	286;212;287	P62140;P62136;P36873	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	no	no	0	0	0	3.5	0.5			1	1		19.607	19.607	3	3.9267E-09	13394	DP1141_9	154.49	125.07			788360000	666	287;286;212	643	1046;1047	1404;1405	1405		2	9606
IFCCHGGLSPDLQSMEQIR	Oxidation (M)	2263.0184	0.018392316	286;212;287	P62140;P62136;P36873	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	no	no	0	1	0	4	0				1		18.088	18.088	3	7.2548E-90	10920	DP1141_9	208.38	192.09			411800000	667	287;286;212	643	1048	1406	1406	177	1	9606
IFCCHGGLSPDLQSMEQIRR	Unmodified	2403.1246	0.12458872	286;212;287	P62140;P62136;P36873	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	no	no	0	0	1	3	0			1			18.725	18.725	4	0.002079	11946	DP1141_8	90.453	55.803			137470000	668	287;286;212	644	1049	1407	1407		1	9606
IFGYPVGIVGNNGVLFSESAK	Unmodified	2167.1314	0.13135511	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3.5	0.5			1	1		22.615	22.615	2;3	2.3631E-07	17929	DP1141_9	114.31	94.986			34680000	669	567	645	1050;1051	1408;1409	1409		2	9606
IFMASEILPPTLR	Oxidation (M)	1502.8167	0.81668625	173	P20936	RASA1	Ras GTPase-activating protein 1	yes	yes	0	1	0	4	0				1		20.785	20.785	3	0.035925	15050	DP1141_9	54.023	33.596			0	670	173	646	1052	1410	1410	155	1	9606
IGEEEIQKPEEK	Unmodified	1427.7144	0.71438925	405	Q15459	SF3A1	Splicing factor 3A subunit 1	yes	yes	0	0	1	2	0		1				14.658	14.658	3	1.8086E-09	5585	DP1141_7	160.91	84.581			26583000	671	405	647	1053	1411	1411		0	9606
IGGGIDVPVPR	Unmodified	1078.6135	0.61349341	500	Q92945	KHSRP	Far upstream element-binding protein 2	yes	yes	0	0	0	2.5	0.5		1	1			18.299	18.299	2	0.010595	11285	DP1141_7	103.55	28.236			10334000	672	500	648	1054;1055	1412;1413	1412		1	9606
IGGIGTVPVGR	Unmodified	1024.6029	0.60292873	320	P68104;Q5VTE0;Q05639	EEF1A1;EEF1A1P5;EEF1A2	Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3;Elongation factor 1-alpha 2	yes	no	0	0	0	2.75	1.48	1	1	1		1	17.329	17.329	2	2.3605999999999997E-21	9656	DP1141_8	170.3	105.73			218810000	673	320	649	1056;1057;1058;1059	1414;1415;1416;1417;1418;1419;1420	1419		7	9606
IGLAEEIR	Unmodified	899.50763	0.50763136	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					17.655	17.655	2	0.00054136	9717	DP1141_6	133.81	31.039			984300000	674	367	650	1060	1421	1421		0	9606
IGPYQPNVPVGIDYVIPK	Unmodified	1968.072	0.072049316	229	P43243	MATR3	Matrin-3	yes	yes	0	0	0	2	0		1				21.5	21.5	2	0.00018162	16262	DP1141_7	105.66	74.063			25257000	675	229	651	1061	1422	1422		1	9606
IGSFGPGEDLLYLR	Unmodified	1535.7984	0.79839365	40	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	yes	yes	0	0	0	1	0	1					21.968	21.968	2	8.4685E-67	16449	DP1141_6	198.62	160.32			11415000	676	40	652	1062	1423	1423		1	9606
IGSFGPQEDLLFLR	Unmodified	1590.8406	0.84059282	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	2.67	1.7	1	1			1	22.637	22.637	2	2.9186E-206	17374	DP1141_6	247.96	228.86			542600000	677	367	653	1063;1064;1065	1424;1425;1426;1427;1428	1425		4	9606
IGVLDEGK	Unmodified	829.45453	0.45453316	236	P46781	RPS9	40S ribosomal protein S9	yes	yes	0	0	0	5	0					1	16.316	16.316	2	0.0076826	8540	DP1141_10	107.59	18.224			96321000	678	236	654	1066	1429	1429		1	9606
IHEGCEEPATHNALAK	Unmodified	1775.8261	0.82608174	336	Q00610	CLTC	Clathrin heavy chain 1	yes	yes	0	0	0	1.5	0.5	1	1				13.8	13.8	3	2.1888000000000002E-70	3885	DP1141_6	203.85	138.76			14220000	679	336	655	1067;1068	1430;1431	1430		2	9606
IHFPLATYAPVISAEK	Unmodified	1755.956	0.95595693	321;442;322	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	no	no	0	0	0	2.71	1.39	2	1	2	1	1	20.421	20.421	2;3	7.4551E-06	14142	DP1141_6	134.81	111.17			692750000	680	321;322;442	656	1069;1070;1071;1072;1073;1074;1075	1432;1433;1434;1435;1436;1437;1438;1439;1440;1441;1442;1443;1444;1445;1446;1447	1435		16	9606
IHNANPELTDGQIQAMLR	Oxidation (M)	2036.0109	0.010922397	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	0	1	0	2					17.555	17.555	2;3	4.0481E-23	9527	DP1141_6	154.47	133.53			197890000	681	367	657	1076;1077	1448;1449	1449	270	1	9606
IHNANPELTDGQIQAMLR	Unmodified	2020.016	0.016007775	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	4	0				1		19.188	19.188	3	0.00031857	12718	DP1141_9	117.13	101.5			14730000	682	367	657	1078	1450	1450		1	9606
IHTGEKPYECVQCGK	Unmodified	1804.8236	0.8236389	160	P17028	ZNF24	Zinc finger protein 24	yes	yes	0	0	1	4	0				1		14.28	14.28	3	0.0094884	4686	DP1141_9	120.9	1.7272			12227000	683	160	658	1079	1451	1451		1	9606
IIDEVVNK	Unmodified	928.52295	0.52294707	95	O95816	BAG2	BAG family molecular chaperone regulator 2	yes	yes	0	0	0	5	0					1	15.56	15.56	2	1.8381E-22	7257	DP1141_10	175.75	57.067			106460000	684	95	659	1080	1452	1452		1	9606
IIDFLSALEGFK	Unmodified	1351.7388	0.73875351	268	P52701	MSH6	DNA mismatch repair protein Msh6	yes	yes	0	0	0	2	0		1				24.603	24.603	2	0.028249	20955	DP1141_7	75.294	24.235			7417300	685	268	660	1081	1453	1453		1	9606
IIDPLPPIDHSEIDYPPFEK	Unmodified	2334.1784	0.17836488	460	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	yes	yes	0	0	0	3	0.816		1	1	1		21.163	21.163	3	3.2432E-06	15812	DP1141_7	113.86	88.032			59399000	686	460	661	1082;1083;1084	1454;1455;1456;1457;1458	1456		5	9606
IIEDQQESLNK	Unmodified	1315.662	0.66195975	116	P05455	SSB	Lupus La protein	yes	yes	0	0	0	3	0			1			15.221	15.221	2	4.149E-66	6262	DP1141_8	200.54	104.05			7957800	687	116	662	1085	1459	1459		1	9606
IIEEAPAPGIK	Unmodified	1136.6441	0.64412484	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	0	2	0.816	1	1	1			16.511	16.511	2	4.8634E-05	8464	DP1141_7	146.79	110.34			2274300000	688	521	663	1086;1087;1088	1460;1461;1462;1463;1464	1462		4	9606
IIEEAPATIATPAVFEHMEQCAVK	Oxidation (M)	2670.3033	0.30332417	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	0	1	0	1					19.355	19.355	3	1.0337E-10	12456	DP1141_6	111.44	92.679			103050000	689	367	664	1089	1465	1465	271	1	9606
IIEEAPATIATPAVFEHMEQCAVK	Unmodified	2654.3084	0.30840955	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					20.814	20.814	3	4.8317E-12	14724	DP1141_6	151.21	135.69			31743000	690	367	664	1090	1466;1467;1468	1467		3	9606
IIEFVPTK	Unmodified	945.55352	0.55351892	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1.67	0.943	2		1			18.345	18.345	1;2	9.424800000000001E-30	10942	DP1141_6	180.93	80.86			858190000	691	367	665	1091;1092;1093	1469;1470;1471;1472	1471		3	9606
IIGVHQEDELLECLSPATSR	Unmodified	2266.1263	0.12634609	501	Q93009	USP7	Ubiquitin carboxyl-terminal hydrolase 7	yes	yes	0	0	0	2.5	0.5		1	1			20.364	20.364	3	0.012172	14646	DP1141_7	64.203	45.247			105940000	692	501	666	1094;1095	1473;1474;1475	1473		3	9606
IILDLISESPIK	Unmodified	1339.7963	0.79626839	284	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	yes	yes	0	0	0	4	0.816			1	1	1	21.907	21.907	2	1.7771E-113	16664	DP1141_8	221.68	221.68			93080000	693	284	667	1096;1097;1098	1476;1477;1478;1479;1480;1481;1482	1478		7	9606
IINEPTAAAIAYGLDKK	Unmodified	1786.9829	0.98289996	140	P11142;P54652	HSPA8;HSPA2	Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2	yes	no	0	0	1	3.5	0.5			1	1		19.143	19.143	3	0.00094455	12471	DP1141_8	83.253	54.704			563260000	694	140	668	1099;1100	1483;1484	1483		1	9606
IINEPTAAAIAYGLDKR	Unmodified	1814.989	0.98904797	139	P11021	HSPA5	78 kDa glucose-regulated protein	yes	yes	0	0	1	3	0			1			19.43	19.43	3	0.02068	12990	DP1141_8	59.606	32.109			0	695	139	669	1101	1485	1485		1	9606
IINEPTAAAIAYGLDR	Unmodified	1686.8941	0.89408495	135;161	P0DMV8;P0DMV9;P17066	HSPA1A;HSPA1B;HSPA6	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 6	no	no	0	0	0	3.4	0.49			3	2		20.401	20.401	2;3	0	14681	DP1141_9	257.2	165.61			3057599999.9999995	696	135;161	670	1102;1103;1104;1105;1106	1486;1487;1488;1489;1490;1491;1492	1492		6	9606
IIPLYSTLPPQQQQR	Unmodified	1780.9836	0.98356866	54	O43143	DHX15	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15	yes	yes	0	0	0	3	0			1			19.225	19.225	2	0.029363	12769	DP1141_8	63.473	20.844			6559700	697	54	671	1107	1493	1493		1	9606
IIQQAGQVWFPDSAFK	Unmodified	1833.9414	0.94136949	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	2	1.41	2			1		21.352	21.352	2;3	1.685E-134	15919	DP1141_9	287.29	236.81			395150000	698	367	672	1108;1109;1110	1494;1495;1496;1497;1498	1498		4	9606
IITHPNFNGNTLDNDIMLIK	Oxidation (M)	2298.1678	0.16781697	8	CON__P00761			yes	yes	0	1	0	3	0			1			20.126	20.126	3	3.9706E-05	14049	DP1141_8	101.49	84.777		+	63040000	699	8	673	1111	1499	1499	8	1	
IITHPNFNGNTLDNDIMLIK	Unmodified	2282.1729	0.17290235	8	CON__P00761			yes	yes	0	0	0	3	0			1			20.657	20.657	3	0.0089379	14811	DP1141_8	104.03	51.096		+	0	700	8	673	1112	1500	1500		1	
IITITGTQDQIQNAQYLLQNSVK	Unmodified	2588.381	0.38098087	284	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	yes	yes	0	0	0	3	0			1			22.129	22.129	3	7.4527E-09	16922	DP1141_8	112.57	80.003			25118000	701	284	674	1113	1501;1502	1501		2	9606
IIVGDATEKDASK	Unmodified	1345.7089	0.70890994	513	Q96I25	RBM17	Splicing factor 45	yes	yes	0	0	1	3.5	0.5			1	1		14.415	14.415	3	0.0020796	5175	DP1141_8	118.76	66.032			119940000	702	513	675	1114;1115	1503;1504;1505	1504		3	9606
IKDEPDNAQEYSHGQQQK	Unmodified	2113.9665	0.96647463	427	Q5VZL5	ZMYM4	Zinc finger MYM-type protein 4	yes	yes	0	0	1	3	0			1			13.493	13.493	3	0.018553	3763	DP1141_8	93.427	56.923			1187600	703	427	676	1116	1506;1507	1506		2	9606
IKFEMEQNLR	Oxidation (M)	1322.6653	0.66527099	19	CON__P35527;P35527	KRT9	Keratin, type I cytoskeletal 9	yes	no	0	1	1	2.5	1.26	2	1	1	2		15.955	15.955	2;3	0.00089408	7463	DP1141_7	112.11	79.889		+	584780000	704	19	677	1117;1118;1119;1120;1121;1122	1508;1509;1510;1511;1512;1513	1510	18	3	9606
IKFEMEQNLR	Unmodified	1306.6704	0.67035637	19	CON__P35527;P35527	KRT9	Keratin, type I cytoskeletal 9	yes	no	0	0	1	4	0				1		17.588	17.588	3	0.030082	10117	DP1141_9	136.52	67.889		+	16064000	705	19	677	1123	1514	1514		0	9606
IKYPENFFLLR	Unmodified	1438.7973	0.79727144	286;212;287	P62140;P62136;P36873	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	no	no	0	0	1	3.29	1.39	1	1	2	1	2	20.729	20.729	2;3	1.0675E-30	15608	DP1141_10	165.63	148.5			3092899999.9999995	706	287;286;212	678	1124;1125;1126;1127;1128;1129;1130	1515;1516;1517;1518;1519;1520;1521;1522;1523	1515		8	9606
ILELLRPDPNTGK	Unmodified	1464.83	0.83002813	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	1	1.33	0.471	2	1				18.406	18.406	2;3	1.4193999999999999E-39	10951	DP1141_6	171.49	111.09			241440000	707	402	679	1131;1132;1133	1524;1525;1526	1524		3	9606
ILEMNDKYVK	Oxidation (M)	1267.6482	0.64822394	382	Q14149	MORC3	MORC family CW-type zinc finger protein 3	yes	yes	0	1	1	3	0			1			14.893	14.893	3	0.018143	5784	DP1141_8	81.525	24.376			0	708	382	680	1134	1527	1527	299	1	9606
ILGADTSVDLEETGR	Unmodified	1574.7788	0.77878042	187	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	yes	yes	0	0	0	5	0					1	18.687	18.687	2	3.0437E-69	12393	DP1141_10	203.03	159.4			6306300	709	187	681	1135	1528	1528		1	9606
ILGTPDYLAPELLLGR	Unmodified	1739.9822	0.98217168	512	Q96GX5	MASTL	Serine/threonine-protein kinase greatwall	yes	yes	0	0	0	5	0					1	23.402	23.402	2	0.02286	19592	DP1141_10	74.392	56.058			4823800	710	512	682	1136	1529	1529		1	9606
ILLAELEQLKGQGK	Unmodified	1538.9032	0.90319307	127	P08670	VIM	Vimentin	yes	yes	0	0	1	3	0			1			19.526	19.526	3	0.00079837	13153	DP1141_8	121.68	78.178			75331000	711	127	683	1137	1530	1530		0	9606
ILMEHIHK	Unmodified	1019.5586	0.55862107	332	P84098	RPL19	60S ribosomal protein L19	yes	yes	0	0	0	5	0					1	14.631	14.631	2	0.027408	5808	DP1141_10	98.418	31.619			2587300	712	332	684	1138	1531	1531		0	9606
ILNEMRDQYEK	Oxidation (M)	1453.6871	0.68712864	9;21	CON__P02533;P02533;CON__Q6IFX2;CON__Q04695;Q04695	KRT14;KRT17	Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 17	no	no	0	1	1	4	0				1		14.514	14.514	3	0.0011455	5011	DP1141_9	86.463	38.491		+	47302000	713	9;21	685	1139	1532	1532	9	0	9606
ILNVPQELYEK	Unmodified	1344.7289	0.7289171	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					19.355	19.355	2	1.1794999999999998E-52	12430	DP1141_6	194.94	144.46			299420000	714	367	686	1140	1533;1534	1533		2	9606
ILSKPIEVQVGGR	Unmodified	1394.8245	0.82454882	445	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	yes	yes	0	0	1	1	0	1					16.68	16.68	3	1.4055E-13	8162	DP1141_6	162.93	120.45			24089000	715	445	687	1141	1535	1535		1	9606
ILSMLADSTSTQEK	Oxidation (M)	1538.7498	0.74978848	425	Q5VUA4	ZNF318	Zinc finger protein 318	yes	yes	0	1	0	2	0		1				16.657	16.657	2	0.033365	8719	DP1141_7	87.713	44.406			0	716	425	688	1142	1536	1536	322	1	9606
ILSTMDSPST	Oxidation (M)	1066.4852	0.48524094	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	0	1	0	1					16.055	16.055	2	0.028587	7063	DP1141_6	87.754	60.23			105270000	717	367	689	1143	1537	1537	272	0	9606
ILVVIEPLLIDEDYYAR	Unmodified	2033.1085	0.1084944	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	2	0		1				24.201	24.201	2	0	20266	DP1141_7	277.15	250			34758000	718	78	690	1144	1538;1539	1539		2	9606
IMDQAITVGAPVIGLNDSGGAR	Unmodified	2154.1103	0.11030209	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3	0			1			20.533	20.533	2	0.0030595	14825	DP1141_8	77.222	38.922			14134000	719	111	691	1145	1540	1540		1	9606
IMGNLGAADIDHK	Oxidation (M)	1369.666	0.66599927	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	1	0	2	0		1				15.564	15.564	3	0.0098333	6994	DP1141_7	71.933	41.602			195800000	720	78	692	1146	1541	1541	65	1	9606
IMLPWDPTGK	Oxidation (M)	1172.59	0.58998078	182	P23396	RPS3	40S ribosomal protein S3	yes	yes	0	1	0	5	0					1	20.814	20.814	2	0.012419	15636	DP1141_10	105.52	57.672			20379000	721	182	693	1147	1542	1542	161	1	9606
IMLPWDPTGK	Unmodified	1156.5951	0.59506616	182	P23396	RPS3	40S ribosomal protein S3	yes	yes	0	0	0	5	0					1	21.509	21.509	2	0.0030446	16655	DP1141_10	140.35	97.484			15766000	722	182	693	1148	1543	1543		1	9606
IMNTFSVVPSPK	Oxidation (M)	1334.6904	0.69042311	122;323;376	P07437;P68371;P04350;Q13509	TUBB;TUBB4B;TUBB4A;TUBB3	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-3 chain	no	no	0	1	0	3	1.63	1		1		1	18.187	18.187	2	0.0089156	11678	DP1141_10	137.98	77.957			182620000	723	122;323;376	694	1149;1150;1151	1544;1545;1546;1547;1548	1544	108	4	9606
IMNTFSVVPSPK	Unmodified	1318.6955	0.69550848	122;323;376	P07437;P68371;P04350;Q13509	TUBB;TUBB4B;TUBB4A;TUBB3	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-3 chain	no	no	0	0	0	3.5	0.5			1	1		19.051	19.051	2	3.1778E-09	12425	DP1141_8	172.27	97.062			160140000	724	122;323;376	694	1152;1153	1549;1550;1551;1552;1553;1554	1550		6	9606
INEVLADFMGR	Oxidation (M)	1279.6231	0.62307182	354	Q07973	CYP24A1	1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial	yes	yes	0	1	0	1	0	1					19.547	19.547	2	0.010278	12733	DP1141_6	96.143	56.225			0	725	354	695	1154	1555	1555	260	1	9606
INTQWLLTSGTTEANAWK	Unmodified	2033.0218	0.02180466	29	CON__Streptavidin			yes	yes	0	0	0	3	2	1				1	21.596	21.596	2;3	7.476499999999999E-296	16928	DP1141_10	216.71	160.95		+	1178800000	726	29	696	1155;1156	1556;1557;1558;1559	1556		4	
INVYYNEAAGNK	Unmodified	1354.6517	0.65172941	381	Q13885	TUBB2A	Tubulin beta-2A chain	yes	yes	0	0	0	5	0					1	16.762	16.762	2	4.0691E-21	9208	DP1141_10	169.65	121.99			23270000	727	381	697	1157	1560;1561	1561		2	9606
INVYYNEATGGK	Unmodified	1327.6408	0.64083038	323	P68371	TUBB4B	Tubulin beta-4B chain	yes	yes	0	0	0	3.5	0.5			1	1		17.055	17.055	2	9.0573E-41	9222	DP1141_9	188.91	148.13			240110000	728	323	698	1158;1159	1562;1563	1563		1	9606
IPCDSPQSDPVDTPTSTK	Unmodified	1943.8782	0.87823647	232	P46013	MKI67	Antigen KI-67	yes	yes	0	0	0	2	0		1				15.964	15.964	2	0.0087696	7790	DP1141_7	90.759	68.038			16488000	729	232	699	1160	1564	1564		1	9606
IPDWFLNR	Unmodified	1059.5502	0.55016488	293	P62269	RPS18	40S ribosomal protein S18	yes	yes	0	0	0	5	0					1	21.126	21.126	2	1.0417E-05	16062	DP1141_10	143.02	60.269			60846000	730	293	700	1161	1565;1566	1565		2	9606
IPGGIIEDSCVLR	Unmodified	1427.7442	0.74424959	246	P49368	CCT3	T-complex protein 1 subunit gamma	yes	yes	0	0	0	3.5	0.5			1	1		19.489	19.489	2	0.014046	13124	DP1141_9	83.862	41.526			15695000	731	246	701	1162;1163	1567;1568	1568		2	9606
IPGGNIYISPLK	Unmodified	1270.7285	0.72852317	117	P06400	RB1	Retinoblastoma-associated protein	yes	yes	0	0	0	1	0	1					19.289	19.289	2	0.014768	12454	DP1141_6	91.658	33.062			6446700	732	117	702	1164	1569	1569		0	9606
IPLSQEEITLQGHAFEAR	Unmodified	2038.0484	0.048353761	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	0	3.25	1.48	1		1	1	1	19.224	19.224	3	3.5835999999999997E-296	12683	DP1141_8	265.27	218.38			1002299999.9999999	733	521	703	1165;1166;1167;1168	1570;1571;1572;1573;1574;1575;1576;1577	1574		7	9606
IPSIVSSPLNSPLDR	Unmodified	1593.8726	0.87262123	252	P49790	NUP153	Nuclear pore complex protein Nup153	yes	yes	0	0	0	2	0		1				20.2	20.2	2	2.5026E-24	14281	DP1141_7	166.11	125.03			16171000	734	252	704	1169	1578	1578		0	9606
IPVGPETLGR	Unmodified	1037.5869	0.58694431	118	P06576	ATP5B	ATP synthase subunit beta, mitochondrial	yes	yes	0	0	0	2	0		1				17.4	17.4	2	0.0035677	9915	DP1141_7	109.11	66.241			22490000	735	118	705	1170	1579	1579		1	9606
IPVQAVWAGWGHASENPK	Unmodified	1945.9799	0.97988027	367;40	Q13085;O00763	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	no	no	0	0	0	1	0	2					19.756	19.756	2;3	4.4239000000000004E-105	13064	DP1141_6	211.49	193.81			332950000	736	367;40	706	1171;1172	1580;1581	1580		1	9606
IQDKEGIPPDQQR	Unmodified	1522.774	0.77396981	134	P62987;P62979;P0CG47;P0CG48;A0A2R8Y422	UBA52;RPS27A;UBB;UBC	Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Polyubiquitin-B;Ubiquitin;Polyubiquitin-C;Ubiquitin	yes	no	0	0	1	2.5	1.5	2	2		1	1	13.916	13.916	2;3	0.0018429	4411	DP1141_7	143.42	81.645			114590000	737	134	707	1173;1174;1175;1176;1177;1178	1582;1583;1584;1585;1586;1587;1588;1589	1588		8	9606
IQDWYDKK	Unmodified	1094.5397	0.53965977	19	CON__P35527;P35527	KRT9	Keratin, type I cytoskeletal 9	yes	no	0	0	1	1	0	1					15.855	15.855	2	0.021808	6777	DP1141_6	120.46	57.742		+	18067000	738	19	708	1179	1590	1590		1	9606
IQEAGTEVVK	Unmodified	1072.5764	0.57643921	223	P40926	MDH2	Malate dehydrogenase, mitochondrial	yes	yes	0	0	0	2.33	1.25	1	1		1		14.667	14.667	2	0.0036288	4929	DP1141_6	124.92	40.424			27995000	739	223	709	1180;1181;1182	1591;1592;1593;1594	1591		3	9606
IQLIFER	Unmodified	917.53345	0.53345218	398	Q15020	SART3	Squamous cell carcinoma antigen recognized by T-cells 3	yes	yes	0	0	0	2	0		1				19.649	19.649	2	7.9652E-40	13486	DP1141_7	173.85	19.964			0	740	398	710	1183	1595	1595		1	9606
IQQQFSDLKR	Unmodified	1261.6779	0.67788459	86	O94906	PRPF6	Pre-mRNA-processing factor 6	yes	yes	0	0	1	2	0		1				15.291	15.291	3	0.013839	6710	DP1141_7	82.029	46.487			2536900	741	86	711	1184	1596	1596		1	9606
IQREREMEK	Oxidation (M)	1233.6136	0.61356977	553	Q9H0G5	NSRP1	Nuclear speckle splicing regulatory protein 1	yes	yes	0	1	2	3	0			1			16.318	16.318	2	0.030828	8052	DP1141_8	84.568	18.495			0	742	553	712	1185	1597	1597	397	1	9606
ISEQFTAMFR	Oxidation (M)	1244.586	0.58595803	122;323;381;376	P07437;P68371;P04350;Q13885;Q9BVA1;Q13509	TUBB;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain	no	no	0	1	0	5	0					1	18.637	18.637	2	7.7932E-12	12272	DP1141_10	177.3	105.43			28304000	743	122;323;381;376	713	1186	1598	1598	109	0	9606
ISGLIYEETR	Unmodified	1179.6136	0.61355299	303	P62805	HIST1H4A	Histone H4	yes	yes	0	0	0	2.75	1.48	1	1	1		1	18.23	18.23	2	6.3371E-96	11714	DP1141_10	214.96	158.24			387740000	744	303	714	1187;1188;1189;1190	1599;1600;1601;1602;1603;1604;1605	1599		7	9606
ISLGLPVGAVINCADNTGAK	Unmodified	1969.0303	0.030260856	305	P62829	RPL23	60S ribosomal protein L23	yes	yes	0	0	0	5	0					1	21.126	21.126	2	0.033534	16155	DP1141_10	81.992	59.211			67866000	745	305	715	1191	1606	1606		1	9606
ISLLLDPGSFVESDMFVEHR	Oxidation (M)	2306.1253	0.12528345	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	1	0	5	0					1	22.309	22.309	3	0.0022306	17995	DP1141_10	77.959	59.505			24880000	746	111	716	1192	1607	1607	101	1	9606
ISLPIEDYFNK	Unmodified	1337.6867	0.68671794	587	Q9UBD5	ORC3	Origin recognition complex subunit 3	yes	yes	0	0	0	3	0			1			21.629	21.629	2	0.0092731	16194	DP1141_8	89.886	35.163			9749800	747	587	717	1193	1608	1608		1	9606
ISLPLPNFSSLNLR	Unmodified	1569.8879	0.88787736	127	P08670	VIM	Vimentin	yes	yes	0	0	0	3	0			1			22.837	22.837	2	3.7103E-30	17933	DP1141_8	172.8	141.21			20949000	748	127	718	1194	1609;1610	1609		2	9606
ISPPIKEEETKGDSVEK	Unmodified	1884.968	0.96803775	433	Q6PJT7	ZC3H14	Zinc finger CCCH domain-containing protein 14	yes	yes	0	0	2	3	0			2			14.728	14.728	3;4	0.008965	5590	DP1141_8	133.87	108.95			11995000	749	433	719	1195;1196	1611;1612	1611		1	9606
ISTLTIEEGNLDIQRPK	Unmodified	1926.0422	0.042205751	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	1	3.8	0.748			2	2	1	18.706	18.706	2;3	0	11984	DP1141_8	340.88	271.62			6975199999.999999	750	365	720	1197;1198;1199;1200;1201	1613;1614;1615;1616;1617;1618;1619;1620	1616		8	9606
ISVMGGEQAANVLATITK	Unmodified	1801.9608	0.96078431	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	4	0.816			1	1	1	21.74	21.74	2	5.3250999999999995E-248	16420	DP1141_8	259.27	225.4			637590000	751	567	721	1202;1203;1204	1621;1622;1623	1622		2	9606
ISVMGGEQAANVLATITK	Oxidation (M)	1817.9557	0.95569893	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	1	0	3	0			1			20.728	20.728	2	3.9398E-15	14808	DP1141_8	163.62	107.41			1358400000	752	567	721	1205	1624	1624	405	1	9606
ISVYYNEASSHK	Unmodified	1396.6623	0.6622941	376	Q13509	TUBB3	Tubulin beta-3 chain	yes	yes	0	0	0	2	0		1				15.564	15.564	3	0.035366	6951	DP1141_7	55.258	21.716			9065200	753	376	722	1206	1625	1625		1	9606
ITADGAHFELR	Unmodified	1228.62	0.62003536	463	Q8IWX8	CHERP	Calcium homeostasis endoplasmic reticulum protein	yes	yes	0	0	0	3	0			1			17.13	17.13	3	0.0076507	9384	DP1141_8	113.67	48.393			17722000	754	463	723	1207	1626	1626		1	9606
ITAEEMYDIFGK	Oxidation (M)	1431.6592	0.65918256	615	Q9Y3B4	SF3B6	Splicing factor 3B subunit 6	yes	yes	0	1	0	5	0					1	19.726	19.726	2	4.5082E-14	13970	DP1141_10	166.66	92.485			296400000	755	615	724	1208	1627	1627	423	1	9606
ITDIIGKEEGIGPENLR	Unmodified	1852.9894	0.9894419	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	1.75	0.829	2	1	1			18.658	18.658	2;3	0	11380	DP1141_6	283.66	226.31			752080000	756	367	725	1209;1210;1211;1212	1628;1629;1630;1631;1632;1633;1634;1635;1636;1637	1632		9	9606
ITGEAFVQFASQELAEK	Unmodified	1866.9363	0.9363437	266	P52597	HNRNPF	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed	yes	yes	0	0	0	4	0				1		22.543	22.543	2	2.2299E-23	17802	DP1141_9	171.36	141.81			55868000	757	266	726	1213	1638	1638		1	9606
ITISPLQELTLYNPER	Unmodified	1886.0149	0.014928368	36	O00425	IGF2BP3	Insulin-like growth factor 2 mRNA-binding protein 3	yes	yes	0	0	0	3	0			1			22.482	22.482	2	0.026175	17505	DP1141_8	119.21	78.84			0	758	36	727	1214	1639	1639		1	9606
ITLIIGGSYGAGNYGMCGR	Unmodified	1958.9343	0.93425198	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3	0			1			20.728	20.728	2	9.708500000000002E-41	14982	DP1141_8	224.25	181.77			9219600	759	567	728	1215	1640	1640		0	9606
ITPENLPQILLQLK	Unmodified	1618.9658	0.96579333	229	P43243	MATR3	Matrin-3	yes	yes	0	0	0	2.5	0.5		1	1			23.236	23.236	2	0.00067643	18882	DP1141_7	144.77	118.88			19027000	760	229	729	1216;1217	1641;1642;1643	1641		3	9606
ITPSYVAFTPEGER	Unmodified	1565.7726	0.77257283	139	P11021	HSPA5	78 kDa glucose-regulated protein	yes	yes	0	0	0	3	0			1			19.026	19.026	2	0.00050378	12347	DP1141_8	117.09	74.901			94275000	761	139	730	1218	1644	1644		0	9606
ITSEAEDLVANFFPK	Unmodified	1679.8407	0.8406524	281	P61289	PSME3	Proteasome activator complex subunit 3	yes	yes	0	0	0	4.5	0.5				1	1	23.319	23.319	2	0.0033287	19200	DP1141_10	119.03	86.169			12408000	762	281	731	1219;1220	1645;1646;1647;1648;1649;1650	1645		6	9606
ITSENPDEGFKPSSGTVQELNFR	Unmodified	2551.2191	0.2190605	367;40	Q13085;O00763	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	no	no	0	0	1	2	0		1				18.8	18.8	3	2.4503E-42	12135	DP1141_7	178.1	161.51			43579000	763	367;40	732	1221	1651	1651		1	9606
IVAERPGTNSTGPAPMAPPR	Oxidation (M)	2034.0317	0.031657839	372	Q13263	TRIM28	Transcription intermediary factor 1-beta	yes	yes	0	1	1	2.5	0.5		1	1			15.041	15.041	3	7.2542E-08	6153	DP1141_7	151.39	123.96			277210000	764	372	733	1222;1223	1652;1653;1654;1655;1656	1653	291	5	9606
IVAERPGTNSTGPAPMAPPR	Unmodified	2018.0367	0.036743217	372	Q13263	TRIM28	Transcription intermediary factor 1-beta	yes	yes	0	0	1	2	0		1				15.964	15.964	3	0.0085394	7598	DP1141_7	96.447	80.457			50800000	765	372	733	1224	1657	1657		1	9606
IVALNAHTFLR	Unmodified	1253.7244	0.72444085	176	P22087;A6NHQ2	FBL;FBLL1	rRNA 2'-O-methyltransferase fibrillarin;rRNA/tRNA 2'-O-methyltransferase fibrillarin-like protein 1	yes	no	0	0	0	4	0				1		18.687	18.687	3	0.0045137	11705	DP1141_9	96.665	74.024			19271000	766	176	734	1225	1658	1658		1	9606
IVDDLKDEAEQYR	Unmodified	1592.7682	0.76821574	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	2	0		2				17.4	17.4	2;3	8.0437E-233	9908	DP1141_7	258.01	214.05			84550000	767	78	735	1226;1227	1659;1660	1659		1	9606
IVDDLKDEAEQYRK	Unmodified	1720.8632	0.86317875	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	2	1.5	0.5	1	1				16.462	16.462	3	1.0206E-08	8286	DP1141_7	188.15	150.62			988150000	768	78	736	1228;1229	1661;1662;1663;1664	1662		3	9606
IVEIPFNSTNK	Unmodified	1260.6714	0.67140222	106	P05023	ATP1A1	Sodium/potassium-transporting ATPase subunit alpha-1	yes	yes	0	0	0	1	0	1					18.61	18.61	2	0.020516	11156	DP1141_6	90.709	38.306			2699900	769	106	737	1230	1665	1665		0	9606
IVEPYIAWGYPNLK	Unmodified	1661.8817	0.88172935	167	P18124	RPL7	60S ribosomal protein L7	yes	yes	0	0	0	5	0					1	21.809	21.809	2	0.018795	17284	DP1141_10	78.655	28.372			23993000	770	167	738	1231	1666	1666		1	9606
IVEQPTVSVTEPK	Unmodified	1425.7715	0.7715102	400	Q15054	POLD3	DNA polymerase delta subunit 3	yes	yes	0	0	0	3	0			1			16.684	16.684	2	0.0090299	8544	DP1141_8	88.187	44.879			7056500	771	400	739	1232	1667	1667		1	9606
IVGDLAQFMVQNGLSR	Unmodified	1746.9087	0.90868916	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2.67	1.25	1		1	1		22.251	22.251	2	5.1786E-84	17335	DP1141_9	207.47	132.52			75790000	772	142	740	1233;1234;1235	1668;1669;1670;1671;1672	1671		5	9606
IVGDLAQFMVQNGLSR	Oxidation (M)	1762.9036	0.90360378	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	1	0	4	0				1		20.234	20.234	2	6.1878E-18	14217	DP1141_9	156.14	113.42			0	773	142	740	1236	1673	1673	142	1	9606
IVILEYQPSK	Unmodified	1188.6754	0.67542497	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	0	1.5	0.5	1	1				18.827	18.827	2	9.552800000000002E-41	11643	DP1141_6	187	122.79			382980000	774	402	741	1237;1238	1674;1675;1676	1675		2	9606
IVLDNSVFSEHR	Unmodified	1414.7205	0.72047768	336	Q00610;P53675	CLTC;CLTCL1	Clathrin heavy chain 1;Clathrin heavy chain 2	yes	no	0	0	0	1	0	1					18.298	18.298	2	0.00045563	10749	DP1141_6	136.02	89.566			0	775	336	742	1239	1677	1677		1	9606
IVLEDGTLHVTEGSGR	Unmodified	1681.8635	0.8635131	409	Q16555	DPYSL2	Dihydropyrimidinase-related protein 2	yes	yes	0	0	0	3	0			1			17.724	17.724	3	0.016272	10325	DP1141_8	68.173	35.898			41845000	776	409	743	1240	1678	1678		1	9606
IVPGQFLAVDPK	Unmodified	1282.7285	0.72852317	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	0	1	0	1					19.756	19.756	2	0.0067927	13063	DP1141_6	97.472	66.05			125370000	777	402	744	1241	1679;1680	1679		2	9606
IVQAEGEAEAAK	Unmodified	1214.6143	0.61428128	529	Q99623	PHB2	Prohibitin-2	yes	yes	0	0	0	2.5	1.5	1			1		14.28	14.28	2	3.9979999999999995E-21	4711	DP1141_9	169.76	100.16			27337000	778	529	745	1242;1243	1681;1682;1683;1684	1683		4	9606
IVQMTEAEVR	Oxidation (M)	1190.5965	0.59652272	287	P62140	PPP1CB	Serine/threonine-protein phosphatase PP1-beta catalytic subunit	yes	yes	0	1	0	4.5	0.5				1	1	14.511	14.511	2	0.0177	5183	DP1141_9	108.98	62.552			308810000	779	287	746	1244;1245	1685;1686	1686	231	2	9606
IVQQIAILMGCAILPHLR	Oxidation (M)	2061.1591	0.15910696	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	1	0	2	0		1				21.3	21.3	3	5.1974E-11	15980	DP1141_7	160.04	134.63			108090000	780	78	747	1246	1687;1688	1687	66	2	9606
IVQQIAILMGCAILPHLR	Unmodified	2045.1642	0.16419234	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	2	0		2				23.692	23.692	2;3	7.386800000000001E-193	19441	DP1141_7	225.21	208.69			42200000	781	78	747	1247;1248	1689;1690;1691	1689		3	9606
IVVNLTGR	Unmodified	870.5287	0.52870115	288	P62244	RPS15A	40S ribosomal protein S15a	yes	yes	0	0	0	5	0					1	17.337	17.337	2	0.0021157	10318	DP1141_10	173.59	76.525			364200000	782	288	748	1249	1692	1692		0	9606
IVVVTAGVR	Unmodified	912.57565	0.57565135	121	P07195	LDHB	L-lactate dehydrogenase B chain	yes	yes	0	0	0	3	1		1		1		16.581	16.581	2	0.020059	8447	DP1141_9	96.19	42.839			86566000	783	121	749	1250;1251	1693;1694	1694		1	9606
IWDPTPSHTPAGAATPGR	Unmodified	1830.9013	0.90129559	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	2.4	1.02	1	2	1	1		16.665	16.665	2;3	4.5235E-168	8696	DP1141_7	225.33	176.14			405960000	784	78	750	1252;1253;1254;1255;1256	1695;1696;1697;1698;1699;1700;1701;1702	1698		8	9606
IWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSAR	Unmodified	3545.6785	0.67845331	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	2.83	0.898		3	1	2		15.35	15.35	4;5;6	2.3974E-23	6493	DP1141_7	88.688	72.643			772550000	785	78	751	1257;1258;1259;1260;1261;1262	1703;1704;1705;1706;1707;1708;1709	1703		6	9606
IWHHTFYNELR	Unmodified	1514.7419	0.74188183	277;318	P60709;Q6S8J3;P68133;P68032;A5A3E0;Q9BYX7;P0CG38;P0CG39;P63261	ACTB;POTEE;ACTA1;ACTC1;POTEF;POTEKP;POTEI;POTEJ;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;POTE ankyrin domain family member E;Actin, alpha skeletal muscle;Actin, alpha cardiac muscle 1;POTE ankyrin domain family member F;Putative beta-actin-like protein 3;Putative beta-actin-like protein 3, N-terminally processed;POTE ankyrin domain family member I;POTE ankyrin domain family member J;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	no	no	0	0	0	4	0				1		17.688	17.688	3	0.0061088	10402	DP1141_9	88.596	57.381			27203000	786	277;318	752	1263	1710	1710		1	9606
IYAEDPSNNFMPVAGPLVHLSTPR	Oxidation (M)	2640.3006	0.30062206	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	1	0	2.5	1.12	1	1	1	1		20.113	20.113	3	3.678E-10	14226	DP1141_7	106.02	73.296			471630000	787	521	753	1264;1265;1266;1267	1711;1712;1713;1714;1715;1716;1717;1718	1713	372	8	9606
IYAEDPSNNFMPVAGPLVHLSTPR	Unmodified	2624.3057	0.30570743	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	0	2.5	1.12	1	1	1	1		21.098	21.098	3	1.0597E-07	15396	DP1141_8	132.36	117.13			158150000	788	521	753	1268;1269;1270;1271	1719;1720;1721;1722;1723	1721		5	9606
IYGFYDECK	Unmodified	1193.5063	0.50631073	286;212;287	P62140;P62136;P36873	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	no	no	0	0	0	3.5	0.5			1	1		18.706	18.706	2	9.789899999999999E-80	11980	DP1141_9	204.65	189.98			1394300000	789	287;286;212	754	1272;1273	1724;1725;1726;1727	1725		3	9606
IYGFYDECKR	Unmodified	1349.6074	0.60742176	286;212;287	P62140;P62136;P36873	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	no	no	0	0	1	4	0				1		17.387	17.387	3	0.0044697	9869	DP1141_9	140.11	118.74			370600000	790	287;286;212	755	1274	1728	1728		1	9606
IYNDDKNTYIR	Unmodified	1413.6888	0.6888432	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	2.67	0.943		2		1		15.446	15.446	2;3	4.0273999999999995E-65	6788	DP1141_7	173.39	110.81			1120200000	791	78	756	1275;1276;1277	1729;1730;1731;1732	1730		2	9606
IYNSIYIGSQDALIAHYPR	Unmodified	2193.1219	0.12185306	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	2	0		2				20.1	20.1	3	2.9166E-07	14289	DP1141_7	161.08	120.89			353370000	792	78	757	1278;1279	1733;1734;1735;1736;1737;1738	1735		6	9606
KAALDEAQGVGLDSTGYYDQEIYGGSDSR	Unmodified	3064.3898	0.38976723	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	2	0		1				19.401	19.401	3	8.711E-05	13282	DP1141_7	53.722	36.564			61022000	793	78	758	1280	1739	1739		1	9606
KAEAGAGSATEFQFR	Unmodified	1568.7583	0.75831975	238	P46783;Q9NQ39	RPS10;RPS10P5	40S ribosomal protein S10;Putative 40S ribosomal protein S10-like	yes	no	0	0	1	5	0					1	16.835	16.835	3	0.01765	9364	DP1141_10	48.899	21.929			32732000	794	238	759	1281	1740	1740		1	9606
KAEGEPQEESPLK	Unmodified	1440.7096	0.70963822	580	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	yes	yes	0	0	1	1.33	0.471	2	1				14.32	14.32	2;3	2.4786E-20	4475	DP1141_6	196.27	81.867			21224000	795	580	760	1282;1283;1284	1741;1742;1743	1742		3	9606
KAEVNTIPGFDGVVK	Unmodified	1572.8512	0.8511575	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	0	1	2	1	1		1			18.235	18.235	3	2.9985E-06	11124	DP1141_8	131.08	110.34			103680000	796	110	761	1285;1286	1744;1745	1745		1	9606
KAGNFYVPAEPK	Unmodified	1319.6874	0.68738664	167	P18124	RPL7	60S ribosomal protein L7	yes	yes	0	0	1	5	0					1	16.216	16.216	2	0.014666	8456	DP1141_10	128.51	83.491			24301000	797	167	762	1287	1746	1746		1	9606
KAGTATSPAGSSPAVAGGTQR	Unmodified	1870.9497	0.94970235	373	Q13428	TCOF1	Treacle protein	yes	yes	0	0	1	2	0		1				13.426	13.426	3	0.0015828	3834	DP1141_7	91.774	52.389			903940	798	373	763	1288	1747;1748	1748		2	9606
KAIVICPTDEDLKDR	Unmodified	1771.9138	0.91383411	540	Q9BUJ2	HNRNPUL1	Heterogeneous nuclear ribonucleoprotein U-like protein 1	yes	yes	0	0	2	2	0		1				16.165	16.165	3	0.0041243	7919	DP1141_7	110.55	80.441			19309000	799	540	764	1289	1749	1749		1	9606
KASGPPVSELITK	Unmodified	1325.7555	0.7554662	157	P16403;P10412;P16402	HIST1H1C;HIST1H1E;HIST1H1D	Histone H1.2;Histone H1.4;Histone H1.3	yes	no	0	0	1	4	0				2		16.508	16.508	2;3	0.00047004	8333	DP1141_9	132.31	88.01			192530000	800	157	765	1290;1291	1750;1751;1752	1751		3	9606
KATATISAKPQITNPK	Unmodified	1667.957	0.95701956	613	Q9Y2W2	WBP11	WW domain-binding protein 11	yes	yes	0	0	2	3	0			1			14.189	14.189	3	0.0033697	4734	DP1141_8	139.21	77.478			3470900	801	613	766	1292	1753	1753		1	9606
KAYVEANQMLGDLIK	Oxidation (M)	1707.8866	0.88655673	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	1	1	2	0		2				18.298	18.298	2;3	0.0024688	11411	DP1141_7	110.57	74.763			119650000	802	142	767	1293;1294	1754;1755;1756;1757	1756	136	4	9606
KEEGLPEEEPSHVTGR	Unmodified	1792.8592	0.85915601	162	P17098	ZNF8	Zinc finger protein 8	yes	yes	0	0	1	3	0			1			14.809	14.809	3	0.0017349	5587	DP1141_8	128.82	95.069			7015000	803	162	768	1295	1758;1759	1758		2	9606
KFEEEGNPYYSSAR	Unmodified	1675.7478	0.74781464	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	1	2.75	1.48	1	1	1		1	16.141	16.141	3	3.4688E-14	7180	DP1141_6	162.94	136.65			2253200000	804	567	769	1296;1297;1298;1299	1760;1761;1762;1763	1761		3	9606
KFGDPVVQSDMK	Oxidation (M)	1365.6599	0.65985126	135	P0DMV8;P0DMV9	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	yes	no	0	1	1	3.75	0.829			2	1	1	15.221	15.221	2;3	0.0046209	6306	DP1141_8	85.554	51.684			122100000	805	135	770	1300;1301;1302;1303	1764;1765;1766;1767;1768	1767	127	5	9606
KFLDGIYVSEK	Unmodified	1297.6918	0.69180331	203	P32969	RPL9	60S ribosomal protein L9	yes	yes	0	0	1	5	0					1	18.232	18.232	3	0.017073	11690	DP1141_10	71.085	35.562			0	806	203	771	1304	1769	1769		1	9606
KFVIHPESNNLIIIETDHNAYTEATK	Unmodified	2996.5244	0.52435064	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	1	2	0		2				18.991	18.991	3;4	0.0088144	12622	DP1141_7	45.126	24.401			84328000	807	402	772	1305;1306	1770;1771	1770		2	9606
KGHAVGDIPGVR	Unmodified	1204.6677	0.66765425	292	P62266	RPS23	40S ribosomal protein S23	yes	yes	0	0	1	3	2	1				1	14.776	14.776	3	0.001799	5872	DP1141_10	115.92	33.275			67937000	808	292	773	1307;1308	1772;1773;1774	1773		3	9606
KGMSHEPK	Acetyl (Protein N-term);Oxidation (M)	970.45422	0.45421558	391	Q14687	GSE1	Genetic suppressor element 1	yes	yes	1	1	1	2	0		1				24.792	24.792	2	0.035106	21087	DP1141_7	41.029	11.653			0	809	391	774	1309	1775	1775	301	1	9606
KGTHFVQLCCQR	Unmodified	1532.734	0.73403603	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	1	3.75	0.829			2	1	1	15.113	15.113	2;3	1.9043E-09	6122	DP1141_9	156.51	121.5			1159800000	810	567	775	1310;1311;1312;1313	1776;1777;1778;1779;1780	1780		4	9606
KHVTTAEGTPGTTDQEGPPPDGPPEKR	Unmodified	2798.3471	0.34711456	41	O14497	ARID1A	AT-rich interactive domain-containing protein 1A	yes	yes	0	0	2	2	0		1				14.062	14.062	4	0.0064142	4677	DP1141_7	44.184	30.709			5284800	811	41	776	1314	1781	1781		1	9606
KIAPYVAHNFSK	Unmodified	1373.7456	0.74557022	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	1	2	0		2				15.26	15.26	2;3	1.0771E-14	6514	DP1141_7	163.45	135.21			185050000	812	142	777	1315;1316	1782;1783;1784	1783		3	9606
KIDKYTEVLK	Unmodified	1235.7125	0.71253876	221	P40429	RPL13A	60S ribosomal protein L13a	yes	yes	0	0	2	5	0					1	15.415	15.415	3	0.0054403	7002	DP1141_10	101.3	64.231			37182000	813	221	778	1317	1785	1785		1	9606
KIGEEEIQKPEEK	Unmodified	1555.8094	0.80935227	405	Q15459	SF3A1	Splicing factor 3A subunit 1	yes	yes	0	0	2	2.5	0.5		1	1			14.082	14.082	3	1.3875000000000002E-29	4605	DP1141_8	182.37	133.18			46714000	814	405	779	1318;1319	1786;1787;1788	1787		3	9606
KIHNANPELTDGQIQAMLR	Oxidation (M)	2164.1059	0.10588542	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	1	1	0	1					16.914	16.914	4	0.00022956	8575	DP1141_6	135.55	113.12			48538000	815	367	780	1320	1789	1789	270	1	9606
KIHPQTIIAGWR	Unmodified	1418.8147	0.81465284	328	P78371	CCT2	T-complex protein 1 subunit beta	yes	yes	0	0	1	3	0			1			17.634	17.634	3	0.0039224	10239	DP1141_8	132.56	94.952			23096000	816	328	781	1321	1790	1790		0	9606
KIYPTVNCQPLGMISLMK	Oxidation (M)	2108.0832	0.083224404	98	P01042	KNG1	Kininogen-1;Kininogen-1 heavy chain;T-kinin;Bradykinin;Lysyl-bradykinin;Kininogen-1 light chain;Low molecular weight growth-promoting factor	yes	yes	0	1	1	3	0			1			15.001	15.001	3	0.031149	5949	DP1141_8	56.746	24.196			0	817	98	782	1322	1791	1791	81;82	1	9606
KKPLDGEYFTLQIR	Unmodified	1706.9356	0.93555583	104	P04637	TP53	Cellular tumor antigen p53	yes	yes	0	0	2	3.5	0.5			1	1		18.756	18.756	3	1.8164E-81	11965	DP1141_9	172.58	152.35			193560000	818	104	783	1323;1324	1792;1793;1794	1793		3	9606
KKPLFITTDSSK	Unmodified	1363.7711	0.77111627	447	Q7LBC6	KDM3B	Lysine-specific demethylase 3B	yes	yes	0	0	2	2	0		1				14.759	14.759	3	0.032332	5747	DP1141_7	85.672	49.001			5572900	819	447	784	1325	1795	1795		0	9606
KLAAAEGLEPK	Unmodified	1125.6394	0.63937381	224	Q6NXS1;P41236	PPP1R2P3;PPP1R2	Protein phosphatase inhibitor 2-like protein 3;Protein phosphatase inhibitor 2	yes	no	0	0	1	4.5	0.5				1	1	15.141	15.141	2	2.2222E-09	6494	DP1141_10	161.51	70.911			109370000	820	224	785	1326;1327	1796;1797;1798	1796		3	9606
KLASQGDSISSQLGPIHPPPR	Unmodified	2184.1651	0.16511485	500	Q92945	KHSRP	Far upstream element-binding protein 2	yes	yes	0	0	1	3	0			1			17.161	17.161	4	0.0011726	9374	DP1141_8	81.51	64.425			15493000	821	500	786	1328	1799	1799		1	9606
KLAVNMVPFPR	Oxidation (M)	1286.7169	0.71691263	122;323;381;376	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	no	no	0	1	1	3.67	0.471			1	2		17.552	17.552	2;3	0.013138	10087	DP1141_9	73.499	57.96			155840000	822	122;323;381;376	787	1329;1330;1331	1800;1801;1802;1803	1802	110	3	9606
KLFIGGLSFETTDESLR	Unmodified	1911.9942	0.99419293	130	P09651;Q32P51	HNRNPA1;HNRNPA1L2	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2	yes	no	0	0	1	4.5	0.5				1	1	20.767	20.767	3	8.7455E-145	15072	DP1141_9	197.29	169.86			34690000	823	130	788	1332;1333	1804;1805;1806	1805		3	9606
KLFIGGLSFETTEESLR	Unmodified	1926.0098	0.0098429899	179	P22626	HNRNPA2B1	Heterogeneous nuclear ribonucleoproteins A2/B1	yes	yes	0	0	1	4	0				1		20.887	20.887	3	8.537799999999999E-88	15273	DP1141_9	156.29	99.495			11927000	824	179	789	1334	1807;1808	1808		2	9606
KLFVGGIKEDTEEHHLR	Unmodified	2007.0538	0.05377349	179	P22626	HNRNPA2B1	Heterogeneous nuclear ribonucleoproteins A2/B1	yes	yes	0	0	2	4	0				3		15.728	15.728	3;4;5	1.3598E-10	6911	DP1141_9	160.93	0			133920000	825	179	790	1335;1336;1337	1809;1810;1811;1812;1813;1814	1813		6	9606
KLGPTEGRPQLK	Unmodified	1322.767	0.76703394	52	O15235	MRPS12	28S ribosomal protein S12, mitochondrial	yes	yes	0	0	2	5	0					1	14.056	14.056	3	0.010919	4957	DP1141_10	86.463	52.593			3755500	826	52	791	1338	1815	1815		1	9606
KLGVQTVAVYSEADR	Unmodified	1634.8628	0.86278482	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	1	3.2	1.33	1		2	1	1	17.237	17.237	2;3	0	9648	DP1141_8	277.11	206.71			475020000	827	521	792	1339;1340;1341;1342;1343	1816;1817;1818;1819;1820	1819		5	9606
KLHYNEGLNIK	Unmodified	1327.7248	0.72483478	224	Q6NXS1;P41236	PPP1R2P3;PPP1R2	Protein phosphatase inhibitor 2-like protein 3;Protein phosphatase inhibitor 2	yes	no	0	0	1	4.5	0.5				1	1	15.642	15.642	3	2.2834E-30	7382	DP1141_10	150.46	118.24			94873000	828	224	793	1344;1345	1821;1822	1821		1	9606
KLIYFQLHR	Unmodified	1216.7081	0.7080625	372	Q13263	TRIM28	Transcription intermediary factor 1-beta	yes	yes	0	0	1	2	0		1				17.751	17.751	3	5.7549E-10	10506	DP1141_7	144.09	48.179			0	829	372	794	1346	1823	1823		1	9606
KLSSWDQAETPGHTPSLR	Unmodified	2008.9967	0.99665254	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	2.5	1.26	2	1	1	2		16.847	16.847	3;4	0.00011333	9098	DP1141_7	106.31	79.363			269550000	830	78	795	1347;1348;1349;1350;1351;1352	1824;1825;1826;1827;1828;1829;1830	1826		6	9606
KLTATPTPLGGMTGFHMQTEDR	Oxidation (M)	2404.1515	0.15151498	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	1	1	2.5	0.5		2	2			17.559	17.559	3;4	1.6842E-23	10328	DP1141_7	162.39	146.09			114240000	831	78	796	1353;1354;1355;1356	1831;1832;1833;1834;1835;1836	1834	67;68	5	9606
KLTATPTPLGGMTGFHMQTEDR	Unmodified	2388.1566	0.15660036	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	2	0		1				18.6	18.6	4	0.00139	11797	DP1141_7	74.324	52.46			43399000	832	78	796	1357	1837	1837		1	9606
KNHEEEMLALR	Oxidation (M)	1384.6769	0.67689831	16	CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8	KRT16	Keratin, type I cytoskeletal 16	yes	no	0	1	1	4	0				1		14.514	14.514	3	0.0021459	5051	DP1141_9	91.701	56.037		+	19201000	833	16	797	1358	1838	1838	13	0	9606
KNMLAFLLTWEK	Oxidation (M)	1508.8061	0.80612157	454	Q86T75	NBPF11	Neuroblastoma breakpoint family member 11	yes	yes	0	1	1	5	0					1	18.407	18.407	3	0.033883	11971	DP1141_10	56.404	13			0	834	454	798	1359	1839	1839	337	1	9606
KNPASLPLTQAALK	Unmodified	1450.8508	0.85076357	373	Q13428	TCOF1	Treacle protein	yes	yes	0	0	1	2	0		1				17.199	17.199	3	0.022046	9481	DP1141_7	53.038	16.085			21395000	835	373	799	1360	1840	1840		1	9606
KPALFPEPAK	Unmodified	1096.6281	0.62808085	514	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	yes	yes	0	0	1	2	0		1				16.064	16.064	2	5.8575E-12	7741	DP1141_7	176.38	138.65			51306000	836	514	800	1361	1841	1841		0	9606
KPGDLSDELR	Unmodified	1128.5775	0.57750184	374	Q13435	SF3B2	Splicing factor 3B subunit 2	yes	yes	0	0	1	3	0			1			15.926	15.926	2	0.0023753	7468	DP1141_8	102.06	67.809			14915000	837	374	801	1362	1842	1842		0	9606
KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK	Unmodified	3514.7634	0.76335213	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	2	3.3	1.1		3	3	2	2	19.594	19.594	4;5;6	3.0367E-103	13431	DP1141_7	201.29	186.25			1085500000	838	78	802	1363;1364;1365;1366;1367;1368;1369;1370;1371;1372	1843;1844;1845;1846;1847;1848;1849;1850;1851;1852;1853;1854;1855;1856;1857;1858;1859;1860;1861	1846		19	9606
KPHIYYGSLEEKER	Unmodified	1747.8893	0.88933392	56	O43172	PRPF4	U4/U6 small nuclear ribonucleoprotein Prp4	yes	yes	0	0	2	3	0			1			15.221	15.221	4	0.0094297	6441	DP1141_8	77.192	50.411			32820000	839	56	803	1373	1862;1863	1863		2	9606
KPLPDHVSIVEPK	Unmodified	1457.8242	0.82421447	182	P23396	RPS3	40S ribosomal protein S3	yes	yes	0	0	1	5	0					1	15.826	15.826	3	0.0025946	8036	DP1141_10	118.76	84.708			42000000	840	182	804	1374	1864;1865	1865		2	9606
KPLPDHVSIVEPKDEILPTTPISEQK	Unmodified	2909.575	0.57498923	182	P23396	RPS3	40S ribosomal protein S3	yes	yes	0	0	2	5	0					2	18.237	18.237	3;4	8.0657E-23	11763	DP1141_10	155.11	136.01			111140000	841	182	805	1375;1376	1866;1867;1868;1869	1866		4	9606
KPPPAPQQPPPPPAPHPQQHPQQHPQNQAHGK	Unmodified	3492.7664	0.76642087	351	Q07065	CKAP4	Cytoskeleton-associated protein 4	yes	yes	0	0	1	3	0			2			13.922	13.922	5;7	0.00032683	4328	DP1141_8	42.275	31.107			24791000	842	351	806	1377;1378	1870;1871;1872;1873;1874	1873		5	9606
KPSPSESPEPWKPFPAVSPEPR	Unmodified	2445.2329	0.23286007	514	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	yes	yes	0	0	2	2	0		1				18.128	18.128	4	0.0097197	11275	DP1141_7	53.718	26.195			20914000	843	514	807	1379	1875	1875		1	9606
KPSVSEEVQATPNK	Unmodified	1512.7784	0.77838649	597	Q9UKJ3	GPATCH8	G patch domain-containing protein 8	yes	yes	0	0	1	1	0	1					14.097	14.097	3	0.014635	4183	DP1141_6	73.415	46.703			1674100	844	597	808	1380	1876	1876		1	9606
KQGTIFLAGPPLVK	Unmodified	1467.8813	0.88133542	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	1	3	1.41	2		2	2	1	18.867	18.867	2;3	2.6574E-29	12229	DP1141_8	180.24	165.55			679880000	845	567	809	1381;1382;1383;1384;1385;1386;1387	1877;1878;1879;1880;1881;1882;1883;1884;1885;1886;1887;1888;1889	1883		13	9606
KQMELPGQVEELLIFR	Oxidation (M)	1945.0343	0.034283601	626				yes	yes	0	1	1	3	0			2			14.822	14.822	4	0.035947	5703	DP1141_8	52.008	16.282	+		1398900000	846	626	810	1388;1389	1890;1891	1890	430	1	9606
KQMVIDVLHPGK	Oxidation (M)	1379.7595	0.75950572	307	P62847	RPS24	40S ribosomal protein S24	yes	yes	0	1	1	5	0					2	15.913	15.913	3	0.0030506	7865	DP1141_10	100.02	66.261			0	847	307	811	1390;1391	1892;1893	1893	241	2	9606
KQQISLATQMVR	Oxidation (M)	1417.7711	0.77113304	244	P48643	CCT5	T-complex protein 1 subunit epsilon	yes	yes	0	1	1	3	0			1			15.29	15.29	3	0.032788	6386	DP1141_8	58.098	25.368			0	848	244	812	1392	1894	1894	195	1	9606
KQVVNIPSFIVR	Unmodified	1398.8347	0.83471958	236	P46781	RPS9	40S ribosomal protein S9	yes	yes	0	0	1	5	0					1	19.327	19.327	3	0.0038886	13514	DP1141_10	91.961	83.857			56936000	849	236	813	1393	1895	1895		1	9606
KREELSNVLAAMR	Oxidation (M)	1531.8141	0.81406049	618	Q9Y3U8	RPL36	60S ribosomal protein L36	yes	yes	0	1	2	5	0					1	16.016	16.016	3	0.0083626	7947	DP1141_10	74.392	31.967			18025000	850	618	814	1394	1896	1896	426	0	9606
KRVEGPGSLGLEESGSR	Unmodified	1756.9068	0.9067749	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	2	3.33	1.25	1	1	3	2	2	15.424	15.424	2;3;4	0	6683	DP1141_8	297.45	258.43			1580199999.9999998	851	365	815	1395;1396;1397;1398;1399;1400;1401;1402;1403	1897;1898;1899;1900;1901;1902;1903;1904;1905;1906;1907;1908;1909;1910;1911;1912;1913;1914	1909		17	9606
KSAEFLLHMLK	Oxidation (M)	1331.7271	0.72714296	169	P18621	RPL17	60S ribosomal protein L17	yes	yes	0	1	1	5	0					1	17.037	17.037	3	0.0017905	9817	DP1141_10	111.27	82.203			43981000	852	169	816	1404	1915	1915	154	1	9606
KSGVSDHWALDDHHALHLTR	Unmodified	2294.1305	0.13046068	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	1	3.12	0.781		2	3	3		16.609	16.609	3;4;5	1.3476E-27	8564	DP1141_8	172.5	150.96			1830899999.9999998	853	567	817	1405;1406;1407;1408;1409;1410;1411;1412	1916;1917;1918;1919;1920;1921;1922;1923;1924;1925;1926;1927;1928;1929;1930	1920		15	9606
KTEELEEESFPER	Unmodified	1621.7471	0.74714594	612	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	yes	yes	0	0	1	2.33	0.745	1	2	3			16.453	16.453	2;3	0	8281	DP1141_7	276.95	240.42			204560000	854	612	818	1413;1414;1415;1416;1417;1418	1931;1932;1933;1934;1935;1936;1937;1938;1939;1940	1932		10	9606
KTHQPSDEVGTSIEHPR	Unmodified	1916.9341	0.93405228	528	Q99575	POP1	Ribonucleases P/MRP protein subunit POP1	yes	yes	0	0	1	1.5	0.5	1	1				14.124	14.124	4	0.002246	4289	DP1141_6	132.25	112.5			29604000	855	528	819	1419;1420	1941;1942	1941		1	9606
KTKPYIQVDIGGGQTK	Unmodified	1731.9519	0.95193418	139	P11021	HSPA5	78 kDa glucose-regulated protein	yes	yes	0	0	2	3	0			1			16.026	16.026	3	0.027884	7491	DP1141_8	66.289	44.936			8228300	856	139	820	1421	1943	1943		1	9606
KTTHFVEGGDAGNREDQINR	Unmodified	2243.0679	0.067920004	167	P18124	RPL7	60S ribosomal protein L7	yes	yes	0	0	2	5	0					2	14.289	14.289	3;4	0.0062482	5249	DP1141_10	71.929	52.995			74464000	857	167	821	1422;1423	1944;1945	1944		2	9606
KTVTAMDVVYALK	Oxidation (M)	1453.7851	0.78505177	303	P62805	HIST1H4A	Histone H4	yes	yes	0	1	1	5	0					1	18.419	18.419	3	0.001665	12050	DP1141_10	110.15	88.755			35166000	858	303	822	1424	1946	1946	237	1	9606
KTVTAMDVVYALKR	Oxidation (M)	1609.8862	0.8861628	303	P62805	HIST1H4A	Histone H4	yes	yes	0	1	2	5	0					1	17.813	17.813	3	0.0020719	11059	DP1141_10	130.66	90.285			39121000	859	303	823	1425	1947	1947	237	1	9606
KVEEEEDESALKR	Unmodified	1560.7631	0.76313036	387	Q14566	MCM6	DNA replication licensing factor MCM6	yes	yes	0	0	2	2	0		1				13.788	13.788	3	0.0053113	4080	DP1141_7	75.669	52.661			9116900	860	387	824	1426	1948	1948		1	9606
KVEWTSDTVDNEHMGR	Oxidation (M)	1918.8479	0.84793939	67	O60927	PPP1R11	Protein phosphatase 1 regulatory subunit 11	yes	yes	0	1	1	5	0					1	15.24	15.24	3	0.033422	6620	DP1141_10	49.463	27.797			14022000	861	67	825	1427	1949	1949	54	1	9606
KVNNADDFPNLFR	Unmodified	1548.7685	0.76849051	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	1	0	1					19.355	19.355	3	9.679E-89	12446	DP1141_6	218.75	174.45			602090000	862	367	826	1428	1950	1950		0	9606
KVPAESMPTLTPAFPR	Oxidation (M)	1756.9182	0.91819121	447	Q7LBC6	KDM3B	Lysine-specific demethylase 3B	yes	yes	0	1	1	2	0		1				17.699	17.699	3	0.019052	10319	DP1141_7	55.885	36.723			11971000	863	447	827	1429	1951	1951	333	0	9606
KVPQVSTPTLVEVSR	Unmodified	1638.9305	0.93047046	15;14	CON__P02769;CON__P02768-1;P02768	ALB	Serum albumin	no	no	0	0	1	3.25	1.48	1		1	1	1	17.622	17.622	3	8.089700000000001E-130	10731	DP1141_10	187.08	164.17		+	126500000	864	15;14	828	1430;1431;1432;1433	1952;1953;1954;1955;1956	1952		4	9606
KVTQLDLDGPK	Unmodified	1212.6714	0.67140222	375	Q13442	PDAP1	28 kDa heat- and acid-stable phosphoprotein	yes	yes	0	0	1	5	0					1	15.869	15.869	2	0.021442	7802	DP1141_10	169.99	74.252			5582300	865	375	829	1434	1957	1957		1	9606
KVVNPLFEK	Unmodified	1072.6281	0.62808085	300	P62424	RPL7A	60S ribosomal protein L7a	yes	yes	0	0	1	4	0				1		16.638	16.638	2	0.0017801	8551	DP1141_9	145.72	88.442			22821000	866	300	830	1435	1958	1958		1	9606
KYYLFGR	Unmodified	945.50724	0.50723743	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	1	3	0			2			17.917	17.917	2	0.0089122	10681	DP1141_8	119.22	42.375			0	867	365	831	1436;1437	1959;1960	1960		2	9606
LAAAEGLEPK	Unmodified	997.54441	0.5444108	224	Q6NXS1;P41236	PPP1R2P3;PPP1R2	Protein phosphatase inhibitor 2-like protein 3;Protein phosphatase inhibitor 2	yes	no	0	0	0	5	0					1	16.016	16.016	2	0.0059232	8058	DP1141_10	101.64	49.789			43722000	868	224	832	1438	1961	1961		1	9606
LAADDFR	Unmodified	806.39227	0.39226725	17;16;9;21;26	CON__P13645;P13645;CON__P02535-1;Q7Z3Y7;CON__Q148H6;CON__Q7Z3Y7;CON__P19001;CON__P08727;P08727;O76013;CON__REFSEQ:XP_986630;CON__Q15323;CON__Q14532;CON__A2A5Y0;CON__O76015;CON__A2AB72;Q2M2I5;CON__Q14525;CON__O76014;Q14525;P05783;CON__Q2M2I5;CON__O76013;O76014;Q15323;CON__Q9UE12;Q92764;Q14532;O76015;CON__P05784;CON__Q92764;CON__P02533;P02533;CON__Q6IFX2;CON__P19012;CON__A2A4G1;P19012;CON__Q04695;Q04695;CON__Q9QWL7;CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8;CON__Q497I4	KRT10;KRT28;KRT19;KRT36;KRT24;KRT33B;KRT18;KRT37;KRT31;KRT35;KRT32;KRT38;KRT14;KRT15;KRT17;KRT16	Keratin, type I cytoskeletal 10;Keratin, type I cytoskeletal 28;Keratin, type I cytoskeletal 19;Keratin, type I cuticular Ha6;Keratin, type I cytoskeletal 24;Keratin, type I cuticular Ha3-II;Keratin, type I cytoskeletal 18;Keratin, type I cuticular Ha7;Keratin, type I cuticular Ha1;Keratin, type I cuticular Ha5;Keratin, type I cuticular Ha2;Keratin, type I cuticular Ha8;Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 15;Keratin, type I cytoskeletal 17;Keratin, type I cytoskeletal 16	no	no	0	0	0	2.5	0.5		1	1			16.446	16.446	2	8.4121E-10	8189	DP1141_8	148.28	79.189		+	422290000	869	17;9;21;16;26	833	1439;1440	1962;1963	1963		2	9606
LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	Unmodified	4245.5433	0.5432839	120	P06748	NPM1	Nucleophosmin	yes	yes	0	0	2	4	0				1		16.985	16.985	4	2.0247999999999999E-22	9154	DP1141_9	83.705	79.173			14780000	870	120	834	1441	1964	1964		1	9606
LAASIAPEIYGHEDVKK	Unmodified	1839.9731	0.97306355	205	P33993	MCM7	DNA replication licensing factor MCM7	yes	yes	0	0	1	3	0			1			16.923	16.923	3	0.013218	8987	DP1141_8	68.944	45.765			38956000	871	205	835	1442	1965	1965		0	9606
LAAVQLLQFLAPK	Unmodified	1410.8599	0.8598717	577	Q9NXF1	TEX10	Testis-expressed sequence 10 protein	yes	yes	0	0	0	2	0		1				24.042	24.042	2	7.3989E-21	20025	DP1141_7	196.88	168.48			6414700	872	577	836	1443	1966;1967	1966		2	9606
LADDLSTLQEK	Unmodified	1231.6296	0.62959699	396	Q14980	NUMA1	Nuclear mitotic apparatus protein 1	yes	yes	0	0	0	2	0		1				17.4	17.4	2	0.013885	10115	DP1141_7	87.149	20.187			39198000	873	396	837	1444	1968	1968		1	9606
LAELEEALQK	Unmodified	1142.6183	0.61830402	18	CON__P13647;P13647	KRT5	Keratin, type II cytoskeletal 5	yes	no	0	0	0	4.5	0.5				1	1	18.237	18.237	2	0.0080587	11248	DP1141_9	128.38	63.131		+	25062000	874	18	838	1445;1446	1969;1970	1970		2	9606
LAFEVAEK	Unmodified	905.48583	0.48583328	470	Q8N3F8	MICALL1	MICAL-like protein 1	yes	yes	0	0	0	2	0		1				17.499	17.499	2	0.0040567	10110	DP1141_7	108.09	49.272			3724500	875	470	839	1447	1971	1971		0	9606
LAPAQYIR	Unmodified	930.5287	0.52870115	377	Q13573	SNW1	SNW domain-containing protein 1	yes	yes	0	0	0	4	0				1		16.904	16.904	2	0.0076831	8982	DP1141_9	107.74	59.896			22541000	876	377	840	1448	1972	1972		1	9606
LAPVPSPEPQKPAPVSPESVK	Unmodified	2153.1732	0.17321992	514	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	yes	yes	0	0	1	2	0		1				16.687	16.687	3	2.0329E-05	8769	DP1141_7	121.77	104.75			0	877	514	841	1449	1973	1973		1	9606
LASSMGK	Oxidation (M)	708.34763	0.34762524	69	O75064	DENND4B	DENN domain-containing protein 4B	yes	yes	0	1	0	4	0				1		17.688	17.688	1	0.034345	10121	DP1141_9	46.351	21.353			15913000	878	69	842	1450	1974	1974	55	1	9606
LASVLVSDWMAVIR	Oxidation (M)	1574.849	0.84904901	520	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	yes	yes	0	1	0	2	0		1				22.622	22.622	2	4.7310000000000006E-30	17962	DP1141_7	182.28	120.52			12350000	879	520	843	1451	1975;1976	1975	366	2	9606
LASYLDKVR	Unmodified	1063.6026	0.60259438	17;16;9;21	CON__P13645;P13645;CON__P19001;CON__P08727;P08727;Q99456;CON__Q99456;CON__P02533;P02533;CON__P19012;CON__A2A4G1;P19012;CON__Q04695;Q04695;CON__Q9QWL7;CON__P08779;P08779	KRT10;KRT19;KRT12;KRT14;KRT15;KRT17;KRT16	Keratin, type I cytoskeletal 10;Keratin, type I cytoskeletal 19;Keratin, type I cytoskeletal 12;Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 15;Keratin, type I cytoskeletal 17;Keratin, type I cytoskeletal 16	no	no	0	0	1	2.5	1.5	1			1		16.322	16.322	2	0.00020399	7598	DP1141_6	153.04	107.08		+	38430000	880	17;9;21;16	844	1452;1453	1977;1978	1977		1	9606
LATQLTGPVMPVR	Oxidation (M)	1397.7701	0.77007041	188	P26373	RPL13	60S ribosomal protein L13	yes	yes	0	1	0	5	0					1	17.538	17.538	2	0.02617	10669	DP1141_10	73.841	31.243			34540000	881	188	845	1454	1979	1979	164	0	9606
LAVNMVPFPR	Oxidation (M)	1158.6219	0.62194961	122;323;381;376	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	no	no	0	1	0	3	1.41	1	1	1	1	1	18.817	18.817	2	1.6879E-10	12086	DP1141_8	148.04	93.432			323540000	882	122;323;381;376	846	1455;1456;1457;1458;1459	1980;1981;1982;1983;1984;1985	1984	110	5	9606
LAVNMVPFPR	Unmodified	1142.627	0.62703499	122;323;381;376	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1;Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3;TUBB1	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-1 chain	no	no	0	0	0	3	0			1			20.126	20.126	2	7.968E-05	14086	DP1141_8	148.04	148.04			241560000	883	122;323;381;376	846	1460	1986	1986		1	9606
LDDLVRPYVHK	Unmodified	1353.7405	0.74048484	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	2	0		3				16.41	16.41	2	0.0012099	8306	DP1141_7	118.03	70.806			0	884	78	847	1461;1462;1463	1987;1988;1989	1988		3	9606
LDECEEAFQGTK	Unmodified	1425.6082	0.60820962	281	P61289	PSME3	Proteasome activator complex subunit 3	yes	yes	0	0	0	4	0				1		16.614	16.614	2	1.3866E-09	8462	DP1141_9	155.53	117.84			4895700	885	281	848	1464	1990	1990		0	9606
LDHKFDLMYAK	Unmodified	1379.6908	0.69075746	321;442;322	P68363;A6NHL2;P68366;Q71U36;P0DPH8;P0DPH7	TUBA1B;TUBAL3;TUBA4A;TUBA1A	Tubulin alpha-1B chain;Tubulin alpha chain-like 3;Tubulin alpha-4A chain;Tubulin alpha-1A chain	no	no	0	0	1	3	0			1			17.424	17.424	3	7.2256E-05	9903	DP1141_8	150.06	114.38			68722000	886	321;322;442	849	1465	1991	1991		0	9606
LDHKFDLMYAK	Oxidation (M)	1395.6857	0.68567208	321;442;322	P68363;A6NHL2;P68366;Q71U36;P0DPH8;P0DPH7	TUBA1B;TUBAL3;TUBA4A;TUBA1A	Tubulin alpha-1B chain;Tubulin alpha chain-like 3;Tubulin alpha-4A chain;Tubulin alpha-1A chain	no	no	0	1	1	4	0				1		16.508	16.508	3	0.0064773	8343	DP1141_9	110.93	75.28			53788000	887	321;322;442	849	1466	1992	1992	247	1	9606
LDKIMNMKETTK	Oxidation (M)	1466.7473	0.74728606	406	Q15542	TAF5	Transcription initiation factor TFIID subunit 5	yes	yes	0	1	2	1	0	1					14.758	14.758	3	0.0067799	5082	DP1141_6	102.53	41.051			2567800	888	406	850	1467	1993	1993	312	1	9606
LDLDLTADSQPPVFK	Unmodified	1657.8563	0.85630246	372	Q13263	TRIM28	Transcription intermediary factor 1-beta	yes	yes	0	0	0	2	0		1				20.901	20.901	2	0.017851	15514	DP1141_7	78.653	62.732			97843000	889	372	851	1468	1994	1994		1	9606
LDLLEEK	Unmodified	858.46985	0.46984887	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1.5	0.5	1	1				18.028	18.028	2	2.3105E-18	10456	DP1141_6	168.74	0			482690000	890	367	852	1469;1470	1995;1996	1995		2	9606
LDNASAFQGAVISPHYDSLLVK	Unmodified	2344.2063	0.20631097	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2	0.816	1	1	1			20.422	20.422	3	1.1551E-69	14487	DP1141_8	192.18	171.59			1526699999.9999998	891	142	853	1471;1472;1473	1997;1998;1999;2000;2001;2002	2001		6	9606
LDPETLESLGLIK	Unmodified	1426.7919	0.79191129	478	Q8NI27	THOC2	THO complex subunit 2	yes	yes	0	0	0	2	0		1				21.948	21.948	2	0.0008167	17018	DP1141_7	133.75	79.03			4422500	892	478	854	1474	2003	2003		1	9606
LDSELKNMQDMVEDYR	2 Oxidation (M)	2016.8769	0.87685626	102	P04264;CON__P04264	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	2	1	1	0	1					16.68	16.68	3	0.012215	8204	DP1141_6	66.674	45.427		+	20759000	893	102	855	1475	2004;2005	2004	84;85	2	9606
LELAQYR	Unmodified	891.48142	0.48141661	187	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	yes	yes	0	0	0	3	0			1			17.194	17.194	2	0.0049849	9500	DP1141_8	118.06	33.698			0	894	187	856	1476	2006	2006		1	9606
LELDDPSK	Unmodified	915.45493	0.45492709	40	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	yes	yes	0	0	0	1	0	1					16.055	16.055	2	0.018049	7189	DP1141_6	96.492	39.389			15283000	895	40	857	1477	2007	2007		1	9606
LELQGPR	Unmodified	811.4552	0.45520186	171	P19338	NCL	Nucleolin	yes	yes	0	0	0	3	0			1			15.826	15.826	2	0.0010528	7238	DP1141_8	118.06	42.746			16226000	896	171	858	1478	2008	2008		1	9606
LENEIQTYR	Unmodified	1164.5775	0.57750184	17	CON__P13645;P13645;CON__P02535-1	KRT10	Keratin, type I cytoskeletal 10	yes	no	0	0	0	3	2	1				1	16.383	16.383	2	2.4831E-175	8635	DP1141_10	240.53	153.7		+	42045000	897	17	859	1479;1480	2009;2010;2011	2009		3	9606
LENPKMSLENDK	Oxidation (M)	1432.6868	0.68679429	450	Q7Z478	DHX29	ATP-dependent RNA helicase DHX29	yes	yes	0	1	1	1	0	1					14.758	14.758	3	0.025944	4895	DP1141_6	68.786	34.285			2807500	898	450	860	1481	2012	2012	335	0	9606
LEPHKPQQIPIDSTVSFGASTR	Unmodified	2407.2496	0.24957276	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	1	3.4	1.2	1	1	3	3	2	19.582	19.582	2;3;4	2.9631E-160	10253	DP1141_9	228.11	199.15			4834400000	899	365	861	1482;1483;1484;1485;1486;1487;1488;1489;1490;1491	2013;2014;2015;2016;2017;2018;2019;2020;2021;2022;2023;2024;2025;2026;2027;2028;2029;2030;2031	2026		19	9606
LEQGQAIDDLMPAQK	Unmodified	1655.8189	0.8188711	145	P12277	CKB	Creatine kinase B-type	yes	yes	0	0	0	1	0	1					18.955	18.955	2	2.2776E-09	11871	DP1141_6	160.56	99.919			4676500	900	145	862	1492	2032	2032		1	9606
LEYYENAR	Unmodified	1056.4876	0.4876242	44	O14654	IRS4	Insulin receptor substrate 4	yes	yes	0	0	0	1	0	1					15.993	15.993	2	0.01781	6953	DP1141_6	111.65	81.036			0	901	44	863	1493	2033	2033		1	9606
LFIGGLSFETTDESLR	Unmodified	1783.8992	0.89922991	130	P09651;Q32P51	HNRNPA1;HNRNPA1L2	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed;Heterogeneous nuclear ribonucleoprotein A1-like 2	yes	no	0	0	0	4	0				1		22.251	22.251	2	4.1922999999999998E-22	17173	DP1141_9	173.72	142.85			56459000	902	130	864	1494	2034;2035;2036	2034		3	9606
LFLQGPK	Unmodified	801.47487	0.47487467	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2	0		1				17.499	17.499	2	0.0059269	10209	DP1141_7	109.88	61.639			384210000	903	142	865	1495	2037;2038	2037		2	9606
LFPLIQAMHPTLAGK	Oxidation (M)	1651.912	0.91198362	143	Q9H361;P11940	PABPC3;PABPC1	Polyadenylate-binding protein 3;Polyadenylate-binding protein 1	yes	no	0	1	0	3	0			1			19.206	19.206	3	0.0051772	12765	DP1141_8	78.985	52.627			12712000	904	143	866	1496	2039	2039	147	1	9606
LFVGGIKEDTEEHHLR	Unmodified	1878.9588	0.95881047	179	P22626	HNRNPA2B1	Heterogeneous nuclear ribonucleoproteins A2/B1	yes	yes	0	0	1	4.33	0.471				2	1	16.211	16.211	3;4	0.0040858	7920	DP1141_9	101.62	0			476410000	905	179	867	1497;1498;1499	2040;2041;2042;2043	2043		4	9606
LFVGNLPPDITEEEMR	Unmodified	1858.9135	0.91349976	401	Q15233	NONO	Non-POU domain-containing octamer-binding protein	yes	yes	0	0	0	3	0			1			20.928	20.928	2	0.014053	15316	DP1141_8	88.101	62.906			14988000	906	401	868	1500	2044	2044		0	9606
LFWEWGDGIR	Unmodified	1277.6193	0.61930707	468	Q8N1G2	CMTR1	Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1	yes	yes	0	0	0	2	0		1				22.703	22.703	2	0.0041941	18148	DP1141_7	111.17	60.108			5794500	907	468	869	1501	2045	2045		1	9606
LGASNSPGQPNSVK	Unmodified	1354.6841	0.68409218	251	P49756	RBM25	RNA-binding protein 25	yes	yes	0	0	0	3	1		1		1		14.082	14.082	2	4.8722999999999995E-21	4652	DP1141_7	169.82	136.56			22391000	908	251	870	1502;1503	2046;2047	2046		2	9606
LGAVFNQVAFPLQYTPR	Unmodified	1920.0258	0.025767826	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	0	1	0	1					22.214	22.214	2	1.0038E-167	16802	DP1141_6	237.07	237.07			15261000	909	402	871	1504	2048;2049;2050	2048		3	9606
LGEHNIDVLEGNEQFINAAK	Unmodified	2210.0968	0.096760517	8	CON__P00761			yes	yes	0	0	0	3	2	1				1	19.591	19.591	3	4.6301000000000003E-63	12869	DP1141_6	192.22	152.64		+	131510000	910	8	872	1505;1506	2051;2052;2053	2052		3	
LGGIPVGVVAVETR	Unmodified	1365.798	0.79799972	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					19.756	19.756	2	0.0071409	13043	DP1141_6	114.86	71.555			0	911	367	873	1507	2054	2054		1	9606
LGTPELSTAER	Unmodified	1172.6037	0.60371659	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	3.25	1.48	1		1	1	1	16.521	16.521	2	1.0486E-21	7740	DP1141_6	173.39	133.75			649280000	912	367	874	1508;1509;1510;1511	2055;2056;2057;2058;2059;2060;2061	2057		6	9606
LGTPELSTAERK	Unmodified	1300.6987	0.69867961	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	2	1	1		1			15.29	15.29	3	0.0032015	5695	DP1141_6	98.182	63.65			33449000	913	367	875	1512;1513	2062;2063	2062		2	9606
LGVQTVAVYSEADR	Unmodified	1506.7678	0.7678218	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	0	2	1	1		1			18.39	18.39	2	2.9516E-53	10928	DP1141_6	247.96	194.46			51435000	914	521	876	1514;1515	2064;2065;2066	2064		2	9606
LHFFMPGFAPLTSR	Oxidation (M)	1635.8232	0.82316861	122;323;381	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	no	no	0	1	0	3.75	0.829			2	1	1	20.542	20.542	2;3	0.00032971	14773	DP1141_8	142.91	76.905			444480000	915	122;323;381	877	1516;1517;1518;1519	2067;2068;2069;2070;2071	2068	111	5	9606
LHFFMPGFAPLTSR	Unmodified	1619.8283	0.82825399	122;323;381	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	no	no	0	0	0	3	0			2			21.829	21.829	2;3	0.0017592	16685	DP1141_8	113.24	83.259			147050000	916	122;323;381	877	1520;1521	2072;2073;2074	2073		3	9606
LHLIYLINDVLHHCQR	Unmodified	2043.0836	0.083633831	463	Q8IWX8	CHERP	Calcium homeostasis endoplasmic reticulum protein	yes	yes	0	0	0	2	0		1				22.041	22.041	3	0.001445	17152	DP1141_7	136.83	112.42			6586900	917	463	878	1522	2075;2076;2077	2076		3	9606
LIANNTTVER	Unmodified	1129.6091	0.60913632	96	O96019	ACTL6A	Actin-like protein 6A	yes	yes	0	0	0	4	0				1		14.84	14.84	2	0.022512	5629	DP1141_9	99.802	58.773			2275300	918	96	879	1523	2078	2078		0	9606
LIEQAFR	Unmodified	875.4865	0.48650199	339	Q01167	FOXK2	Forkhead box protein K2	yes	yes	0	0	0	3.5	0.5			1	1		17.123	17.123	2	0.012459	9242	DP1141_9	110.54	39.158			21763000	919	339	880	1524;1525	2079;2080	2080		2	9606
LIETYFSK	Unmodified	999.5277	0.5276981	276	P60201	PLP1	Myelin proteolipid protein	yes	yes	0	0	0	3	2	1				1	18.434	18.434	2	0.017807	11046	DP1141_6	96.19	59.097			43434000	920	276	881	1526;1527	2081;2082	2082		2	9606
LIEVDDER	Unmodified	987.48729	0.48728985	302	P62753	RPS6	40S ribosomal protein S6	yes	yes	0	0	0	5	0					1	16.016	16.016	2	0.020301	8182	DP1141_10	88.942	30.338			153560000	921	302	882	1528	2083	2083		1	9606
LIGEYGLR	Unmodified	919.51272	0.51271674	236	P46781	RPS9	40S ribosomal protein S9	yes	yes	0	0	0	5	0					1	18.037	18.037	2	1.7474E-14	11366	DP1141_10	167.25	78.626			317710000	922	236	883	1529	2084	2084		1	9606
LIIDDLSMDK	Unmodified	1161.5951	0.59512574	627				yes	no	0	0	0	2.67	1.7	1	1			1	16.827	16.827	2	0.0095881	9322	DP1141_10	98.418	65.808	+		1377200000	923	627	884	1530;1531;1532	2085;2086;2087;2088	2085		4	9606
LIIVEGCQR	Unmodified	1086.5856	0.5855641	147;106	P05023;P13637;P50993;Q13733;P54707	ATP1A1;ATP1A3;ATP1A2;ATP1A4;ATP12A	Sodium/potassium-transporting ATPase subunit alpha-1;Sodium/potassium-transporting ATPase subunit alpha-3;Sodium/potassium-transporting ATPase subunit alpha-2;Sodium/potassium-transporting ATPase subunit alpha-4;Potassium-transporting ATPase alpha chain 2	no	no	0	0	0	1	0	1					16.956	16.956	2	0.002407	8643	DP1141_6	116.88	61.208			29877000	924	106;147	885	1533	2089	2089		0	9606
LILIESR	Unmodified	842.52255	0.52255314	294	P62277	RPS13	40S ribosomal protein S13	yes	yes	0	0	0	5	0					1	18.037	18.037	2	4.642799999999999E-19	11437	DP1141_10	198.32	83.728			61751000	925	294	886	1534	2090	2090		0	9606
LILISTNGSFIR	Unmodified	1332.7765	0.776536	436	Q6UXN9	WDR82	WD repeat-containing protein 82	yes	yes	0	0	0	4	0				1		20.787	20.787	2	0.012174	15145	DP1141_9	138.08	64.831			15384000	926	436	887	1535	2091	2091		0	9606
LIPFLEK	Unmodified	858.52149	0.52149051	347	Q05D32	CTDSPL2	CTD small phosphatase-like protein 2	yes	yes	0	0	0	1	0	1					18.217	18.217	2	0.02064	10300	DP1141_6	101.33	31.945			1286400	927	347	888	1536	2092	2092		1	9606
LISQIVSSITASLR	Unmodified	1486.8719	0.87189295	321;322	P68363;Q9H853;P68366	TUBA1B;TUBA4B;TUBA4A	Tubulin alpha-1B chain;Putative tubulin-like protein alpha-4B;Tubulin alpha-4A chain	no	no	0	0	0	3.5	1.12		1	1	1	1	23.903	23.903	2	5.658999999999999E-21	19678	DP1141_8	168.85	136.63			21753000	928	321;322	889	1537;1538;1539;1540	2093;2094;2095;2096;2097;2098;2099;2100	2097		8	9606
LITEDVQGK	Unmodified	1001.5393	0.53932542	280	P61247	RPS3A	40S ribosomal protein S3a	yes	yes	0	0	0	4	0				1		15.419	15.419	2	0.0073441	6510	DP1141_9	118.74	69.302			79065000	929	280	890	1541	2101	2101		1	9606
LITKPSEGTTLR	Unmodified	1314.7507	0.75071518	254	P49959	MRE11A	Double-strand break repair protein MRE11A	yes	yes	0	0	1	3	0			1			15.122	15.122	3	0.0091458	6174	DP1141_8	132.32	84.135			82397000	930	254	891	1542	2102	2102		1	9606
LITPAVVSER	Unmodified	1083.6288	0.62880913	308	P62851	RPS25	40S ribosomal protein S25	yes	yes	0	0	0	5	0					1	17.463	17.463	2	0.018475	10350	DP1141_10	86.136	36.718			27356000	931	308	892	1543	2103	2103		1	9606
LIVENLSSR	Unmodified	1029.5819	0.58185893	355	Q13243;Q13247;Q08170	SRSF5;SRSF6;SRSF4	Serine/arginine-rich splicing factor 5;Serine/arginine-rich splicing factor 6;Serine/arginine-rich splicing factor 4	yes	no	0	0	0	4	0				1		17.314	17.314	2	1.9758E-16	9625	DP1141_9	157.33	76.867			0	932	355	893	1544	2104	2104		1	9606
LIWEVWMPFVR	Oxidation (M)	1490.7744	0.77442751	586	Q9UBB9	TFIP11	Tuftelin-interacting protein 11	yes	yes	0	1	0	2	0		1				23.939	23.939	2	0.032703	19894	DP1141_7	82.426	47.653			0	933	586	894	1545	2105	2105	414	1	9606
LKATVTPSPVK	Unmodified	1139.6914	0.69140938	556	Q9H1E3	NUCKS1	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1	yes	yes	0	0	1	4	0				1		14.344	14.344	2	0.012355	4908	DP1141_9	103.26	15.616			11560000	934	556	895	1546	2106	2106		0	9606
LKECCDKPLLEK	Unmodified	1531.7738	0.77383516	15	CON__P02769			yes	yes	0	0	2	3	0			1			14.527	14.527	3	0.0099808	5250	DP1141_8	91.62	42.197		+	10214000	935	15	896	1547	2107	2107		1	
LKEREEFLIPIYHQVAVQFADLHDTPGR	Unmodified	3320.7306	0.73059544	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	2	4.5	0.5				1	1	21.343	21.343	4;5	3.353E-12	16524	DP1141_10	119.14	112.32			18135000	936	367	897	1548;1549	2108;2109;2110;2111	2109		4	9606
LKETGYVVERPSTTK	Unmodified	1706.9203	0.9202997	580	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	yes	yes	0	0	2	1.75	0.433	1	3				14.859	14.859	2;3;4	1.1985E-109	5802	DP1141_7	206.32	128.65			211140000	937	580	898	1550;1551;1552;1553	2112;2113;2114;2115	2115		4	9606
LKGDDLQAIKK	Unmodified	1227.7187	0.71868677	124	P07910	HNRNPC	Heterogeneous nuclear ribonucleoproteins C1/C2	yes	yes	0	0	2	4	0				1		14.344	14.344	3	0.0029215	4847	DP1141_9	127.87	49.355			39951000	938	124	899	1554	2116	2116		1	9606
LKNPNAPMLPPPK	Oxidation (M)	1431.7908	0.79080585	49	O15042	U2SURP	U2 snRNP-associated SURP motif-containing protein	yes	yes	0	1	1	2	0		1				15.168	15.168	3	0.0018284	6306	DP1141_7	96.067	71.214			40078000	939	49	900	1555	2117	2117	41	0	9606
LKPDPEPDDKNQEPSSCK	Unmodified	2082.9528	0.9527984	551	Q9GZU8	FAM192A	Protein FAM192A	yes	yes	0	0	2	4	0				1		12.752	12.752	3	0.0083891	2835	DP1141_9	118.55	101.25			9910100	940	551	901	1556	2118	2118		1	9606
LLADQAEAR	Unmodified	985.51926	0.51925868	332	P84098	RPL19	60S ribosomal protein L19	yes	yes	0	0	0	5	0					1	14.924	14.924	2	9.2619E-05	6162	DP1141_10	143.89	67.04			15024000	941	332	902	1557	2119	2119		0	9606
LLAEGHPDPDAELQR	Unmodified	1659.8216	0.82164829	251	P49756	RBM25	RNA-binding protein 25	yes	yes	0	0	0	2	0		2				16.567	16.567	2;3	0.0027345	8619	DP1141_7	104.55	59.342			214170000	942	251	903	1558;1559	2120;2121;2122	2120		3	9606
LLALNSLYSPK	Unmodified	1217.702	0.70197407	329	P78527	PRKDC	DNA-dependent protein kinase catalytic subunit	yes	yes	0	0	0	1	0	1					20.14	20.14	2	0.0049008	13563	DP1141_6	110.53	47.115			5683400	943	329	904	1560	2123	2123		0	9606
LLASTLVHSVK	Unmodified	1166.7023	0.70230842	580	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	yes	yes	0	0	0	2	0		1				17.354	17.354	2	0.033132	9856	DP1141_7	94.409	41.32			0	944	580	905	1561	2124	2124		1	9606
LLDAESEDRPK	Unmodified	1271.6357	0.635745	89	O95239;Q2VIQ3	KIF4A;KIF4B	Chromosome-associated kinesin KIF4A;Chromosome-associated kinesin KIF4B	yes	no	0	0	1	2	0		2				14.658	14.658	2;3	0.0092176	5506	DP1141_7	98.943	51.861			17860000	945	89	906	1562;1563	2125;2126	2126		2	9606
LLDLQVR	Unmodified	855.5178	0.51780212	440	Q6ZMZ3	SYNE3	Nesprin-3	yes	yes	0	0	0	2	0		1				16.594	16.594	2	0.0030729	8933	DP1141_7	114.59	54.977			1685099999.9999998	946	440	907	1564	2127	2127		1	9606
LLDSLEPPGEPGPSTNIPENDTVDGREEK	Unmodified	3104.4786	0.47858224	493	Q92734	TFG	Protein TFG	yes	yes	0	0	1	3	0			1			18.926	18.926	3	9.5084E-09	12336	DP1141_8	83.202	59.762			14614000	947	493	908	1565	2128	2128		1	9606
LLEGEDAHLTQYK	Unmodified	1515.7569	0.75692277	21	CON__Q04695;Q04695;CON__Q9QWL7	KRT17	Keratin, type I cytoskeletal 17	yes	no	0	0	0	4	0				2		16.907	16.907	2;3	4.1299999999999996E-21	8969	DP1141_9	169.23	125.68		+	91810000	948	21	909	1566;1567	2129;2130	2129		2	9606
LLEQYKEESK	Unmodified	1265.6503	0.65033243	337	Q00839	HNRNPU	Heterogeneous nuclear ribonucleoprotein U	yes	yes	0	0	1	2	0		1				14.859	14.859	3	4.9364E-07	5835	DP1141_7	145.9	91.838			32783000	949	337	910	1568	2131	2131		0	9606
LLETESFQMNR	Oxidation (M)	1382.65	0.65001485	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	0	1	0	1					17.253	17.253	2	3.4651E-95	9028	DP1141_6	214.23	171.36			729380000	950	367	911	1569	2132;2133;2134	2132	273	3	9606
LLETESFQMNR	Unmodified	1366.6551	0.65510023	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	2	1	1		1			18.425	18.425	2	1.0106E-07	11285	DP1141_6	143.37	101.95			7966300	951	367	911	1570;1571	2135;2136	2135		1	9606
LLETTDRPDGHQNNLR	Unmodified	1877.9344	0.93438664	395	Q14974	KPNB1	Importin subunit beta-1	yes	yes	0	0	1	2	0		1				14.859	14.859	4	0.003034	5766	DP1141_7	86.756	60.799			51925000	952	395	912	1572	2137	2137		0	9606
LLEVEHPAAK	Unmodified	1105.6132	0.61315906	165	P17987	TCP1	T-complex protein 1 subunit alpha	yes	yes	0	0	0	1	0	1					14.898	14.898	2	0.02711	5270	DP1141_6	122.19	35.715			0	953	165	913	1573	2138	2138		1	9606
LLEVQGSRPGK	Unmodified	1182.6721	0.67207093	286	P62136	PPP1CA	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit	yes	yes	0	0	1	4.25	0.433				3	1	14.654	14.654	2;3	8.801899999999999E-21	5779	DP1141_10	154.84	80.671			140000000	954	286	914	1574;1575;1576;1577	2139;2140;2141;2142	2139		4	9606
LLGASELPIVTPALR	Unmodified	1548.9239	0.92392852	264	P52292	KPNA2	Importin subunit alpha-1	yes	yes	0	0	0	3	0			1			21.429	21.429	2	0.035606	16000	DP1141_8	61.213	29.719			16615000	955	264	915	1578	2143	2143		1	9606
LLGGHNEDLPSNR	Unmodified	1420.7059	0.70589025	537	Q9BRD0	BUD13	BUD13 homolog	yes	yes	0	0	0	4.5	0.5				1	1	15.419	15.419	3	0.00036557	6514	DP1141_9	117.86	98.364			8493200	956	537	916	1579;1580	2144;2145	2145		1	9606
LLGQFTLIGIPPAPR	Unmodified	1591.945	0.94499831	217	P38646	HSPA9	Stress-70 protein, mitochondrial	yes	yes	0	0	0	3.33	0.471			2	1		22.643	22.643	2	1.7229E-14	17482	DP1141_8	166.86	119.6			54895000	957	217	917	1581;1582;1583	2146;2147;2148;2149	2146		4	9606
LLHYLGHVMVNGPTTPIPVK	Oxidation (M)	2201.2031	0.20308026	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	1	0	1.6	0.49	2	3				18.44	18.44	2;3;4	0.00072223	11638	DP1141_7	94.454	74.729			450570000	958	142	918	1584;1585;1586;1587;1588	2150;2151;2152;2153;2154;2155;2156	2152	143	7	9606
LLHYLGHVMVNGPTTPIPVK	Unmodified	2185.2082	0.20816564	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2	0		2				19.1	19.1	3;4	0.001344	12674	DP1141_7	81.428	62.392			153020000	959	142	918	1589;1590	2157;2158;2159;2160;2161	2157		5	9606
LLIYETEAKK	Unmodified	1206.686	0.68598966	251	P49756	RBM25	RNA-binding protein 25	yes	yes	0	0	1	2	0		1				16.265	16.265	3	0.032666	8129	DP1141_7	71.451	51.42			6228300	960	251	919	1591	2162	2162		1	9606
LLLDHFANR	Unmodified	1097.5982	0.5981777	602	Q9UM47	NOTCH3	Neurogenic locus notch homolog protein 3;Notch 3 extracellular truncation;Notch 3 intracellular domain	yes	yes	0	0	0	1	0	1					15.259	15.259	2	0.01058	5893	DP1141_6	97.602	0			10091000	961	602	920	1592	2163;2164	2164		2	9606
LLLEDLVK	Unmodified	941.57973	0.57973367	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	3	1.63	1		1		1	20.959	20.959	2	6.2505E-06	14972	DP1141_6	145.04	69.01			803270000	962	367	921	1593;1594;1595	2165;2166;2167	2166		3	9606
LLLPGELAK	Unmodified	952.59572	0.59571809	65	Q99880;Q99879;Q99877;Q93079;Q5QNW6;P62807;P58876;P57053;O60814;Q8N257;Q16778;P33778;P23527;P06899;A0A2R8Y619;Q96A08	HIST1H2BL;HIST1H2BM;HIST1H2BN;HIST1H2BH;HIST2H2BF;HIST1H2BC;HIST1H2BD;H2BFS;HIST1H2BK;HIST3H2BB;HIST2H2BE;HIST1H2BB;HIST1H2BO;HIST1H2BJ;HIST1H2BA	Histone H2B type 1-L;Histone H2B type 1-M;Histone H2B type 1-N;Histone H2B type 1-H;Histone H2B type 2-F;Histone H2B type 1-C/E/F/G/I;Histone H2B type 1-D;Histone H2B type F-S;Histone H2B type 1-K;Histone H2B type 3-B;Histone H2B type 2-E;Histone H2B type 1-B;Histone H2B type 1-O;Histone H2B type 1-J;Histone H2B type 1-A	yes	no	0	0	0	5	0					1	19.127	19.127	1	0.00072002	13042	DP1141_10	115.49	31.742			64859000	963	65	922	1596	2168	2168		0	9606
LLLPWLEAR	Unmodified	1109.6597	0.65971533	336	Q00610	CLTC	Clathrin heavy chain 1	yes	yes	0	0	0	2	0		1				22.855	22.855	2	0.0066678	18305	DP1141_7	116.73	84.965			5110100	964	336	923	1597	2169	2169		1	9606
LLLQVQHASK	Unmodified	1135.6713	0.67134264	109	P05141;P12236;P12235	SLC25A5;SLC25A6;SLC25A4	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed;ADP/ATP translocase 3;ADP/ATP translocase 3, N-terminally processed;ADP/ATP translocase 1	yes	no	0	0	0	3.75	1.64	1			1	2	15.738	15.738	2	1.3034E-69	7567	DP1141_10	190.26	65.667			77933000	965	109	924	1598;1599;1600;1601	2170;2171;2172;2173;2174	2171		5	9606
LLPCLHSACSACLGPAAPAAANSSGDGGAAGDGTVVDCPVCK	Unmodified	4110.8326	0.83258874	372	Q13263	TRIM28	Transcription intermediary factor 1-beta	yes	yes	0	0	0	2	0		1				19	19	3	5.1391000000000003E-20	12699	DP1141_7	71.878	61.498			20341000	966	372	925	1602	2175	2175		1	9606
LLQDFFNGK	Unmodified	1080.5604	0.56039521	140;161	P11142;P54652;P17066	HSPA8;HSPA2;HSPA6	Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2;Heat shock 70 kDa protein 6	no	no	0	0	0	3	0			1			20.226	20.226	2	2.206E-08	14202	DP1141_8	155.51	70.245			81561000	967	140;161	926	1603	2176	2176		1	9606
LLQDFFNGR	Unmodified	1108.5665	0.56654322	135	P0DMV8;P0DMV9	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	yes	no	0	0	0	3.5	0.5			1	1		20.457	20.457	2	2.3873999999999998E-36	14582	DP1141_9	203.19	146.46			426450000	968	135	927	1604;1605	2177;2178;2179	2179		2	9606
LLQLVEDR	Unmodified	984.5604	0.56039521	163	P17844	DDX5	Probable ATP-dependent RNA helicase DDX5	yes	yes	0	0	0	4	0				1		18.529	18.529	2	0.017857	11230	DP1141_9	96.253	19.661			13636000	969	163	928	1606	2180	2180		1	9606
LLQSQLQVK	Unmodified	1055.6339	0.63389451	513	Q96I25	RBM17	Splicing factor 45	yes	yes	0	0	0	4	1			1		1	16.71	16.71	2	0.0010594	8574	DP1141_8	161.11	78.44			115590000	970	513	929	1607;1608	2181;2182	2182		0	9606
LLSDATVEKDESHAGK	Unmodified	1698.8424	0.84244331	386	Q14320	FAM50A	Protein FAM50A	yes	yes	0	0	1	4	0				1		14.75	14.75	4	1.7642E-08	5431	DP1141_9	156.2	123.9			108190000	971	386	930	1609	2183	2183		1	9606
LLVATSVAAR	Unmodified	999.60768	0.60767975	445	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	yes	yes	0	0	0	2.5	1.12	1	1	1	1		16.922	16.922	2	6.5943E-30	9140	DP1141_7	178.99	86.523			236910000	972	445	931	1610;1611;1612;1613	2184;2185;2186;2187;2188	2185		5	9606
LLVDVDESTLSPEEQKER	Unmodified	2086.043	0.042993612	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	3	0.816		1	1	1		18.318	18.318	2;3	8.0913E-167	11575	DP1141_7	223.36	192.5			183300000	973	78	932	1614;1615;1616	2189;2190;2191	2189		2	9606
LLVPTQFVGAIIGK	Unmodified	1454.8861	0.88608645	36	O00425	IGF2BP3	Insulin-like growth factor 2 mRNA-binding protein 3	yes	yes	0	0	0	3	0			1			22.999	22.999	2	0.0022534	18321	DP1141_8	123.11	0			6794200	974	36	933	1617	2192	2192		1	9606
LLYAFAEATVPK	Unmodified	1321.7282	0.72818882	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3	0			1			20.427	20.427	2	0.0063654	14512	DP1141_8	90.827	64.443			130090000	975	111	934	1618	2193	2193		1	9606
LMELNMEIRDMIRR	2 Oxidation (M)	1850.9165	0.91649343	422	Q5TBA9	FRY	Protein furry homolog	yes	yes	0	2	2	4	0				1		20.287	20.287	3	0.024039	14452	DP1141_9	51.135	11.45			56605000	976	422	935	1619	2194	2194	317;318	1	9606
LMTEILGR	Oxidation (M)	947.511	0.51100218	61	O43809	NUDT21	Cleavage and polyadenylation specificity factor subunit 5	yes	yes	0	1	0	5	0					1	17.137	17.137	2	0.030936	9922	DP1141_10	114.72	15.346			95955000	977	61	936	1620	2195	2195	51	1	9606
LMTQMRMGKK	3 Oxidation (M)	1270.6196	0.61958312	598	Q9UKN7	MYO15A	Unconventional myosin-XV	yes	yes	0	3	2	5	0					1	18.741	18.741	2	0.031144	12510	DP1141_10	58.981	30.773			0	978	598	937	1621	2196	2196	416;417;418	1	9606
LMVELSK	Oxidation (M)	834.45209	0.45209032	244	P48643	CCT5	T-complex protein 1 subunit epsilon	yes	yes	0	1	0	3	0			1			16.244	16.244	2	0.026549	7924	DP1141_8	102.77	8.7669			0	979	244	938	1622	2197	2197	196	1	9606
LNIPVSQVNPR	Unmodified	1235.6986	0.69862003	147;106	P05023;P13637	ATP1A1;ATP1A3	Sodium/potassium-transporting ATPase subunit alpha-1;Sodium/potassium-transporting ATPase subunit alpha-3	no	no	0	0	0	1	0	1					17.655	17.655	2	4.0637E-09	9658	DP1141_6	172.25	115.44			19801000	980	106;147	939	1623	2198	2198		0	9606
LNISYTR	Unmodified	865.46577	0.46576654	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	0	4	1			1		1	16.511	16.511	2	8.5119E-10	8389	DP1141_8	148.21	64.919			445360000	981	521	940	1624;1625	2199;2200;2201	2201		3	9606
LNLDSIIGR	Unmodified	999.57129	0.57129425	286	P62136	PPP1CA	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit	yes	yes	0	0	0	4	0				1		20.387	20.387	2	1.8204E-13	14494	DP1141_9	163.67	85.928			51583000	982	286	941	1626	2202	2202		1	9606
LNVAHVLFMQENK	Oxidation (M)	1557.7973	0.79734779	459	Q8N4P2;Q86WT1	TTC30B;TTC30A	Tetratricopeptide repeat protein 30B;Tetratricopeptide repeat protein 30A	yes	no	0	1	0	1	0	1					16.255	16.255	3	0.025478	7321	DP1141_6	55.261	20.488			497250000	983	459	942	1627	2203;2204	2203	338	2	9606
LPAAGVGDMVMATVK	2 Oxidation (M)	1490.7473	0.74728606	305	P62829	RPL23	60S ribosomal protein L23	yes	yes	0	2	0	5	0					1	16.973	16.973	2	0.0080649	9694	DP1141_10	108.68	77.861			137450000	984	305	943	1628	2205;2206;2207	2205	238;239	3	9606
LPCIYLVDSGGAYLPR	Unmodified	1792.9182	0.91819121	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	2.67	1.25	1		1	1		21.744	21.744	2	7.5559E-287	16391	DP1141_8	262.07	184.32			1073299999.9999999	985	567	944	1629;1630;1631	2208;2209;2210;2211	2209		4	9606
LPELFETGR	Unmodified	1060.5553	0.55530983	325	P78318	IGBP1	Immunoglobulin-binding protein 1	yes	yes	0	0	0	4	0				1		19.589	19.589	2	0.0002709	13270	DP1141_9	166.68	144.72			37562000	986	325	945	1632	2212	2212		0	9606
LPELLLK	Unmodified	824.53714	0.53714057	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					19.556	19.556	2	1.0115E-10	12680	DP1141_6	153.88	34.664			1032899999.9999999	987	367	946	1633	2213;2214	2213		2	9606
LPGGNEIGMVAWK	Oxidation (M)	1386.6966	0.69657112	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	0	1	0	1					19.148	19.148	2	0.028115	12201	DP1141_6	103.43	70.055			491350000	988	367	947	1634	2215	2215	274	1	9606
LPGGNEIGMVAWK	Unmodified	1370.7017	0.70165649	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					20.14	20.14	2	0.011789	13614	DP1141_6	85.807	28.997			256860000	989	367	947	1635	2216	2216		1	9606
LPIVDKYK	Unmodified	974.58007	0.58006802	153	P15170;Q8IYD1	GSPT1;GSPT2	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A;Eukaryotic peptide chain release factor GTP-binding subunit ERF3B	yes	no	0	0	1	4	0				1		17.925	17.925	2	0.017028	10617	DP1141_9	116.9	50.831			0	990	153	948	1636	2217	2217		1	9606
LPPNTNDEVDEDPTGNK	Unmodified	1853.8279	0.82791546	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	0	3	1.41	1	1	1	1	1	15.736	15.736	2	5.1957E-58	6375	DP1141_6	194.86	169.63			103900000	991	402	949	1637;1638;1639;1640;1641	2218;2219;2220;2221;2222;2223;2224;2225;2226	2219		9	9606
LPPPMPPSER	Unmodified	1119.5747	0.57466507	463	Q8IWX8	CHERP	Calcium homeostasis endoplasmic reticulum protein	yes	yes	0	0	0	2	0		1				16.135	16.135	2	0.023637	7962	DP1141_7	80.455	11.54			8113300	992	463	950	1642	2227	2227		1	9606
LPPQDFLDR	Unmodified	1099.5662	0.56620887	351	Q07065	CKAP4	Cytoskeleton-associated protein 4	yes	yes	0	0	0	3	0			1			18.638	18.638	2	0.010619	11956	DP1141_8	98.033	54.787			15290000	993	351	951	1643	2228;2229	2228		2	9606
LPPVLANLMGSMGAGK	2 Oxidation (M)	1586.816	0.81603433	520	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	yes	yes	0	2	0	2	0		1				19.501	19.501	2	0.003397	13357	DP1141_7	96.334	78.525			36516000	994	520	952	1644	2230	2230	367;368	1	9606
LPQTPLDTGIPFPPVFSTSSAGVK	Unmodified	2455.2999	0.299877	447	Q7LBC6	KDM3B	Lysine-specific demethylase 3B	yes	yes	0	0	0	2	0		2				22.998	22.998	2;3	2.3251E-09	18541	DP1141_7	179.09	166.89			11614000	995	447	953	1645;1646	2231;2232;2233	2231		3	9606
LPSYLDK	Unmodified	834.44872	0.4487195	455	Q86TJ2	TADA2B	Transcriptional adapter 2-beta	yes	yes	0	0	0	2.5	1.5	1			1		17.787	17.787	2	0.0003705	10373	DP1141_9	120.65	57.667			62405000	996	455	954	1647;1648	2234;2235	2235		2	9606
LPVCSQQQGEPDLTEHEK	Unmodified	2093.9688	0.96878281	510	Q96F63	CCDC97	Coiled-coil domain-containing protein 97	yes	yes	0	0	0	4	0				1		16.008	16.008	3	0.00064077	7626	DP1141_9	123.58	103.49			90754000	997	510	955	1649	2236	2236		1	9606
LQAMMTHLHMR	3 Oxidation (M)	1415.6472	0.64719486	53	O15409	FOXP2	Forkhead box protein P2	yes	yes	0	3	0	1	0	1					19.469	19.469	2	0.035364	12607	DP1141_6	42.864	21.119			0	998	53	956	1650	2237	2237	46;47;48	1	9606
LQDEIQNMKEEMAR	2 Oxidation (M)	1765.7975	0.79748373	127	P08670	VIM	Vimentin	yes	yes	0	2	1	4	0				1		14.344	14.344	3	0.015384	4788	DP1141_9	63.727	42.269			9559300	999	127	957	1651	2238	2238	119;120	1	9606
LQIEESSKPVR	Unmodified	1284.7038	0.70376498	150	P13984	GTF2F2	General transcription factor IIF subunit 2	yes	yes	0	0	1	5	0					1	14.77	14.77	3	0.025464	6097	DP1141_10	106.4	41.67			43753000	1000	150	958	1652	2239;2240	2240		2	9606
LQLAMEMVGFLPK	2 Oxidation (M)	1507.7779	0.77785791	6	B2RTY4	MYO9A	Unconventional myosin-IXa	yes	yes	0	2	0	2	0		1				15.117	15.117	3	0.022017	6180	DP1141_7	53.6	21.17			2509000	1001	6	959	1653	2241	2241	6;7	0	9606
LQMEQQQQLQQR	Oxidation (M)	1572.7678	0.76783858	575	Q9NS69	TOMM22	Mitochondrial import receptor subunit TOM22 homolog	yes	yes	0	1	0	5	0					1	14.372	14.372	2	5.0837E-29	5369	DP1141_10	177.36	138.58			13741000	1002	575	960	1654	2242	2242	410	1	9606
LQQQQRPEDAEDGAEGGGK	Unmodified	2011.9195	0.91952443	359	Q08J23	NSUN2	tRNA (cytosine(34)-C(5))-methyltransferase	yes	yes	0	0	1	2	0		1				12.873	12.873	3	0.019334	3205	DP1141_7	82.709	59.742			2830700	1003	359	961	1655	2243	2243		1	9606
LQSIGTENTEENRR	Unmodified	1645.802	0.80197548	100	P04075	ALDOA	Fructose-bisphosphate aldolase A	yes	yes	0	0	1	2	0		1				14.358	14.358	3	0.0028766	5034	DP1141_7	101.32	60.078			12323000	1004	100	962	1656	2244	2244		1	9606
LQSQLLSLEK	Unmodified	1157.6656	0.66558856	255	P50570	DNM2	Dynamin-2	yes	yes	0	0	0	4	0				1		18.387	18.387	2	0.010102	11176	DP1141_9	97.965	0			14563000	1005	255	963	1657	2245	2245		1	9606
LQSSQEPEAPPPR	Unmodified	1434.7103	0.71030693	605	Q9UNF1	MAGED2	Melanoma-associated antigen D2	yes	yes	0	0	0	3	0			1			14.498	14.498	2	0.006165	5263	DP1141_8	114.89	74.836			6263100	1006	605	964	1658	2246	2246		1	9606
LQVEHPVTECITGLDLVQEMIR	Oxidation (M)	2595.3037	0.30365852	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	1	0	3	0			1			20.628	20.628	3	2.5155E-06	14797	DP1141_8	101.92	88.284			65478000	1007	110	965	1659	2247;2248	2248	94	2	9606
LQVEHPVTEMITGTDLVEWQLR	Oxidation (M)	2609.3159	0.31593777	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	1	0	3	0			1			20.928	20.928	3	0.0003075	15152	DP1141_8	90.06	49.438			24643000	1008	521	966	1660	2249;2250	2250	373	2	9606
LRVDYSGGFEPFSVLR	Unmodified	1840.9472	0.94718315	254	P49959	MRE11A	Double-strand break repair protein MRE11A	yes	yes	0	0	1	3	0			1			21.382	21.382	2	0.0046222	15874	DP1141_8	110.51	42.154			0	1009	254	967	1661	2251	2251		1	9606
LSEVLQAVTDHDIPQQLVER	Unmodified	2289.1965	0.19647456	501	Q93009	USP7	Ubiquitin carboxyl-terminal hydrolase 7	yes	yes	0	0	0	2	0		1				20.459	20.459	3	3.3039E-08	14737	DP1141_7	151.31	123.47			12306000	1010	501	968	1662	2252;2253	2253		2	9606
LSILYPATTGR	Unmodified	1190.6659	0.66592292	196	P30041	PRDX6	Peroxiredoxin-6	yes	yes	0	0	0	5	0					1	18.999	18.999	2	0.0035691	12838	DP1141_10	128.6	36.749			11274000	1011	196	969	1663	2254	2254		1	9606
LSINTQNKR	Unmodified	1072.5989	0.59890598	24	CON__Q2UVX4			yes	yes	0	0	1	1	0	1					21.51	21.51	2	0.0027892	15716	DP1141_6	107.9	34.279		+	1765800	1012	24	970	1664	2255	2255		0	
LSPPYSSPQEFAQDVGR	Unmodified	1876.8955	0.89554151	372	Q13263	TRIM28	Transcription intermediary factor 1-beta	yes	yes	0	0	0	3	1		1		1		19.695	19.695	2	1.8814999999999999E-44	13487	DP1141_7	186.16	157.45			133660000	1013	372	971	1665;1666	2256;2257;2258	2256		3	9606
LSQTLSLVPR	Unmodified	1112.6554	0.65535823	84	O94766	B3GAT3	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3	yes	yes	0	0	0	2.67	1.7	1	1			1	17.73	17.73	2	0.012379	9940	DP1141_6	93.143	16.369			105250000	1014	84	972	1667;1668;1669	2259;2260;2261	2260		3	9606
LSQYQEPLHLPGVR	Unmodified	1635.8733	0.87328993	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	0	0	2.67	1.25	1		1	1		18.656	18.656	3	0.00019141	11784	DP1141_8	160.56	138.65			469360000	1015	110	973	1670;1671;1672	2262;2263;2264;2265;2266	2265		4	9606
LSRLMSGSSR	Acetyl (Protein N-term);Oxidation (M)	1150.5765	0.57645598	453	Q7Z6J6	FRMD5	FERM domain-containing protein 5	yes	yes	1	1	1	3.5	0.5			1	1		22.734	22.734	2	0.0094675	17941	DP1141_8	68.383	17.751			65383000	1016	453	974	1673;1674	2267;2268	2267	336	2	9606
LSSLNLTPDPEMEPPPK	Oxidation (M)	1879.9237	0.9237301	482	Q8TDZ2	MICAL1	Protein-methionine sulfoxide oxidase MICAL1	yes	yes	0	1	0	2	0		1				22.011	22.011	2	0.035679	16992	DP1141_7	67.749	39.78			0	1017	482	975	1675	2269	2269	356	1	9606
LSSPATLNSR	Unmodified	1044.5564	0.55637247	8	CON__P00761			yes	yes	0	0	0	2.71	1.28	1	3	1	1	1	15.33	15.33	2	1.3034E-69	6457	DP1141_7	190.26	126.05		+	990340000	1018	8	976	1676;1677;1678;1679;1680;1681;1682	2270;2271;2272;2273;2274;2275;2276;2277;2278;2279;2280;2281;2282;2283	2275		14	
LSSQEAASSFGDDR	Unmodified	1468.643	0.64301522	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	0	0	3	0			1			16.513	16.513	2	0.0048249	8411	DP1141_8	101.71	86.14			81626000	1019	110	977	1683	2284	2284		1	9606
LSSWDQAETPGHTPSLR	Unmodified	1880.9017	0.90168952	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	3.33	1.25		1	1		1	17.512	17.512	3	1.1444E-12	10191	DP1141_7	140.77	109.81			304930000	1020	78	978	1684;1685;1686	2285;2286;2287	2286		2	9606
LSTHSPFR	Unmodified	943.48756	0.48756462	141	P11171	EPB41	Protein 4.1	yes	yes	0	0	0	1	0	1					19.734	19.734	1	0.016016	12951	DP1141_6	70.912	19.125			4041500	1021	141	979	1687	2288	2288		0	9606
LSVDANLQIPK	Unmodified	1196.6765	0.6764876	87	O94913	PCF11	Pre-mRNA cleavage complex 2 protein Pcf11	yes	yes	0	0	0	3	0			1			17.388	17.388	2	0.02855	9815	DP1141_8	96.034	15.815			0	1022	87	980	1688	2289	2289		1	9606
LSVVEYDPGTHDLK	Unmodified	1571.7831	0.78313752	360	Q10570	CPSF1	Cleavage and polyadenylation specificity factor subunit 1	yes	yes	0	0	0	1	0	1					17.692	17.692	3	0.013148	9804	DP1141_6	79.744	65.113			1905600	1023	360	981	1689	2290	2290		0	9606
LTDCVVMRDPASK	Oxidation (M)	1506.717	0.71704856	179	P22626	HNRNPA2B1	Heterogeneous nuclear ribonucleoproteins A2/B1	yes	yes	0	1	1	4	0				1		14.75	14.75	3	0.0046108	5407	DP1141_9	110.8	88.02			37209000	1024	179	982	1690	2291	2291	156	0	9606
LTFDSSFSPNTGKK	Unmodified	1527.7569	0.75692277	174	P21796	VDAC1	Voltage-dependent anion-selective channel protein 1	yes	yes	0	0	1	4	0				1		17.455	17.455	3	0.015531	9853	DP1141_9	90.759	62.134			0	1025	174	983	1691	2292	2292		1	9606
LTGVFAPR	Unmodified	859.49159	0.49158736	177	P22090;P62701;Q8TD47	RPS4Y1;RPS4X;RPS4Y2	40S ribosomal protein S4, Y isoform 1;40S ribosomal protein S4, X isoform;40S ribosomal protein S4, Y isoform 2	yes	no	0	0	0	5	0					2	17.443	17.443	2	0.019821	10414	DP1141_10	107.32	37.934			0	1026	177	984	1692;1693	2293;2294	2294		2	9606
LTIIVSDPSHCNVLR	Unmodified	1722.9087	0.90868916	326	P78346	RPP30	Ribonuclease P protein subunit p30	yes	yes	0	0	0	5	0					1	18.637	18.637	3	1.6992E-17	12235	DP1141_10	159	107.87			16949000	1027	326	985	1694	2295	2295		0	9606
LTISSPLEAHK	Unmodified	1194.6608	0.66083754	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	0	1.67	0.471	1	2				17.053	17.053	2	6.185499999999999E-22	8770	DP1141_6	174.41	96.484			44189000	1028	402	986	1695;1696;1697	2296;2297;2298	2296		3	9606
LTLIDPETLLPR	Unmodified	1379.8024	0.8024164	458	Q86VP6	CAND1	Cullin-associated NEDD8-dissociated protein 1	yes	yes	0	0	0	2	0		1				22.622	22.622	2	1.3437999999999998E-52	17784	DP1141_7	194.94	169.32			19350000	1029	458	987	1698	2299;2300	2299		2	9606
LTLLQVASR	Unmodified	999.60768	0.60767976	89	O95239	KIF4A	Chromosome-associated kinesin KIF4A	yes	yes	0	0	0	2	0		1				19.2	19.2	2	0.022878	12946	DP1141_7	82.279	29.493			3935800	1030	89	988	1699	2301	2301		1	9606
LTPEELER	Unmodified	985.50803	0.50802529	91	O95399	UTS2	Urotensin-2	yes	yes	0	0	0	3	0			1			16.126	16.126	2	6.2326E-05	7797	DP1141_8	132.08	0			113740000	1031	91	989	1700	2302	2302		1	9606
LTQILSYLR	Unmodified	1105.6495	0.64954457	368	Q13123	IK	Protein Red	yes	yes	0	0	0	3	0			1			20.488	20.488	2	1.5502E-100	14568	DP1141_8	205.36	142.89			0	1032	368	990	1701	2303	2303		1	9606
LTQIQESQVTSHNK	Unmodified	1611.8216	0.82164829	490	Q92541	RTF1	RNA polymerase-associated protein RTF1 homolog	yes	yes	0	0	0	3	0			1			14.575	14.575	3	2.4534999999999996E-19	5293	DP1141_8	164.13	135.32			1668200	1033	490	991	1702	2304	2304		0	9606
LTQTSGETTHTDKVPGGEDK	Unmodified	2099.9971	0.99710605	232	P46013	MKI67	Antigen KI-67	yes	yes	0	0	1	2.5	0.5		1	1			12.953	12.953	3	6.3108E-12	2973	DP1141_7	185.2	147.85			16409000	1034	232	992	1703;1704	2305;2306	2305		2	9606
LTRPAASPAVGEK	Unmodified	1295.7197	0.7197494	469	Q8N2M8	CLASRP	CLK4-associating serine/arginine rich protein	yes	yes	0	0	1	3	0			1			14.013	14.013	3	0.0018271	4499	DP1141_8	113.37	87.239			3794100	1035	469	993	1705	2307	2307		0	9606
LTTPTYGDLNHLVSATMSGVTTCLR	Oxidation (M)	2723.3259	0.32585053	122;323;381	P07437;P68371;P04350;Q13885;Q9BVA1	TUBB;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	no	no	0	1	0	4	0				1		21.038	21.038	3	0.00016541	15406	DP1141_9	55.718	30.114			17016000	1036	122;323;381	994	1706	2308	2308	112	1	9606
LVAGEMGQNEPDQGGQR	Oxidation (M)	1800.8061	0.80607458	531	Q99714	HSD17B10	3-hydroxyacyl-CoA dehydrogenase type-2	yes	yes	0	1	0	5	0					1	14.305	14.305	2	0.0020475	5367	DP1141_10	111.94	85.819			5957600	1037	531	995	1707	2309	2309	383	1	9606
LVAIVDVIDQNR	Unmodified	1353.7616	0.76161421	256	P50914	RPL14	60S ribosomal protein L14	yes	yes	0	0	0	5	0					1	20.692	20.692	2	0.023035	15486	DP1141_10	154.85	92.742			0	1038	256	996	1708	2310	2310		1	9606
LVDQSGPPHEPK	Unmodified	1302.6568	0.65681479	271	P55265	ADAR	Double-stranded RNA-specific adenosine deaminase	yes	yes	0	0	0	2	0		1				13.688	13.688	3	0.011279	4169	DP1141_7	79.23	50.846			7472500	1039	271	997	1709	2311	2311		1	9606
LVEQAFR	Unmodified	861.47085	0.47085192	333	P85037	FOXK1	Forkhead box protein K1	yes	yes	0	0	0	3	0			1			16.226	16.226	2	0.011562	7848	DP1141_8	104.11	20.086			35228000	1040	333	998	1710	2312	2312		1	9606
LVLPAPQISDAELQEVVK	Unmodified	1948.0881	0.088093311	526	Q99459	CDC5L	Cell division cycle 5-like protein	yes	yes	0	0	0	2	0		1				21.6	21.6	2	0.0030152	16307	DP1141_7	75.589	44.361			7920200	1041	526	999	1711	2313	2313		0	9606
LVLVGDGGTGK	Unmodified	1014.571	0.5709599	304	P62826	RAN	GTP-binding nuclear protein Ran	yes	yes	0	0	0	1	0	1					16.779	16.779	2	0.0091635	8263	DP1141_6	81.95	17.11			6530800	1042	304	1000	1712	2314	2314		0	9606
LVMADKELYR	Oxidation (M)	1252.6486	0.64855829	488	Q8WX92	NELFB	Negative elongation factor B	yes	yes	0	1	1	3	0			1			15.488	15.488	3	0.033642	6796	DP1141_8	68.626	48.595			12505000	1043	488	1001	1713	2315	2315	359	0	9606
LVNHFVEEFKR	Unmodified	1416.7514	0.75138388	135	P0DMV8;P0DMV9	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	yes	no	0	0	1	2.75	1.09	1		2	1		17.139	17.139	2;3	2.6811E-14	9397	DP1141_8	178.54	159.09			1010599999.9999999	1044	135	1002	1714;1715;1716;1717	2316;2317;2318;2319;2320;2321;2322	2318		6	9606
LVPELDTIVPLESTK	Unmodified	1652.9237	0.92365374	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	2.67	1.25	1		1	1		21.317	21.317	2	1.4819E-118	15437	DP1141_6	220.29	148.05			380110000	1045	111	1003	1718;1719;1720	2323;2324;2325;2326;2327	2323		5	9606
LVPLDYGEDDKNATK	Unmodified	1676.8257	0.82573061	251	P49756	RBM25	RNA-binding protein 25	yes	yes	0	0	1	2	0		1				16.798	16.798	3	0.0097717	9104	DP1141_7	120.53	100.15			35680000	1046	251	1004	1721	2328;2329	2328		2	9606
LVQAFQYTDK	Unmodified	1211.6186	0.61863837	370	Q13162	PRDX4	Peroxiredoxin-4	yes	yes	0	0	0	5	0					1	17.711	17.711	2	0.023107	10840	DP1141_10	104.01	63.027			0	1047	370	1005	1722	2330	2330		1	9606
LVSIGHTVMTPMLNPMIYTLR	3 Oxidation (M)	2434.2422	0.24224424	274	P58180	OR4D2	Olfactory receptor 4D2	yes	yes	0	3	0	3	0			1			22.61	22.61	3	0.034113	17626	DP1141_8	42.58	19.181			3176000	1048	274	1006	1723	2331	2331	225;226;227	0	9606
LVSLCLANSFAK	Unmodified	1321.7064	0.70640752	631				yes	yes	0	0	0	4	0				1		20.687	20.687	2	0.020397	14885	DP1141_9	80.755	36.406	+		11333000	1049	631	1007	1724	2332;2333	2332		2	9606
LVTANTIDQK	Unmodified	1101.603	0.60298831	574	Q9NRZ9	HELLS	Lymphoid-specific helicase	yes	yes	0	0	0	2	0		1				15.26	15.26	2	0.010823	6558	DP1141_7	96.665	53.419			17458000	1050	574	1008	1725	2334	2334		1	9606
LVTSLPSWALLTNHFK	Unmodified	1826.0091	0.0090551289	619	Q9Y467	SALL2	Sal-like protein 2	yes	yes	0	0	0	2	0		1				21.864	21.864	3	0.0053058	16772	DP1141_7	121.95	69.843			0	1051	619	1009	1726	2335	2335		1	9606
LVVWAADR	Unmodified	928.51305	0.51305109	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	0	2.5	1.5	1			1		18.371	18.371	2	5.7085E-06	10829	DP1141_6	133.81	70.665			344990000	1052	521	1010	1727;1728	2336;2337	2336		1	9606
LVYVFSQDFTVFGGSLSGAHAQK	Unmodified	2457.2329	0.23286007	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3	0			1			22.029	22.029	3	0.0015484	16912	DP1141_8	52.095	26.171			21793000	1053	111	1011	1729	2338	2338		1	9606
LWGSPDKYPK	Unmodified	1189.6132	0.61315906	40	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	yes	yes	0	0	1	1	0	1					16.593	16.593	2	0.026827	7967	DP1141_6	98.582	40.336			0	1054	40	1012	1730	2339	2339		1	9606
LWSDFKDQQK	Unmodified	1293.6354	0.63535107	445	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	yes	yes	0	0	1	1	0	1					16.854	16.854	2	0.01158	8402	DP1141_6	109.48	54.108			0	1055	445	1013	1731	2340	2340		1	9606
LYGSAGPPPTGEEDTAEKDEL	Unmodified	2174.9855	0.98553831	139	P11021	HSPA5	78 kDa glucose-regulated protein	yes	yes	0	0	1	3	0			1			18.125	18.125	2	1.5572E-06	11218	DP1141_8	110.25	88.951			25753000	1056	139	1014	1732	2341;2342	2342		2	9606
LYPVLQQSLVR	Unmodified	1314.766	0.76597131	418	Q5RKV6	EXOSC6	Exosome complex component MTR3	yes	yes	0	0	0	5	0					1	19.826	19.826	2	0.0040579	14227	DP1141_10	123.21	92.596			19207000	1057	418	1015	1733	2343;2344	2344		2	9606
MADALDNYVIR	Oxidation (M)	1295.618	0.61798644	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	1	0	2	0		1				18.931	18.931	2	2.8364E-06	12385	DP1141_7	138.98	82.412			0	1058	110	1016	1734	2345	2345	95	1	9606
MADEAVCVGPAPTSK	Oxidation (M)	1547.696	0.69597877	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	1	0	2.4	1.5	2	1	1		1	15.674	15.674	2	0	7445	DP1141_10	286.19	227.94			146260000	1059	110	1017	1735;1736;1737;1738;1739	2346;2347;2348;2349;2350	2346	96	5	9606
MAEEQPQVELFVK	Oxidation (M)	1562.765	0.76504461	34	O00299	CLIC1	Chloride intracellular channel protein 1	yes	yes	0	1	0	5	0					1	14.199	14.199	3	0.032065	5087	DP1141_10	60.08	17.292			0	1060	34	1018	1740	2351	2351	31	1	9606
MAFAPPKNTDGPK	Acetyl (Protein N-term);Oxidation (M)	1430.6864	0.68640036	465	Q8IX29	FBXO16	F-box only protein 16	yes	yes	1	1	1	4	0				1		14.213	14.213	3	0.03202	4652	DP1141_9	40.373	9.3049			2849000	1061	465	1019	1741	2352	2352	346	1	9606
MAGAELGAALEQR	Acetyl (Protein N-term);Oxidation (M)	1373.6609	0.66091389	2	A6NEY8	PRORSD1P	Putative prolyl-tRNA synthetase associated domain-containing protein 1	yes	yes	1	1	0	4	0				1		17.752	17.752	2	0.034432	10338	DP1141_9	55.064	9.6958			0	1062	2	1020	1742	2353	2353	2	1	9606
MALENGGLARR	Oxidation (M)	1202.619	0.6189895	25	CON__Q3T052			yes	yes	0	1	1	5	0					1	15.209	15.209	3	0.024942	6577	DP1141_10	63.944	26.004		+	2708300	1063	25	1021	1743	2354	2354	27	1	
MAMSLPGSRRTSAGSR	2 Oxidation (M)	1695.8145	0.8144712	50	O15079	SNPH	Syntaphilin	yes	yes	0	2	2	2	0		1				23.042	23.042	2	0.014991	18545	DP1141_7	90.913	15.261			0	1064	50	1022	1744	2355	2355	42;43	1	9606
MAPVPLDDSNRPASLTK	Oxidation (M)	1826.9196	0.91964777	580	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	yes	yes	0	1	1	2	0		2				16.31	16.31	2;3	1.1255E-05	8239	DP1141_7	151.22	132.43			97528000	1065	580	1023	1745;1746	2356;2357;2358;2359	2357	412	4	9606
MATKEKLQCLK	Acetyl (Protein N-term);Oxidation (M)	1406.7262	0.72615669	198	P31641	SLC6A6	Sodium- and chloride-dependent taurine transporter	yes	yes	1	1	2	3	0			1			24.563	24.563	2	0.035506	20563	DP1141_8	44.203	10.974			0	1066	198	1024	1747	2360	2360	167	1	9606
MAVTFIGNSTAIQELFK	Oxidation (M)	1884.9655	0.96553533	122	P07437	TUBB	Tubulin beta chain	yes	yes	0	1	0	3.75	0.829			2	1	1	22.734	22.734	2;3	0	17915	DP1141_8	286.29	232.69			269670000	1067	122	1025	1748;1749;1750;1751	2361;2362;2363;2364;2365;2366;2367	2363	113	7	9606
MAVTFIGNSTAIQELFKR	Oxidation (M)	2041.0666	0.066646362	122	P07437	TUBB	Tubulin beta chain	yes	yes	0	1	1	4	0				1		21.533	21.533	3	0.00054551	16116	DP1141_9	140.93	55.921			3970900	1068	122	1026	1752	2368	2368	113	1	9606
MAVVKTPSRGLK	Acetyl (Protein N-term);Oxidation (M)	1343.7595	0.75950572	416	Q4G0U5	CFAP221	Cilia- and flagella-associated protein 221	yes	yes	1	1	2	5	0					1	17.154	17.154	3	0.034119	9923	DP1141_10	49.189	12.511			0	1069	416	1027	1753	2369	2369	316	1	9606
MDEPSPLAQPLELNQHSR	Acetyl (Protein N-term);Oxidation (M)	2119.0004	0.0004172906	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	1	1	0	1	0	1					19.456	19.456	2	0	12612	DP1141_6	338.12	274			319150000	1070	367	1028	1754	2370;2371;2372;2373	2370	275	4	9606
MDEPSPLAQPLELNQHSR	Acetyl (Protein N-term)	2103.0055	0.0055026685	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	1	0	0	1	0	1					20.341	20.341	2	0	14049	DP1141_6	327.94	273.24			57584000	1071	367	1028	1755	2374;2375	2374		2	9606
MDILKSEILR	Acetyl (Protein N-term);Oxidation (M)	1274.6904	0.69042311	530	Q99633	PRPF18	Pre-mRNA-splicing factor 18	yes	yes	1	1	1	1	0	1					23.101	23.101	2	0.029715	18162	DP1141_6	40.882	7.0066			1444200	1072	530	1029	1756	2376	2376	382	1	9606
MDKQSSAGGVKR	Acetyl (Protein N-term);Oxidation (M)	1320.6456	0.64559818	545	Q9NY87;Q9NS26;Q9BXN6	SPANXC;SPANXA1;SPANXD	Sperm protein associated with the nucleus on the X chromosome C;Sperm protein associated with the nucleus on the X chromosome A;Sperm protein associated with the nucleus on the X chromosome D	yes	no	1	1	2	2	0		1				16.003	16.003	3	0.035364	7631	DP1141_7	45.764	9.4467			0	1073	545	1030	1757	2377	2377	390	1	9606
MDLFGDLPEPER	Acetyl (Protein N-term);Oxidation (M)	1475.6602	0.66024519	552	Q9H0C8	ILKAP	Integrin-linked kinase-associated serine/threonine phosphatase 2C	yes	yes	1	1	0	4	0				1		22.605	22.605	2	0.0060037	17842	DP1141_9	82.171	22.745			4636600	1074	552	1031	1758	2378	2378	396	1	9606
MEDLTNVSSLLNMER	Oxidation (M)	1766.8179	0.81788482	446	Q7L2Z9	CENPQ	Centromere protein Q	yes	yes	0	1	0	5	0					1	17.637	17.637	3	0.029032	10306	DP1141_10	49.333	21.28			70296000	1075	446	1032	1759	2379	2379	332	1	9606
MEEPQSDPSVEPPLSQETFSDLWK	Acetyl (Protein N-term);Oxidation (M)	2833.264	0.26402136	104	P04637	TP53	Cellular tumor antigen p53	yes	yes	1	1	0	3	0			1			23.903	23.903	3	6.9225E-07	19691	DP1141_8	100.85	74.665			6017700	1076	104	1033	1760	2380	2380	88	1	9606
MEGPLSVFGDR	Acetyl (Protein N-term);Oxidation (M)	1264.5758	0.57578728	165	P17987	TCP1	T-complex protein 1 subunit alpha	yes	yes	1	1	0	3	0			1			22.303	22.303	2	0.022155	17289	DP1141_8	60.102	35.227			3347800	1077	165	1034	1761	2381	2381	152	0	9606
MEHYLPARVMEK	Oxidation (M)	1518.7323	0.7323047	364	Q12923	PTPN13	Tyrosine-protein phosphatase non-receptor type 13	yes	yes	0	1	1	3	0			1			17.002	17.002	3	0.032366	9188	DP1141_8	67.214	23.416			0	1078	364	1035	1762	2382	2382	263	1	9606
MELGNVTRVK	Acetyl (Protein N-term);Oxidation (M)	1203.6282	0.6281572	476	Q8NGI4	OR4D11	Olfactory receptor 4D11	yes	yes	1	1	1	4	0				1		26.804	26.804	2	0.011918	23587	DP1141_9	62.546	19.463			877670	1079	476	1036	1763	2383	2383	353	1	9606
MELITILEK	Acetyl (Protein N-term);Oxidation (M)	1146.6206	0.62061221	395	Q14974	KPNB1	Importin subunit beta-1	yes	yes	1	1	0	2	0		1				24.042	24.042	2	0.0015106	20043	DP1141_7	109.11	76.5			18874000	1080	395	1037	1764	2384;2385	2384	304	2	9606
MEQMSNMTLMKETISTVEKEMK	2 Oxidation (M)	2650.2032	0.20321748	547	Q9BZW7	TSGA10	Testis-specific gene 10 protein	yes	yes	0	2	2	2	0		1				19.401	19.401	3	0.017616	13206	DP1141_7	45.047	14.455			44635000	1081	547	1038	1765	2386	2386	392;393	0	9606
MEQTEVLK	Acetyl (Protein N-term);Oxidation (M)	1034.4954	0.49541169	414	Q16878	CDO1	Cysteine dioxygenase type 1	yes	yes	1	1	0	3	0			1			17.023	17.023	2	0.031898	9195	DP1141_8	67.035	13.683			36817000	1082	414	1039	1766	2387	2387	315	1	9606
MEVKPPPGRPQPDSGR	Acetyl (Protein N-term);Oxidation (M)	1804.889	0.88901635	262	P51991	HNRNPA3	Heterogeneous nuclear ribonucleoprotein A3	yes	yes	1	1	2	5	0					1	14.509	14.509	3	0.00975	5574	DP1141_10	56.793	30.012			12152000	1083	262	1040	1767	2388	2388	212	1	9606
MFGGPGTASRPSSSR	Oxidation (M)	1509.6994	0.69942466	127	P08670	VIM	Vimentin	yes	yes	0	1	1	3	0			1			14.013	14.013	3	0.0030642	4458	DP1141_8	96.604	56.45			11917000	1084	127	1041	1768	2389	2389	121	1	9606
MFLYNLTLQR	Acetyl (Protein N-term);Oxidation (M)	1355.6908	0.69075746	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	1	1	0	2	0		1				22.858	22.858	2	0.0077243	18311	DP1141_7	80.455	47.614			5095600	1085	402	1042	1769	2390	2390	306	1	9606
MFQLPVNNLGSLR	Acetyl (Protein N-term);Oxidation (M)	1545.7973	0.79734779	559	Q9H2P0	ADNP	Activity-dependent neuroprotector homeobox protein	yes	yes	1	1	0	2	0		1				22.858	22.858	2	1.1488E-09	18308	DP1141_7	156.48	101.99			5575700	1086	559	1043	1770	2391	2391	400	1	9606
MGGFQRGKYGTMAEGR	Acetyl (Protein N-term);Oxidation (M)	1802.8192	0.81922222	508	Q96F15	GIMAP5	GTPase IMAP family member 5	yes	yes	1	1	2	1	0	1					22.138	22.138	2	0.034622	16700	DP1141_6	51.979	11.463			0	1087	508	1044	1771	2392	2392	363	1	9606
MGGMVSFR	Oxidation (M)	899.39934	0.39934324	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	0	1	0	2					16.562	16.562	2	0.027521	7323	DP1141_6	95.352	48.689			250160000	1088	367	1045	1772;1773	2393;2394	2394	276;277	1	9606
MGPAMGPALGAGIER	2 Oxidation (M)	1458.6959	0.69591919	263	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	yes	yes	0	2	0	5	0					1	16.973	16.973	2	0.0069784	9631	DP1141_10	107.85	74.656			16162000	1089	263	1046	1774	2395;2396	2396	214;215	2	9606
MGPLGLDHMASSIER	2 Oxidation (M)	1644.76	0.75997601	263	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	yes	yes	0	2	0	4.5	0.5				1	1	16.624	16.624	3	0.0039714	8535	DP1141_9	68.033	48.71			44126000	1090	263	1047	1775;1776	2397;2398	2398	216;217	0	9606
MGPVIGMTPDK	Acetyl (Protein N-term);Oxidation (M)	1202.5675	0.56753078	202	P32314	FOXN2	Forkhead box protein N2	yes	yes	1	1	0	3	0			1			15.549	15.549	2	0.022698	7144	DP1141_8	66.429	11.318			12547000	1091	202	1048	1777	2399	2399	171	1	9606
MHLYLGAAK	Unmodified	1002.5321	0.53207197	367;40	Q13085;O00763	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	no	no	0	0	0	1	0	1					16.838	16.838	2	0.0010996	8326	DP1141_6	128.38	128.38			83365000	1092	367;40	1049	1778	2400	2400		1	9606
MHLYLGAAK	Oxidation (M)	1018.527	0.52698659	367;40	Q13085;O00763	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	no	no	0	1	0	1	0	1					15.259	15.259	2	0.0098785	5698	DP1141_6	128.82	82.426			18974000	1093	367;40	1049	1779	2401	2401	35	0	9606
MIAGQVLDINLAAEPK	Oxidation (M)	1697.9022	0.9022068	124	P07910	HNRNPC	Heterogeneous nuclear ribonucleoproteins C1/C2	yes	yes	0	1	0	4	0				1		20.094	20.094	2	0.0073832	14011	DP1141_9	119.25	76.17			19104000	1094	124	1050	1780	2402	2402	116	1	9606
MIASQVVDINLAAEPKVNR	Oxidation (M)	2083.1096	0.10957381	0	A0A0G2JPF8;P0DMR1;O60812;B7ZW38	HNRNPCL4;HNRNPCL1;HNRNPCL3	Heterogeneous nuclear ribonucleoprotein C-like 4;Heterogeneous nuclear ribonucleoprotein C-like 1;Heterogeneous nuclear ribonucleoprotein C-like 3	yes	no	0	1	1	3	0			1			22.702	22.702	3	0.034478	17908	DP1141_8	46.121	18.157			34524000	1095	0	1051	1781	2403	2403	0	0	9606
MIDMLAANSGR	2 Oxidation (M)	1209.5482	0.54819232	445	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	yes	yes	0	2	0	1.33	0.471	2	1				15.26	15.26	2	0.0078801	5791	DP1141_6	92.538	42.725			25058000	1096	445	1052	1782;1783;1784	2404;2405;2406	2404	326;327	3	9606
MIMDDSKRK	2 Oxidation (M)	1154.5424	0.54237866	46	O14786	NRP1	Neuropilin-1	yes	yes	0	2	2	1	0	1					19.771	19.771	2	0.025528	13062	DP1141_6	71.715	21.083			0	1097	46	1053	1785	2407	2407	38;39	1	9606
MIMVEERLILQQKMVK	2 Oxidation (M)	2020.0883	0.088309782	5	B1AJZ9	FHAD1	Forkhead-associated domain-containing protein 1	yes	yes	0	2	2	1	0	1					18.823	18.823	3	0.035628	11582	DP1141_6	50.155	26.52			0	1098	5	1054	1786	2408	2408	4;5	1	9606
MIQMEPQFGGAPCPETVQRK	2 Oxidation (M)	2335.0759	0.075907195	566	Q9HCB6	SPON1	Spondin-1	yes	yes	0	2	1	1	0	1					20.786	20.786	3	0.035808	14630	DP1141_6	49.141	19.421			0	1099	566	1055	1787	2409	2409	403;404	1	9606
MIVDPVEPHGEMK	2 Oxidation (M)	1512.6953	0.69525049	372	Q13263	TRIM28	Transcription intermediary factor 1-beta	yes	yes	0	2	0	2	0		1				15.244	15.244	3	0.0010736	6444	DP1141_7	116.24	84.582			90979000	1100	372	1056	1788	2410	2410	292;293	1	9606
MKEIAEAYLGK	Unmodified	1251.6533	0.65330932	140	P11142	HSPA8	Heat shock cognate 71 kDa protein	yes	yes	0	0	1	3	0			2			17.135	17.135	2	3.7202E-23	9377	DP1141_8	178.46	84.151			0	1101	140	1057	1789;1790	2411;2412	2411		2	9606
MKEIAEAYLGYPVTNAVITVPAYFNDSQR	Oxidation (M)	3275.6173	0.61726475	135	P0DMV8;P0DMV9	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	yes	no	0	1	1	3	0			1			22.029	22.029	3	1.1587E-09	17008	DP1141_8	87.772	77.595			14248000	1102	135	1058	1791	2413	2413	128	1	9606
MKETAENYLGHTAK	Oxidation (M)	1607.7614	0.76135622	217	P38646	HSPA9	Stress-70 protein, mitochondrial	yes	yes	0	1	1	3	0			1			14.397	14.397	3	0.0064112	5062	DP1141_8	116.79	79.129			54088000	1103	217	1059	1792	2414	2414	180	1	9606
MKIELFADVVPK	Oxidation (M)	1404.7687	0.76867343	58	O43447	PPIH	Peptidyl-prolyl cis-trans isomerase H	yes	yes	0	1	1	5	0					1	19.41	19.41	3	0.03478	13556	DP1141_10	63.181	28.104			0	1104	58	1060	1793	2415	2415	50	1	9606
MKRHEMVAK	Acetyl (Protein N-term);Oxidation (M)	1186.5951	0.59508293	346	Q03924	ZNF117	Zinc finger protein 117	yes	yes	1	1	2	5	0					1	15.538	15.538	2	0.026403	7211	DP1141_10	67.494	21.037			0	1105	346	1061	1794	2416	2416	259	1	9606
MKVQDQDLPNTPHSK	Oxidation (M)	1752.8465	0.84648283	358	Q08554	DSC1	Desmocollin-1	yes	yes	0	1	1	1	0	1					13.847	13.847	3	0.0081317	3799	DP1141_6	108.66	81.714			962960	1106	358	1062	1795	2417	2417	261	1	9606
MLCDEEAQKRK	Acetyl (Protein N-term);Oxidation (M)	1464.6701	0.67009837	472	Q8N9Z0	ZNF610	Zinc finger protein 610	yes	yes	1	1	2	1	0	1					21.659	21.659	2	0.034607	15971	DP1141_6	50.04	13.723			0	1107	472	1063	1796	2418	2418	348	1	9606
MLGPEGGEGFVVK	Acetyl (Protein N-term);Oxidation (M)	1376.6646	0.66460229	266	P52597	HNRNPF	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed	yes	yes	1	1	0	4	0				1		20.422	20.422	2	0.0050013	14619	DP1141_9	82.831	36.829			17752000	1108	266	1064	1797	2419	2419	220	1	9606
MLGPEGGEGFVVK	Acetyl (Protein N-term)	1360.6697	0.66968766	266	P52597	HNRNPF	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed	yes	yes	1	0	0	4	0				1		22.16	22.16	2	0.00016214	17080	DP1141_9	139.43	100.68			14329000	1109	266	1064	1798	2420;2421	2420		2	9606
MLQPCGPPADKPEEN	Oxidation (M)	1697.7389	0.73890622	543	Q9BWJ5	SF3B5	Splicing factor 3B subunit 5	yes	yes	0	1	1	5	0					1	15.24	15.24	2	2.3056E-14	6855	DP1141_10	168.22	139.26			118620000	1110	543	1065	1799	2422	2422	389	1	9606
MLQPCGPPADKPEEN	Unmodified	1681.744	0.74399159	543	Q9BWJ5	SF3B5	Splicing factor 3B subunit 5	yes	yes	0	0	1	5	0					1	16.016	16.016	2	0.031707	8194	DP1141_10	116.74	103.62			49462000	1111	543	1065	1800	2423;2424	2423		2	9606
MLQYCLQGLFHPAR	Oxidation (M)	1748.8491	0.84906579	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	1	0	2	0		1				20.17	20.17	3	0.0017609	14144	DP1141_7	104.59	66.293			43061000	1112	78	1066	1801	2425;2426	2425	69	2	9606
MLVSGAGDIK	Oxidation (M)	1005.5165	0.51648149	220	Q92526;P40227	CCT6B;CCT6A	T-complex protein 1 subunit zeta-2;T-complex protein 1 subunit zeta	yes	no	0	1	0	4	0				1		15.598	15.598	2	0.01399	6775	DP1141_9	99.136	35.988			0	1113	220	1067	1802	2427	2427	181	1	9606
MMNQQRTKMEIK	3 Oxidation (M)	1584.7422	0.74221746	610	Q9Y2R2	PTPN22	Tyrosine-protein phosphatase non-receptor type 22	yes	yes	0	3	2	1	0	1					17.374	17.374	3	0.021558	9428	DP1141_6	50.354	8.0368			6750700	1114	610	1068	1803	2428	2428	420;421;422	1	9606
MMYGVSPWGDSPIDFEDSAHVPCPR	2 Oxidation (M)	2881.2146	0.21458552	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	2	0	1	0	1					20.812	20.812	3	1.5113E-06	14718	DP1141_6	87.793	74.722			10619000	1115	367	1069	1804	2429	2429	278;279	1	9606
MMYGVSPWGDSPIDFEDSAHVPCPR	Oxidation (M)	2865.2197	0.2196709	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	0	1	0	1					21.121	21.121	3	1.3141E-11	15262	DP1141_6	125.75	113.2			2108900	1116	367	1069	1805	2430	2430	278;279	1	9606
MNEVYTRLGEMNNAVR	2 Oxidation (M)	1927.888	0.88803007	477	Q8NHQ1	CEP70	Centrosomal protein of 70 kDa	yes	yes	0	2	1	3	0			1			20.201	20.201	2	0.032437	14141	DP1141_8	62.528	16.764			0	1117	477	1070	1806	2431	2431	354;355	1	9606
MNQPGGAAAPQADGASAAGR	Acetyl (Protein N-term)	1838.833	0.83295803	420	Q5T7W0	ZNF618	Zinc finger protein 618	yes	yes	1	0	0	1	0	1					15.663	15.663	3	0.01873	6313	DP1141_6	50.392	18.107			26317000	1118	420	1071	1807	2432	2432		0	9606
MNVLADALK	Oxidation (M)	989.52157	0.52156686	288	P62244	RPS15A	40S ribosomal protein S15a	yes	yes	0	1	0	5	0					1	18.207	18.207	2	0.029466	11650	DP1141_10	85.862	22.443			0	1119	288	1072	1808	2433	2433	232	1	9606
MPGGPKPGGGPGLSTPGGHPKPPHR	Unmodified	2369.2175	0.21750155	181	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	yes	yes	0	0	2	2.5	0.5		1	1			14.571	14.571	4	0.0043812	5307	DP1141_8	47.288	18.955			45062000	1120	181	1073	1809;1810	2434;2435	2435		2	9606
MPGGPKPGGGPGLSTPGGHPKPPHR	Oxidation (M)	2385.2124	0.21241617	181	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	yes	yes	0	1	2	3	0			2			14.086	14.086	4;5	4.4168E-06	4565	DP1141_8	88	57.588			57652000	1121	181	1073	1811;1812	2436;2437;2438	2436	159	3	9606
MPLPAPSLSHQPPPAPR	Oxidation (M)	1807.9403	0.94032364	250	P49750	YLPM1	YLP motif-containing protein 1	yes	yes	0	1	0	3	0			1			16.457	16.457	3	0.011677	8440	DP1141_8	62.237	44.691			11948000	1122	250	1074	1813	2439	2439	203	1	9606
MPMRVPEEVTLR	Acetyl (Protein N-term);2 Oxidation (M)	1530.7534	0.75343407	30	F8W1W9	NPIPB9	Nuclear pore complex-interacting protein family member B9	yes	yes	1	2	1	2	0		1				22.911	22.911	2	0.031491	18350	DP1141_7	52.482	22.09			0	1123	30	1075	1814	2440	2440	28;29	1	9606
MPWPFSESIKK	Oxidation (M)	1364.6799	0.67985842	503	Q96BY7	ATG2B	Autophagy-related protein 2 homolog B	yes	yes	0	1	1	2	0		1				15.595	15.595	2	0.0095942	6881	DP1141_7	78.113	15.039			5156900	1124	503	1076	1815	2441	2441	362	0	9606
MQGQEAVLAMSSR	Oxidation (M)	1422.6595	0.65953368	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	1	0	1	0	1					15.955	15.955	2	0.024864	6898	DP1141_6	111.52	80.956			12581000	1125	402	1077	1816	2442	2442	307;308	1	9606
MQGQEAVLAMSSR	2 Oxidation (M)	1438.6544	0.65444831	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	2	0	2	0		1				15.223	15.223	2	0.0062798	6368	DP1141_7	112.43	65.634			26567000	1126	402	1077	1817	2443	2443	307;308	1	9606
MREIVHLQAGQCGNQIGAK	Unmodified	2109.0572	0.057161084	323	P68371;P04350	TUBB4B;TUBB4A	Tubulin beta-4B chain;Tubulin beta-4A chain	yes	no	0	0	1	3	0			1			16.23	16.23	3	0.00070112	8075	DP1141_8	122.01	0			99293000	1127	323	1078	1818	2444	2444		1	9606
MRPGVACSVSQAQK	Unmodified	1517.7443	0.74426637	203	P32969	RPL9	60S ribosomal protein L9	yes	yes	0	0	1	5	0					1	14.372	14.372	3	0.031621	5365	DP1141_10	88.224	59.864			13221000	1128	203	1079	1819	2445	2445		1	9606
MRPGVACSVSQAQK	Oxidation (M)	1533.7392	0.73918099	203	P32969	RPL9	60S ribosomal protein L9	yes	yes	0	1	1	5	0					1	13.744	13.744	3	0.015867	4425	DP1141_10	87.083	63.011			0	1129	203	1079	1820	2446	2446	172	1	9606
MRPNSNTPVNETATASDSK	Oxidation (M)	2034.9276	0.92764628	48	O15014	ZNF609	Zinc finger protein 609	yes	yes	0	1	1	2	0		1				13.082	13.082	3	1.404E-05	3209	DP1141_7	110.56	86.51			1064600	1130	48	1080	1821	2447;2448	2447	40	2	9606
MSATFIGNSTAIQELFK	Oxidation (M)	1872.9291	0.92914983	323;381	P68371;Q13885;Q9BVA1	TUBB4B;TUBB2A;TUBB2B	Tubulin beta-4B chain;Tubulin beta-2A chain;Tubulin beta-2B chain	no	no	0	1	0	2.33	1.25	1	1		1		22.289	22.289	2	0	16925	DP1141_6	284.92	43.082			28833000	1131	323;381	1081	1822;1823;1824	2449;2450;2451;2452	2449	250	4	9606
MSAWAAASLSR	Acetyl (Protein N-term);Oxidation (M)	1207.5656	0.56555694	538	Q9BSH4	TACO1	Translational activator of cytochrome c oxidase 1	yes	yes	1	1	0	1	0	1					20.948	20.948	2	0.03558	14871	DP1141_6	53.775	27.67			0	1132	538	1082	1825	2453	2453	385	1	9606
MSGAFFMRRTFGGNK	2 Oxidation (M)	1737.8079	0.80792926	51	O15228	GNPAT	Dihydroxyacetone phosphate acyltransferase	yes	yes	0	2	2	4	0				1		16.042	16.042	3	0.025285	6751	DP1141_9	48.527	21.429			7010800	1133	51	1083	1826	2454	2454	44;45	1	9606
MSGEPIQTVESIR	Oxidation (M)	1461.7133	0.71334339	424	Q5VT52	RPRD2	Regulation of nuclear pre-mRNA domain-containing protein 2	yes	yes	0	1	0	2	0		1				17.859	17.859	2	0.0080248	10680	DP1141_7	126.03	88.47			0	1134	424	1084	1827	2455	2455	321	1	9606
MSMKEVDEQMLNVQNK	3 Oxidation (M)	1970.8747	0.87474777	122;323;381	P07437;P68371;Q13885;Q9BVA1	TUBB;TUBB4B;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-2A chain;Tubulin beta-2B chain	no	no	0	3	1	4.5	0.5				1	1	14.842	14.842	3	0.00040003	6067	DP1141_10	122.33	104.62			23098000	1135	122;323;381	1085	1828;1829	2456;2457;2458	2456	107;114;115	2	9606
MSRSPDAK	Acetyl (Protein N-term)	932.43857	0.43856552	93	O95628	CNOT4	CCR4-NOT transcription complex subunit 4	yes	yes	1	0	1	1	0	1					16.555	16.555	2	0.016804	7879	DP1141_6	73.975	10.827			4214100	1136	93	1086	1830	2459	2459		0	9606
MSVQPTVSLGGFEITPPVVLR	Oxidation (M)	2242.2031	0.20313984	120	P06748	NPM1	Nucleophosmin	yes	yes	0	1	0	4	0				1		22.705	22.705	3	3.452E-05	17996	DP1141_9	98.562	78.665			4946100	1137	120	1087	1831	2460	2460	105	1	9606
MTLDDFR	Oxidation (M)	912.40112	0.40111738	19	CON__P35527;P35527	KRT9	Keratin, type I cytoskeletal 9	yes	no	0	1	0	2.5	1.12	1	1	1	1		17.043	17.043	1;2	1.1184E-07	9273	DP1141_8	138.48	97.559		+	279880000	1138	19	1088	1832;1833;1834;1835	2461;2462;2463;2464;2465	2464	19	5	9606
MTPPIKDLLPR	Oxidation (M)	1295.7271	0.72714296	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	1	1	2	0		2				18.33	18.33	2;3	0.0092444	11114	DP1141_7	96.113	75.651			271520000	1139	78	1089	1836;1837	2466;2467;2468	2466	70	3	9606
MTPPIKDLLPR	Unmodified	1279.7322	0.73222834	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	2	0		1				18.9	18.9	3	0.025769	12399	DP1141_7	120.63	100.97			35168000	1140	78	1089	1838	2469	2469		1	9606
MTSASPEDQNAPVGCPK	Acetyl (Protein N-term);Oxidation (M)	1845.7873	0.78731297	517	Q96N96	SPATA13	Spermatogenesis-associated protein 13	yes	yes	1	1	0	1	0	1					20.167	20.167	3	0.035267	13666	DP1141_6	41.014	12.202			0	1141	517	1090	1839	2470	2470	365	1	9606
MTVPISITNPDLLR	Oxidation (M)	1584.8545	0.85452832	40	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	yes	yes	0	1	0	1	0	1					20.241	20.241	2	0.03067	13735	DP1141_6	92.866	64.662			5290300	1142	40	1091	1840	2471	2471	36	1	9606
MVAAVACAQVPK	Oxidation (M)	1259.6366	0.6366134	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	1	0	2.67	1.25	1		1	1		15.834	15.834	2	0.024426	7271	DP1141_8	115.71	64.438			1361000000	1143	567	1092	1841;1842;1843	2472;2473;2474	2473	406	3	9606
MVAAVACAQVPK	Unmodified	1243.6417	0.64169877	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	4	0				1		16.643	16.643	2	0.015672	8559	DP1141_9	110.87	42.501			11834000	1144	567	1092	1844	2475	2475		0	9606
MVGVGGGDVEDVTPR	Acetyl (Protein N-term)	1528.7192	0.71915705	128	P09038	FGF2	Fibroblast growth factor 2	yes	yes	1	0	0	1	0	1					20.339	20.339	2	0.03333	13949	DP1141_6	48.998	6.7554			18430000	1145	128	1093	1845	2476	2476		1	9606
MVGVGGGDVEDVTPR	Acetyl (Protein N-term);Oxidation (M)	1544.7141	0.71407167	128	P09038	FGF2	Fibroblast growth factor 2	yes	yes	1	1	0	1	0	1					20.438	20.438	2	0.016818	13485	DP1141_6	52.579	27.282			118540000	1146	128	1093	1846	2477	2477	122	0	9606
MVMETIEK	Unmodified	979.47184	0.47183948	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	2	0		1				16.566	16.566	2	1.0237E-05	8541	DP1141_7	143.11	41.895			61300000	1147	78	1094	1847	2478	2478		1	9606
MVNDAEKFAEEDKK	Unmodified	1652.7716	0.77158655	139	P11021	HSPA5	78 kDa glucose-regulated protein	yes	yes	0	0	2	3	0			1			15.188	15.188	4	0.0037761	6193	DP1141_8	109.16	75.109			3128000	1148	139	1095	1848	2479	2479		0	9606
MVPAGMGAGLER	2 Oxidation (M)	1219.5689	0.56892776	263	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	yes	yes	0	2	0	3	0			1			14.832	14.832	2	0.013147	5755	DP1141_8	76.282	45.67			16693000	1149	263	1096	1849	2480	2480	218;219	0	9606
MVQEAEKYKAEDEVQR	Oxidation (M)	1967.9259	0.92585536	135	P0DMV8;P0DMV9	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	yes	no	0	1	2	5	0					1	14.372	14.372	3	0.033739	5457	DP1141_10	70.26	31.748			13106000	1150	135	1097	1850	2481	2481	129	1	9606
MYVFGGWVPLVMDDVK	2 Oxidation (M)	1886.8947	0.89467858	259	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	yes	yes	0	2	0	2	0		1				22.858	22.858	2	0.019394	18303	DP1141_7	81.676	60.819			7836100	1151	259	1098	1851	2482	2482	207;208	1	9606
NACDHLSGFNVCNR	Unmodified	1662.6991	0.69910709	615	Q9Y3B4	SF3B6	Splicing factor 3B subunit 6	yes	yes	0	0	0	5	0					2	16.893	16.893	2;3	4.749499999999999E-280	9499	DP1141_10	278.38	206.06			822580000	1152	615	1099	1852;1853	2483;2484;2485	2484		3	9606
NAHSATTWSGQYVGGAEAR	Unmodified	1961.898	0.89800113	29	CON__Streptavidin			yes	yes	0	0	0	4	1.55	1			1	3	16.519	16.519	2;3;4	0	8869	DP1141_10	351.2	329.55		+	19188000000	1153	29	1100	1854;1855;1856;1857;1858	2486;2487;2488;2489;2490;2491;2492;2493;2494;2495;2496	2491		10	
NALESYAFNMK	Unmodified	1286.5965	0.59652272	135	P0DMV8;P0DMV9;P34931	HSPA1A;HSPA1B;HSPA1L	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like	yes	no	0	0	0	3	0			1			19.626	19.626	2	3.9705E-30	13249	DP1141_8	175.91	152.59			384660000	1154	135	1101	1859	2497	2497		1	9606
NALESYAFNMK	Oxidation (M)	1302.5914	0.59143734	135	P0DMV8;P0DMV9;P34931	HSPA1A;HSPA1B;HSPA1L	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like	yes	no	0	1	0	3	0			1			18.425	18.425	2	4.8211E-08	11485	DP1141_8	158.76	133.18			411830000	1155	135	1101	1860	2498	2498	130	0	9606
NALTTLAGPLTPPVK	Unmodified	1491.8661	0.86607929	560	Q9H3P2	NELFA	Negative elongation factor A	yes	yes	0	0	0	3	0			1			20.427	20.427	2	0.0023614	14413	DP1141_8	132.03	78.431			8437200	1156	560	1102	1861	2499;2500	2500		2	9606
NAMTSAPSKDQVQLK	Oxidation (M)	1632.8141	0.81412007	1	A3KN83	SBNO1	Protein strawberry notch homolog 1	yes	yes	0	1	1	1	0	1					14.315	14.315	3	0.0099151	4496	DP1141_6	90.861	52.092			1011300	1157	1	1103	1862	2501	2501	1	1	9606
NAQGIINPIEAK	Unmodified	1266.6932	0.6932003	586	Q9UBB9	TFIP11	Tuftelin-interacting protein 11	yes	yes	0	0	0	2	0		1				17.673	17.673	2	0.020273	10377	DP1141_7	113.44	59.67			0	1158	586	1104	1863	2502	2502		1	9606
NAVPITPTLNR	Unmodified	1194.6721	0.67207093	12	CON__P02663			yes	yes	0	0	0	4	0				1		17.288	17.288	2	0.014691	9564	DP1141_9	86.67	52.417		+	13080000	1159	12	1105	1864	2503	2503		1	
NDLAVVDVR	Unmodified	999.53491	0.53490874	171	P19338	NCL	Nucleolin	yes	yes	0	0	0	5	0					1	17.538	17.538	2	0.022396	10545	DP1141_10	82.75	24.521			6031700	1160	171	1106	1865	2504	2504		1	9606
NEPYQVVECAMR	Oxidation (M)	1510.6544	0.65444831	502	Q96AE7	TTC17	Tetratricopeptide repeat protein 17	yes	yes	0	1	0	3	0			1			17.424	17.424	3	0.035152	10060	DP1141_8	51.979	15.979			26932000	1161	502	1107	1866	2505	2505	361	1	9606
NFDLTAIPCANHK	Unmodified	1499.7191	0.71909747	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	2					18.454	18.454	2;3	0.0061085	11048	DP1141_6	95.483	59.819			192340000	1162	367	1108	1867;1868	2506;2507	2507		2	9606
NFGDQPDIR	Unmodified	1060.4938	0.49377221	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	0	2	0.816	1	1	1			16.545	16.545	2	0.000734	7852	DP1141_6	131.03	102.11			270120000	1163	402	1109	1869;1870;1871	2508;2509;2510;2511	2508		4	9606
NFYNEHEEITNLTPQQLIDLR	Unmodified	2586.2714	0.27143042	460	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	yes	yes	0	0	0	2	0		1				21.3	21.3	3	5.7162E-05	15991	DP1141_7	126.91	86.115			61336000	1164	460	1110	1872	2512	2512		1	9606
NGIAFMGPPSQAMWALGDK	2 Oxidation (M)	2021.9339	0.93391763	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	2	0	1	0	1					20.241	20.241	2	1.5261E-05	13941	DP1141_6	111.64	81.08			49643000	1165	367	1111	1873	2513	2513	280;281	1	9606
NGIAFMGPPSQAMWALGDK	Oxidation (M)	2005.939	0.93900301	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	0	1	0	1					21.335	21.335	2	0.0015507	15514	DP1141_6	123.63	95.395			30482000	1166	367	1111	1874	2514	2514	280;281	1	9606
NHEEEMLALR	Oxidation (M)	1256.5819	0.58193529	16	CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8	KRT16	Keratin, type I cytoskeletal 16	yes	no	0	1	0	4	0				1		15.353	15.353	2	2.3021E-07	6375	DP1141_9	157.34	131.54		+	14727000	1167	16	1112	1875	2515	2515	13	0	9606
NHPGLLLMDTTFR	Oxidation (M)	1529.766	0.76604767	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	1	0	2.6	1.02	1	1	2	1		18.647	18.647	2;3	5.8963E-05	11992	DP1141_7	144.28	84.442			460510000	1168	142	1113	1876;1877;1878;1879;1880	2516;2517;2518;2519;2520;2521;2522;2523	2518	144	7	9606
NHPGLLLMDTTFR	Unmodified	1513.7711	0.77113304	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	1.5	0.5	1	1				20.126	20.126	2;3	2.7100999999999997E-40	14004	DP1141_7	184.87	123.66			295560000	1169	142	1113	1881;1882	2524;2525;2526	2525		3	9606
NHQGPLPPVPLHLR	Unmodified	1573.8841	0.88412939	522	Q96S55	WRNIP1	ATPase WRNIP1	yes	yes	0	0	0	3	0			1			17.486	17.486	3	0.015895	9945	DP1141_8	62.732	30.255			13621000	1170	522	1114	1883	2527	2527		0	9606
NIETIINTFHQYSVK	Unmodified	1805.9312	0.93119874	119	P06702	S100A9	Protein S100-A9	yes	yes	0	0	0	5	0					1	21.409	21.409	2	0.022564	16684	DP1141_10	94.547	51.25			94950000	1171	119	1115	1884	2528	2528		1	9606
NIIHGSDSVESAEK	Unmodified	1484.7107	0.71070086	154	P15531	NME1	Nucleoside diphosphate kinase A	yes	yes	0	0	0	5	0					1	14.877	14.877	3	0.0051621	6145	DP1141_10	98.943	77.287			0	1172	154	1116	1885	2529	2529		1	9606
NIIVGFAR	Unmodified	888.51814	0.51813647	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	4	1			1		1	18.725	18.725	2	1.2332E-05	11978	DP1141_8	138.07	62.764			766680000	1173	111	1117	1886;1887	2530;2531	2531		1	9606
NITYLPAGQSVLLQLPQ	Unmodified	1854.0251	0.025099124	206	P35232	PHB	Prohibitin	yes	yes	0	0	0	5	0					1	23.519	23.519	2	0.00017104	19707	DP1141_10	118.9	64.419			15264000	1174	206	1118	1888	2532	2532		1	9606
NIVEAAAVR	Unmodified	941.52943	0.52942943	309	Q5JNZ5;P62854	RPS26P11;RPS26	Putative 40S ribosomal protein S26-like 1;40S ribosomal protein S26	yes	no	0	0	0	5	0					1	16.116	16.116	2	0.019603	8314	DP1141_10	84.743	39.408			27426000	1175	309	1119	1889	2533	2533		1	9606
NKFPGDSVVTGR	Unmodified	1275.6571	0.65714914	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	1	3	0			2			15.926	15.926	2;3	0.016727	7559	DP1141_8	87.831	36.554			137030000	1176	111	1120	1890;1891	2534;2535	2535		2	9606
NKHPDEDAVEAEGHEVKR	Unmodified	2058.9719	0.97189435	578	Q9NY27	PPP4R2	Serine/threonine-protein phosphatase 4 regulatory subunit 2	yes	yes	0	0	2	3.5	0.5			2	2		13.742	13.742	4;5	6.2296E-08	4107	DP1141_8	154.47	134.92			26566000	1177	578	1121	1892;1893;1894;1895	2536;2537;2538;2539;2540;2541;2542	2538		7	9606
NKLEGLEDALQKAK	Unmodified	1555.857	0.85697116	10;101	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;P04259	KRT6A;KRT6C;KRT6B	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 6B	no	no	0	0	2	4	0				1		18.087	18.087	3	0.021922	10747	DP1141_9	71.513	26.399		+	11418000	1178	10;101	1122	1896	2543	2543		1	9606
NKLNDLEDALQQAK	Unmodified	1598.8264	0.82639932	102	P04264;CON__P04264	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	0	1	1	0	1					19.355	19.355	2	0.01237	12606	DP1141_6	130.44	84.029		+	21615000	1179	102	1123	1897	2544	2544		1	9606
NKLNDLEDALQQAKEDLAR	Unmodified	2183.1182	0.11822424	102	P04264;CON__P04264	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	0	2	3.33	1.25		1	1		1	21.513	21.513	3	0	16298	DP1141_7	268.6	233.85		+	125850000	1180	102	1124	1898;1899;1900	2545;2546;2547	2546		3	9606
NKLNDLEEALQQAKEDLAR	Unmodified	2197.1339	0.1338743	20	CON__P35908v2;CON__P35908;P35908	KRT2	Keratin, type II cytoskeletal 2 epidermal	yes	no	0	0	2	2	0		1				21.6	21.6	3	0.022695	16579	DP1141_7	67.995	47.408		+	10164000	1181	20	1125	1901	2548	2548		1	9606
NKNPAPPIDAVEQILPTLVR	Unmodified	2184.2267	0.22665248	264	P52292	KPNA2	Importin subunit alpha-1	yes	yes	0	0	1	3	0			1			22.229	22.229	3	0.014191	17162	DP1141_8	86.258	70.597			12973000	1182	264	1126	1902	2549	2549		1	9606
NKYEDEINKR	Unmodified	1307.647	0.64697839	102;10;101;18;27	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;CON__Q8VED5;P05787;CON__P05787;CON__H-INV:HIT000016045;CON__P13647;P13647;CON__Q6IFZ6;P04259;P04264;CON__P04264	KRT6A;KRT6C;KRT8;KRT5;KRT6B;KRT1	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 8;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 1	no	no	0	0	2	3	1.58	1	1		1	1	14.202	14.202	3	1.2024E-40	4393	DP1141_6	194.94	150.98		+	56023000	1183	10;18;27;101;102	1127	1903;1904;1905;1906	2550;2551;2552;2553;2554;2555;2556;2557	2552		8	9606
NLDIERPTYTNLNR	Unmodified	1717.8747	0.87474649	321;442;322	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	no	no	0	0	1	3.5	0.5			1	1		17.656	17.656	3	0.00055002	10257	DP1141_8	138.24	101.95			998460000	1184	321;322;442	1128	1907;1908	2558;2559	2558		1	9606
NLDLDSIIAEVK	Unmodified	1328.7187	0.71874635	20;10;101;18	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;O95678;CON__O95678;CON__Q8VED5;CON__P13647;P13647;P04259;CON__P35908v2;CON__P35908;P35908;CON__Q5XKE5;Q5XKE5	KRT6A;KRT6C;KRT75;KRT5;KRT6B;KRT2;KRT79	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 75;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 2 epidermal;Keratin, type II cytoskeletal 79	no	no	0	0	0	3	0.816		1	1	1		22.567	22.567	2	1.5019E-05	17840	DP1141_7	150.15	100.44		+	113670000	1185	10;18;101;20	1129	1909;1910;1911	2560;2561;2562;2563;2564;2565	2560		6	9606
NLIQTLVSGIAPATR	Unmodified	1552.8937	0.89369102	484	Q8WVB6	CHTF18	Chromosome transmission fidelity protein 18 homolog	yes	yes	0	0	0	2	0		1				23.321	23.321	2	0.0018584	19038	DP1141_7	125.28	63.865			11145000	1186	484	1130	1912	2566;2567	2566		2	9606
NLNPHSTMDSILGALAPYAVLSSSNVR	Oxidation (M)	2842.4283	0.42834177	335	P98175	RBM10	RNA-binding protein 10	yes	yes	0	1	0	2	0		1				22.201	22.201	3	3.6295E-15	17322	DP1141_7	147.22	109.73			19183000	1187	335	1131	1913	2568;2569;2570;2571	2569	255	4	9606
NLPFDFTWK	Unmodified	1166.576	0.57604528	263	P52272	HNRNPM	Heterogeneous nuclear ribonucleoprotein M	yes	yes	0	0	0	3	0			1			22.329	22.329	2	0.014798	17440	DP1141_8	87.639	55.285			14705000	1188	263	1132	1914	2572	2572		1	9606
NLPLPPPPPPR	Unmodified	1193.6921	0.69207809	284	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	yes	yes	0	0	0	4	0.816			1	1	1	17.734	17.734	2	0.0044334	10523	DP1141_8	122.18	69.239			147010000	1189	284	1133	1915;1916;1917	2573;2574;2575;2576	2575		4	9606
NMDAIIVDSEK	Oxidation (M)	1249.586	0.58601761	389	Q14683	SMC1A	Structural maintenance of chromosomes protein 1A	yes	yes	0	1	0	2	0		1				16.361	16.361	2	0.0086452	8223	DP1141_7	97.734	46.388			0	1190	389	1134	1918	2577	2577	300	1	9606
NMGGPYGGGNYGPGGSGGSGGYGGR	Oxidation (M)	2204.893	0.89299211	179	P22626	HNRNPA2B1	Heterogeneous nuclear ribonucleoproteins A2/B1	yes	yes	0	1	0	4	0				1		16.508	16.508	2	0.00058225	8470	DP1141_9	71.143	65.827			26543000	1191	179	1135	1919	2578	2578	157	1	9606
NMQDMVEDYR	2 Oxidation (M)	1331.5122	0.51220074	102	P04264;CON__P04264	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	2	0	3	1.41	1	1	1	1	1	15.374	15.374	2	0.0043871	6627	DP1141_7	108.57	88.429		+	186560000	1192	102	1136	1920;1921;1922;1923;1924	2579;2580;2581;2582;2583;2584;2585;2586;2587	2583	84;85	9	9606
NMQDMVEDYR	Oxidation (M)	1315.5173	0.51728612	102	P04264;CON__P04264	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	1	0	2.67	1.25	1		1	1		16.989	16.989	2	0.0037615	9105	DP1141_8	113.71	95.034		+	116800000	1193	102	1136	1925;1926;1927	2588;2589;2590	2589	84;85	2	9606
NMQDMVEDYR	Unmodified	1299.5224	0.5223715	102	P04264;CON__P04264	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	0	0	4	0				1		18.625	18.625	2	6.686299999999999E-21	11768	DP1141_9	187.22	144.13		+	4197700	1194	102	1136	1928	2591	2591		1	9606
NMQDMVEDYRNK	2 Oxidation (M)	1573.6501	0.65009121	102	P04264;CON__P04264	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	2	1	1	0	1					14.262	14.262	3	0.032785	4410	DP1141_6	58.754	44.5		+	1161800	1195	102	1137	1929	2592	2592	84;85	1	9606
NMSVHLSPCFR	Oxidation (M)	1362.6173	0.61727494	295	P62280	RPS11	40S ribosomal protein S11	yes	yes	0	1	0	5	0					1	16.51	16.51	3	0.020547	8939	DP1141_10	70.942	46.71			90957000	1196	295	1138	1930	2593	2593	235	0	9606
NMVPQQALVIR	Oxidation (M)	1283.702	0.70199085	147;106	P05023;P13637;P50993;Q13733	ATP1A1;ATP1A3;ATP1A2;ATP1A4	Sodium/potassium-transporting ATPase subunit alpha-1;Sodium/potassium-transporting ATPase subunit alpha-3;Sodium/potassium-transporting ATPase subunit alpha-2;Sodium/potassium-transporting ATPase subunit alpha-4	no	no	0	1	0	1	0	1					17.455	17.455	2	0.016517	9371	DP1141_6	125.31	61.781			22335000	1197	106;147	1139	1931	2594	2594	89	1	9606
NMVQTAVVPVK	Oxidation (M)	1200.6536	0.65364367	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	1	0	3.5	1.12		1	1	1	1	15.825	15.825	2	2.0684E-65	7117	DP1141_9	200.56	159.11			1434900000	1198	365	1140	1932;1933;1934;1935	2595;2596;2597;2598;2599;2600	2599	264	6	9606
NMVQTAVVPVK	Unmodified	1184.6587	0.65872905	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	0	3	1.63	1		1		1	17.138	17.138	2	0.0031579	9827	DP1141_10	125.68	86.429			317200000	1199	365	1140	1936;1937;1938	2601;2602;2603	2601		2	9606
NMVQTAVVPVKK	Oxidation (M)	1328.7486	0.74860669	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	1	1	3	1.41	2	2	2	2	2	14.385	14.385	2;3	3.7316E-30	5060	DP1141_7	182.39	134.52			3266699999.9999995	1200	365	1141	1939;1940;1941;1942;1943;1944;1945;1946;1947;1948	2604;2605;2606;2607;2608;2609;2610;2611;2612;2613;2614;2615;2616;2617;2618;2619;2620;2621;2622;2623;2624	2612	264	21	9606
NMVQTAVVPVKK	Unmodified	1312.7537	0.75369207	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	1	3.2	1.33	1		2	1	1	15.599	15.599	2;3	5.7418E-06	6930	DP1141_8	122.55	110.49			610950000	1201	365	1141	1949;1950;1951;1952;1953	2625;2626;2627;2628;2629	2628		4	9606
NNASTDYDLSDK	Unmodified	1341.5685	0.56845329	219	P39023	RPL3	60S ribosomal protein L3	yes	yes	0	0	0	1	0	1					15.677	15.677	2	0.013359	6600	DP1141_6	86.014	66.024			5147900	1202	219	1142	1954	2630	2630		1	9606
NNFAVGYR	Unmodified	939.45626	0.45626449	231	P45880	VDAC2	Voltage-dependent anion-selective channel protein 2	yes	yes	0	0	0	4	0				1		16.643	16.643	2	0.00022212	8536	DP1141_9	128.82	58.548			30452000	1203	231	1143	1955	2631	2631		1	9606
NNTQVLINCR	Unmodified	1230.6139	0.61390412	298	P62316	SNRPD2	Small nuclear ribonucleoprotein Sm D2	yes	yes	0	0	0	5	0					1	16.116	16.116	2	1.0166E-13	8045	DP1141_10	166.68	125.65			35513000	1204	298	1144	1956	2632	2632		1	9606
NPDLCDFTIDHQSCSR	Unmodified	1963.8153	0.81525906	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	0	3	1.49	2	2	1	2	2	18.16	18.16	2;3	0	11057	DP1141_9	299.2	289.42			3158199999.9999995	1205	365	1145	1957;1958;1959;1960;1961;1962;1963;1964;1965	2633;2634;2635;2636;2637;2638;2639;2640;2641;2642;2643;2644;2645;2646;2647	2646		13	9606
NPPNQSSNERPPSLLVIETK	Unmodified	2219.1546	0.15460975	49	O15042	U2SURP	U2 snRNP-associated SURP motif-containing protein	yes	yes	0	0	1	2	0		1				18.099	18.099	3	0.014619	11235	DP1141_7	92.236	74.452			108760000	1206	49	1146	1966	2648	2648		1	9606
NPSGINDDYGQLK	Unmodified	1419.663	0.66302238	68	O60934	NBN	Nibrin	yes	yes	0	0	0	4	0				1		16.997	16.997	2	0.012706	9136	DP1141_9	97.813	54.301			9183700	1207	68	1147	1967	2649	2649		0	9606
NQLTSNPENTVFDAKR	Unmodified	1832.9017	0.90168952	139	P11021	HSPA5	78 kDa glucose-regulated protein	yes	yes	0	0	1	3	0			1			17.093	17.093	3	0.0014429	9336	DP1141_8	108.36	85.502			0	1208	139	1148	1968	2650	2650		1	9606
NQTGDVACGSYTLWEEDLK	Unmodified	2184.9634	0.96336308	557	Q9H227	GBA3	Cytosolic beta-glucosidase	yes	yes	0	0	0	2	0		1				14.927	14.927	3	0.012314	5926	DP1141_7	49.343	22.019			0	1209	557	1149	1969	2651	2651		1	9606
NQVALNPQNTVFDAK	Unmodified	1657.8424	0.84238373	135	P0DMV8;P0DMV9	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	yes	no	0	0	0	3.25	1.48	1		1	1	1	18.526	18.526	2	7.5851E-56	11622	DP1141_8	210.95	168.48			1645999999.9999998	1210	135	1150	1970;1971;1972;1973	2652;2653;2654;2655;2656;2657	2656		5	9606
NQVALNPQNTVFDAKR	Unmodified	1813.9435	0.94349476	135	P0DMV8;P0DMV9	HSPA1A;HSPA1B	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B	yes	no	0	0	1	4	1			1		1	17.424	17.424	3	4.7272E-36	9915	DP1141_8	178.67	139.69			60688000	1211	135	1151	1974;1975	2658;2659	2659		1	9606
NQVAMNPTNTVFDAK	Oxidation (M)	1664.7828	0.78281994	140	P11142	HSPA8	Heat shock cognate 71 kDa protein	yes	yes	0	1	0	4	0.816			1	1	1	17.13	17.13	2	6.3031E-30	9470	DP1141_8	179.35	142.37			95609000	1212	140	1152	1976;1977;1978	2660;2661;2662;2663	2661	135	4	9606
NREEEWDPEYTPK	Unmodified	1691.7427	0.74272927	612	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	yes	yes	0	0	1	2	0		1				17.099	17.099	2	0.0036361	9476	DP1141_7	139.31	108.12			37236000	1213	612	1153	1979	2664	2664		1	9606
NRPLSDEELDAMFPEGYK	Oxidation (M)	2125.9626	0.9626348	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	1	1	2.33	0.471		2	1			18.613	18.613	2;3	0.00018189	11814	DP1141_8	115.56	86.928			111650000	1214	78	1154	1980;1981;1982	2665;2666;2667	2667	71	3	9606
NRPLSDEELDAMFPEGYK	Unmodified	2109.9677	0.96772018	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	2	0		2				20.1	20.1	2;3	4.4522E-09	14257	DP1141_7	144.4	103.02			208360000	1215	78	1154	1983;1984	2668;2669;2670	2670		3	9606
NRWDETPKTER	Unmodified	1430.6902	0.69024019	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	2	2	0		1				14.152	14.152	3	0.018164	4777	DP1141_7	81.676	49.052			24430000	1216	78	1155	1985	2671	2671		1	9606
NSDEADLVPAK	Unmodified	1157.5564	0.55643205	331	P83916	CBX1	Chromobox protein homolog 1	yes	yes	0	0	0	5	0					1	15.826	15.826	2	0.0055648	7559	DP1141_10	114.5	70.845			31587000	1217	331	1156	1986	2672	2672		1	9606
NSMHVDMADEAYSIGPAPSQQSYLSMEK	Oxidation (M)	3101.3416	0.34163653	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	1	0	3	0			1			19.125	19.125	3	2.4346E-13	12520	DP1141_8	128.91	117.14			17368000	1218	521	1157	1987	2673;2674	2673	374	2	9606
NSNPDEIEIDFETLKPSTLR	Unmodified	2317.1438	0.14377029	66	O60885	BRD4	Bromodomain-containing protein 4	yes	yes	0	0	1	2	0		1				20.8	20.8	3	7.934E-07	15273	DP1141_7	94.856	65.582			10718000	1219	66	1158	1988	2675	2675		0	9606
NSSYFVEWIPNNVK	Unmodified	1695.8257	0.82567103	122;323;381;376	P07437;P68371;P04350;Q13885;Q9BVA1;Q13509	TUBB;TUBB4B;TUBB4A;TUBB2A;TUBB2B;TUBB3	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain	no	no	0	0	0	4	0				1		21.388	21.388	2	0.0064228	16107	DP1141_9	106.16	77.199			29146000	1220	122;323;381;376	1159	1989	2676	2676		1	9606
NSVSNFLHSLER	Unmodified	1401.7001	0.70007659	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					20.393	20.393	3	0.012666	14018	DP1141_6	116.74	80.053			0	1221	367	1160	1990	2677	2677		1	9606
NSVTPDMMEEMYKK	3 Oxidation (M)	1749.726	0.72595827	233	P46777	RPL5	60S ribosomal protein L5	yes	yes	0	3	1	2.5	1.5	1			1		14.036	14.036	3	0.013854	4197	DP1141_6	55.261	42.113			7400500	1222	233	1161	1991;1992	2678;2679	2678	187;188;189	2	9606
NTCEAVVLGTLHPR	Unmodified	1565.7984	0.79841043	571	Q9NQT4	EXOSC5	Exosome complex component RRP46	yes	yes	0	0	0	5	0					1	18.137	18.137	3	0.0191	11609	DP1141_10	53.946	34.66			47808000	1223	571	1162	1993	2680	2680		1	9606
NVKEDSTADDSKDSVAQGTTNVHSSEHAGR	Unmodified	3141.4195	0.41950423	232	P46013	MKI67	Antigen KI-67	yes	yes	0	0	2	2.5	0.5		1	1			13.228	13.228	5	1.3969E-10	3085	DP1141_7	92.613	69.481			18304000	1224	232	1163	1994;1995	2681;2682;2683	2681		3	9606
NVLLDPQLVPGGGASEMAVAHALTEK	Oxidation (M)	2632.3531	0.35305156	246	P49368	CCT3	T-complex protein 1 subunit gamma	yes	yes	0	1	0	3	0			1			21.128	21.128	3	1.8514E-08	15527	DP1141_8	88.001	66.385			18348000	1225	246	1164	1996	2684	2684	199	0	9606
NVQDAIADAEQR	Unmodified	1328.6321	0.6320566	20	CON__P35908v2;CON__P35908;P35908	KRT2	Keratin, type II cytoskeletal 2 epidermal	yes	no	0	0	0	2	1	1		1			17.763	17.763	2	2.0788E-66	9971	DP1141_6	201.84	144.29		+	17589000	1226	20	1165	1997;1998	2685;2686	2685		2	9606
NVQLQENEIR	Unmodified	1241.6364	0.6364137	212	P36873	PPP1CC	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	yes	yes	0	0	0	4	0.816			1	1	1	16.321	16.321	2	0.0037612	8465	DP1141_10	124.23	81.632			6564599999.999999	1227	212	1166	1999;2000;2001	2687;2688;2689;2690	2687		3	9606
NVQLSLLTER	Unmodified	1171.6561	0.65608651	254	P49959	MRE11A	Double-strand break repair protein MRE11A	yes	yes	0	0	0	3	0			1			19.426	19.426	2	0.0044792	12891	DP1141_8	105.1	69.656			14988000	1228	254	1167	2002	2691	2691		0	9606
NVQLTENEIR	Unmodified	1214.6255	0.62551466	286	P62136	PPP1CA	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit	yes	yes	0	0	0	4	0				1		16.752	16.752	2	1.6995E-08	8706	DP1141_9	159.58	95.32			133030000	1229	286	1168	2003	2692	2692		1	9606
NVSEELDRTPPEVSK	Unmodified	1698.8424	0.84244331	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	1	1.33	0.471	2	1				16.325	16.325	2;3	1.4002E-53	7744	DP1141_6	167.03	109.5			155240000	1230	402	1169	2004;2005;2006	2693;2694;2695;2696	2695		4	9606
NVSTGDVNVEMNAAPGVDLTQLLNNMR	2 Oxidation (M)	2903.3753	0.37531992	17	CON__P13645;P13645	KRT10	Keratin, type I cytoskeletal 10	yes	no	0	2	0	1.67	0.943	2		1			21.469	21.469	2;3	1.1096E-06	15772	DP1141_6	93.768	73.834		+	21295000	1231	17	1170	2007;2008;2009	2697;2698;2699	2698	15;16	3	9606
PAGPVQAVPPPPPVPTEPK	Unmodified	1874.0302	0.030184501	405	Q15459	SF3A1	Splicing factor 3A subunit 1	yes	yes	0	0	0	2	0		1				18.099	18.099	2	0.0052188	10886	DP1141_7	83.877	50.604			10497000	1232	405	1171	2010	2700	2700		1	9606
PEFLEDPSVLTK	Acetyl (Protein N-term)	1415.7184	0.718412	225	P42166	TMPO	Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin	yes	yes	1	0	0	3	0			1			20.901	20.901	2	0.0052723	15169	DP1141_8	102.95	76.513			0	1233	225	1172	2011	2701	2701		1	9606
PGASLPPLDLQALEK	Unmodified	1547.8559	0.85590853	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2.33	1.25	1	1		1		20.995	20.995	2	7.7959E-69	15591	DP1141_7	201.09	155.5			262040000	1234	142	1173	2012;2013;2014	2702;2703;2704;2705;2706;2707	2703		6	9606
PGETEEPRPPEQQDQEGGEAAK	Unmodified	2378.0622	0.062225504	515	Q96JP5	ZFP91	E3 ubiquitin-protein ligase ZFP91	yes	yes	0	0	1	3	0			1			14.492	14.492	3	4.3856E-05	5235	DP1141_8	100.27	86.535			30976000	1235	515	1174	2015	2708	2708		1	9606
PGGGPGLSTPGGHPKPPHR	Unmodified	1801.9336	0.93359877	181	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	yes	yes	0	0	1	2.5	0.5		1	1			13.913	13.913	4	4.5278E-08	4389	DP1141_7	115.04	97.491			59717000	1236	181	1175	2016;2017	2709;2710	2709		1	9606
PLTMTKATYCKPHMQTK	Oxidation (M)	2051.0002	0.000223056	589	Q9UBW7	ZMYM2	Zinc finger MYM-type protein 2	yes	yes	0	1	2	5	0					1	20.384	20.384	2	0.031385	15021	DP1141_10	97.163	10.252			0	1237	589	1176	2018	2711	2711	415	1	9606
PLVLPSPLVTPGSNSQER	Unmodified	1890.0211	0.021076378	520	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	yes	yes	0	0	0	2	0		1				20.301	20.301	2	3.2371E-22	14523	DP1141_7	155.14	112.93			62520000	1238	520	1177	2019	2712	2712		0	9606
PMIHELLTEGR	Oxidation (M)	1310.6653	0.66527099	395	Q14974	KPNB1	Importin subunit beta-1	yes	yes	0	1	0	2	0		1				17.003	17.003	3	0.032579	9344	DP1141_7	54.486	23.662			7924700	1239	395	1178	2020	2713	2713	305	1	9606
PVIVEPLEQLDDEDGLPEK	Unmodified	2134.0681	0.06814573	181	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	yes	yes	0	0	0	2	0		1				21.251	21.251	2	5.1834E-104	15880	DP1141_7	231.07	192.49			0	1240	181	1179	2021	2714	2714		1	9606
PVQMMFMKKK	3 Oxidation (M)	1314.6498	0.64982062	242	P48595	SERPINB10	Serpin B10	yes	yes	0	3	2	3	0			1			16.672	16.672	2	0.035659	8641	DP1141_8	44.117	8.5754			0	1241	242	1180	2022	2715	2715	192;193;194	1	9606
PYGLDWAELSR	Unmodified	1305.6354	0.63535107	42	O14525	ASTN1	Astrotactin-1	yes	yes	0	0	0	1.5	0.5	1	1				18.272	18.272	2	0.021565	11359	DP1141_7	104.06	21.631			1171500000	1242	42	1181	2023;2024	2716;2717	2717		1	9606
QAASSLQQASLK	Unmodified	1230.6568	0.65681479	217	P38646	HSPA9	Stress-70 protein, mitochondrial	yes	yes	0	0	0	3	0			1			15.42	15.42	2	0.0026841	6534	DP1141_8	131.82	84.161			43135000	1243	217	1182	2025	2718	2718		1	9606
QADVFPDR	Unmodified	946.45084	0.45084476	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3	0			1			16.326	16.326	2	0.00046438	8105	DP1141_8	98.629	54.513			67708000	1244	567	1183	2026	2719	2719		0	9606
QADVFPDRDHFGR	Unmodified	1558.7277	0.72768832	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	1	3	0			1			16.612	16.612	2	2.2494000000000002E-20	8450	DP1141_8	173.24	145.22			87489000	1245	567	1184	2027	2720;2721	2720		2	9606
QAQIEVVPSASALIIK	Unmodified	1665.9665	0.96652161	197	P30050	RPL12	60S ribosomal protein L12	yes	yes	0	0	0	5	0					1	20.526	20.526	2	4.7633E-06	15097	DP1141_10	129.74	97.126			15871000	1246	197	1185	2028	2722	2722		0	9606
QAVDFLSNEGHIYSTVDDDHFK	Unmodified	2536.1506	0.15064658	156	P15927	RPA2	Replication protein A 32 kDa subunit	yes	yes	0	0	0	4	0				1		19.428	19.428	4	0.019457	13140	DP1141_9	43.463	26.786			26470000	1247	156	1186	2029	2723	2723		1	9606
QAVDVSPLR	Unmodified	983.53999	0.53999412	237	P46782	RPS5	40S ribosomal protein S5;40S ribosomal protein S5, N-terminally processed	yes	yes	0	0	0	5	0					1	16.576	16.576	2	0.034505	8926	DP1141_10	75.043	30.649			11788000	1248	237	1187	2030	2724	2724		1	9606
QAVTNPNNTFYATK	Unmodified	1567.7631	0.76307078	217	P38646	HSPA9	Stress-70 protein, mitochondrial	yes	yes	0	0	0	3	0			1			16.595	16.595	2	0.027114	8520	DP1141_8	69.672	42.368			17437000	1249	217	1188	2031	2725	2725		1	9606
QCCGTDGVEANYIK	Unmodified	1613.6814	0.68139134	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	2	0		1				16.781	16.781	2	0.0013604	8951	DP1141_7	141.89	120.49			174820000	1250	78	1189	2032	2726;2727	2726		2	9606
QEGIIFIGPPPSAIR	Unmodified	1593.8879	0.88787736	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	0	3	1.41	1	1	1	1	1	21.008	21.008	2	1.3263000000000002E-68	15323	DP1141_9	244.18	244.18			550020000	1251	521	1190	2033;2034;2035;2036;2037	2728;2729;2730;2731;2732;2733;2734;2735;2736;2737	2735		9	9606
QELSHALYQHDAACR	Unmodified	1797.8217	0.82166506	603	Q9UMS4	PRPF19	Pre-mRNA-processing factor 19	yes	yes	0	0	0	3	0			1			15.312	15.312	3	0.0032996	6416	DP1141_8	113.37	78.449			13140000	1252	603	1191	2038	2738	2738		1	9606
QEQVTAAVAHAVEQQMQK	Oxidation (M)	2010.9793	0.97928792	463	Q8IWX8	CHERP	Calcium homeostasis endoplasmic reticulum protein	yes	yes	0	1	0	2	0		1				17.853	17.853	3	9.0617E-05	10772	DP1141_7	102.36	74.329			43068000	1253	463	1192	2039	2739	2739	343	1	9606
QESGSEIHVEVK	Unmodified	1340.6572	0.65720872	232	P46013	MKI67	Antigen KI-67	yes	yes	0	0	0	3	0			1			14.974	14.974	3	0.012416	5849	DP1141_8	74.611	34.114			2092300	1254	232	1193	2040	2740	2740		0	9606
QEYDESGPSIVHR	Unmodified	1515.6954	0.69538514	277;318	P60709;Q6S8J3;A5A3E0;Q9BYX7;P0CG38;P0CG39;P63261	ACTB;POTEE;POTEF;POTEKP;POTEI;POTEJ;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;POTE ankyrin domain family member E;POTE ankyrin domain family member F;Putative beta-actin-like protein 3;Putative beta-actin-like protein 3, N-terminally processed;POTE ankyrin domain family member I;POTE ankyrin domain family member J;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	no	no	0	0	0	4	0				1		15.722	15.722	2	0.0099149	7036	DP1141_9	96.113	52.479			20020000	1255	277;318	1194	2041	2741	2741		0	9606
QFSSADEAALKEPIIK	Unmodified	1745.92	0.91996535	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	1	4	0				1		18.021	18.021	3	0.017817	10773	DP1141_9	147.12	102.61			0	1256	567	1195	2042	2742	2742		1	9606
QFSSADEAALKEPIIKK	Unmodified	1874.0149	0.014928368	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	2	3	0			1			16.878	16.878	3	0.004676	8891	DP1141_8	130.95	104.75			20991000	1257	567	1196	2043	2743	2743		1	9606
QFSSSYLSR	Unmodified	1073.5142	0.5141733	19	CON__P35527;P35527	KRT9	Keratin, type I cytoskeletal 9	yes	no	0	0	0	4	0				1		17.122	17.122	2	0.022727	9309	DP1141_9	82.426	25.705		+	7965500	1258	19	1197	2044	2744	2744		1	9606
QGDEVSVHYDPMIAK	Oxidation (M)	1703.7825	0.78248559	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	1	0	2.75	1.09	1		2	1		16.669	16.669	2;3	0.003621	8126	DP1141_6	85.163	70.174			693820000	1259	521	1198	2045;2046;2047;2048	2745;2746;2747;2748	2745	375	4	9606
QGDEVSVHYDPMIAK	Unmodified	1687.7876	0.78757097	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	0	1	0	1					17.534	17.534	3	0.0015686	9507	DP1141_6	115.12	67.873			0	1260	521	1198	2049	2749	2749		1	9606
QGILGAQPQLIFQPHR	Unmodified	1801.9951	0.9951364	467	Q8N163	CCAR2	Cell cycle and apoptosis regulator protein 2	yes	yes	0	0	0	2	0		1				19.968	19.968	3	0.0008157	14029	DP1141_7	89.26	56.557			13683000	1261	467	1199	2050	2750	2750		1	9606
QGIVTPIEAQTR	Unmodified	1311.7147	0.71466402	335	P98175	RBM10	RNA-binding protein 10	yes	yes	0	0	0	2	0		1				17.199	17.199	2	0.005173	9584	DP1141_7	104.52	43.17			25367000	1262	335	1200	2051	2751	2751		1	9606
QGPLHGMLINTPYVTK	Oxidation (M)	1783.9291	0.92909025	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	0	1	0	2					17.768	17.768	2;3	0.004719	9820	DP1141_6	80.719	43.194			211330000	1263	367	1201	2052;2053	2752;2753;2754	2752	282	3	9606
QGPLHGMLINTPYVTK	Unmodified	1767.9342	0.93417563	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	2					19.05	19.05	2;3	2.8423E-06	11961	DP1141_6	153.41	83.536			107490000	1264	367	1201	2054;2055	2755;2756;2757	2756		3	9606
QGPQHGMLINTPYVTK	Oxidation (M)	1798.9036	0.90360378	40	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	yes	yes	0	1	0	1	0	1					16.635	16.635	3	0.033425	8135	DP1141_6	47.537	24.552			12504000	1265	40	1202	2056	2758	2758	37	1	9606
QGTIFLAGPPLVK	Unmodified	1339.7864	0.7863724	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	2.67	1.25	1		1	1		20.417	20.417	2	0.00047882	14627	DP1141_8	127.76	109.54			742600000	1266	567	1203	2057;2058;2059	2759;2760;2761;2762;2763;2764;2765;2766;2767	2763		9	9606
QGVDADINGLR	Unmodified	1156.5836	0.58364985	19	CON__P35527;P35527	KRT9	Keratin, type I cytoskeletal 9	yes	no	0	0	0	2.5	1.5	1			1		17.383	17.383	2	2.4166E-160	9280	DP1141_6	223.88	126.28		+	0	1267	19	1204	2060;2061	2768;2769	2768		2	9606
QHHPPYHQQHHQGPPPGGPGGR	Unmodified	2402.1278	0.12777534	181	P23246	SFPQ	Splicing factor, proline- and glutamine-rich	yes	yes	0	0	0	2.5	0.5		2	2			12.581	12.581	4;5	0.00015747	2803	DP1141_7	93.812	69.901			64205000	1268	181	1205	2062;2063;2064;2065	2770;2771;2772;2773;2774;2775;2776	2770		7	9606
QHPVPPPAQNQNQVR	Unmodified	1708.8757	0.87574954	408	Q15942	ZYX	Zyxin	yes	yes	0	0	0	3	0			1			13.526	13.526	3	0.0070251	3852	DP1141_8	73.219	34.82			489790	1269	408	1206	2066	2777;2778	2778		2	9606
QIDATFVR	Unmodified	948.50288	0.50288033	404	Q15435	PPP1R7	Protein phosphatase 1 regulatory subunit 7	yes	yes	0	0	0	4	0				1		17.248	17.248	2	0.0067334	9454	DP1141_9	113.7	59.171			19718000	1270	404	1207	2067	2779	2779		1	9606
QITVNDLPVGR	Unmodified	1210.667	0.66698555	348	Q06830;P32119	PRDX1;PRDX2	Peroxiredoxin-1;Peroxiredoxin-2	yes	no	0	0	0	5	0					1	18.337	18.337	2	1.7912E-05	11887	DP1141_10	152.11	89.453			83405000	1271	348	1208	2068	2780	2780		1	9606
QKADEAYLIGR	Unmodified	1262.6619	0.66190017	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	1	3	2	1				1	16.433	16.433	2	0.011535	7586	DP1141_6	93.649	67.533			19282000	1272	142	1209	2069;2070	2781;2782	2782		1	9606
QKNTNEEDDEVREAMTR	Oxidation (M)	2079.9127	0.9127245	254	P49959	MRE11A	Double-strand break repair protein MRE11A	yes	yes	0	1	2	3	0			1			14.013	14.013	4	0.030455	4237	DP1141_8	53.946	38.692			7330600	1273	254	1210	2071	2783	2783	204	0	9606
QLASGLLLVTGPLVLNR	Unmodified	1763.0669	0.066904359	343	Q02878	RPL6	60S ribosomal protein L6	yes	yes	0	0	0	4	0				1		23.106	23.106	2	1.2508E-09	18539	DP1141_9	155.88	128.02			3394200	1274	343	1211	2072	2784;2785	2784		2	9606
QLDNIVGER	Unmodified	1042.5407	0.5407224	101	P04259	KRT6B	Keratin, type II cytoskeletal 6B	yes	yes	0	0	0	4	0				1		16.732	16.732	2	0.0066678	8626	DP1141_9	116.73	41.616			17232000	1275	101	1212	2073	2786	2786		1	9606
QLDSIVGER	Unmodified	1015.5298	0.52982336	10;18	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;CON__P13647;P13647	KRT6A;KRT6C;KRT5	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 5	no	no	0	0	0	4	0				1		16.821	16.821	2	0.00058868	8774	DP1141_9	132.08	45.612		+	158300000	1276	10;18	1213	2074	2787;2788	2787		2	9606
QLFHPEQLITGK	Unmodified	1409.7667	0.76669959	321;442;322	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	no	no	0	0	0	3.5	0.5			1	1		18.957	18.957	3	0.0027143	12288	DP1141_8	101.56	0			196990000	1277	321;322;442	1214	2075;2076	2789;2790	2789		2	9606
QLFHPEQLITGKEDAANNYAR	Unmodified	2414.1979	0.19787154	321;442;322	P68363;P68366;Q71U36;P0DPH8;P0DPH7	TUBA1B;TUBA4A;TUBA1A	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain	no	no	0	0	1	3.5	0.5			2	2		18.614	18.614	3;4	6.7726E-175	11813	DP1141_8	247.3	207.95			755820000	1278	321;322;442	1215	2077;2078;2079;2080	2791;2792;2793;2794;2795	2793		5	9606
QLQAAAAHWQQHQQHR	Unmodified	1936.9517	0.95170846	250	P49750	YLPM1	YLP motif-containing protein 1	yes	yes	0	0	0	2	0		1				14.259	14.259	4	0.0062828	5014	DP1141_7	108.32	75.794			4110900	1279	250	1216	2081	2796	2796		1	9606
QLTEEDGVHSVIEENIK	Unmodified	1938.9535	0.95345032	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	2.33	1.89	2				1	18.324	18.324	2;3	4.9136999999999995E-124	10872	DP1141_6	228.7	186.99			201830000	1280	367	1217	2082;2083;2084	2797;2798;2799;2800;2801;2802	2801		6	9606
QNLEPLFEQYINNLR	Unmodified	1889.9636	0.9635615	10;101;18	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;CON__P13647;P13647;P04259	KRT6A;KRT6C;KRT5;KRT6B	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B	no	no	0	0	0	3	1		1		1		23.423	23.423	2	5.2605E-69	19046	DP1141_9	233.54	158.7		+	14740000	1281	10;18;101	1218	2085;2086	2803;2804;2805	2805		3	9606
QNLEPLFEQYINNLRR	Unmodified	2046.0647	0.064672527	10;101;18	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;CON__P13647;P13647;P04259	KRT6A;KRT6C;KRT5;KRT6B	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 5;Keratin, type II cytoskeletal 6B	no	no	0	0	1	3	1		1		1		22.301	22.301	3	0.0071722	17346	DP1141_9	129.54	96.835		+	51029000	1282	10;18;101	1219	2087;2088	2806;2807	2807		2	9606
QPTIFQNK	Unmodified	974.51853	0.5185304	295	P62280	RPS11	40S ribosomal protein S11	yes	yes	0	0	0	5	0					1	16.339	16.339	2	0.0076964	8361	DP1141_10	111.65	53.044			20405000	1283	295	1220	2089	2808	2808		1	9606
QQVPSGESAILDR	Unmodified	1398.7103	0.71030693	131	P09874	PARP1	Poly [ADP-ribose] polymerase 1	yes	yes	0	0	0	2	0		1				17.276	17.276	2	0.019311	9730	DP1141_7	116.77	57.416			0	1284	131	1221	2090	2809	2809		1	9606
QRPSEIKDYSPYFK	Unmodified	1756.8784	0.87843489	16	CON__P08779;P08779	KRT16	Keratin, type I cytoskeletal 16	yes	no	0	0	2	4	0				1		17.188	17.188	4	0.020261	9459	DP1141_9	62.298	43.011		+	67177000	1285	16	1222	2091	2810	2810		1	9606
QRQEEPPPGPQRPDQSAAAAGPGDPK	Unmodified	2680.2954	0.29535376	535	Q9BQ61	C19orf43	Uncharacterized protein C19orf43	yes	yes	0	0	2	5	0					1	14.509	14.509	4	1.0577E-05	5565	DP1141_10	78.531	43.494			35367000	1286	535	1223	2092	2811	2811		1	9606
QSNVAAPGDATPPAEK	Unmodified	1551.7529	0.75290002	520	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	yes	yes	0	0	0	2	0		1				14.759	14.759	2	0.025371	5739	DP1141_7	101.56	73.784			25700000	1287	520	1224	2093	2812	2812		1	9606
QSNVAAPGDATPPAEKK	Unmodified	1679.8479	0.84786304	520	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	yes	yes	0	0	1	3	0.816		1	1	1		13.788	13.788	3	8.4721E-105	4124	DP1141_8	178.47	148.3			51205000	1288	520	1225	2094;2095;2096	2813;2814;2815;2816;2817	2816		5	9606
QSVEADINGLRR	Unmodified	1356.711	0.71097563	17	CON__P13645;P13645;CON__P02535-1	KRT10	Keratin, type I cytoskeletal 10	no	no	0	0	1	2.67	1.7	1	1			1	17.018	17.018	2;3	0.0081009	8664	DP1141_6	83.081	46.017		+	369170000	1289	17	1226	2097;2098;2099	2818;2819;2820	2819		1	9606
QTFEAAILTQLHPR	Unmodified	1623.8733	0.87328993	570	Q9NPD3	EXOSC4	Exosome complex component RRP41	yes	yes	0	0	0	5	0					1	20.626	20.626	3	0.014135	15429	DP1141_10	70.373	49.946			40351000	1290	570	1227	2100	2821	2821		1	9606
QTLMWSATWPK	Unmodified	1347.6645	0.66454271	163;496	Q92841;P17844	DDX17;DDX5	Probable ATP-dependent RNA helicase DDX17;Probable ATP-dependent RNA helicase DDX5	no	no	0	0	0	3	0			1			20.958	20.958	2	0.027555	15251	DP1141_8	112.71	69.429			0	1291	496;163	1228	2101	2822	2822		1	9606
QTLPVAPR	Unmodified	880.51305	0.51305109	433	Q6PJT7	ZC3H14	Zinc finger CCCH domain-containing protein 14	yes	yes	0	0	0	2.5	0.5		1	1			15.61	15.61	2	0.001002	6960	DP1141_8	127.46	81.51			31954000	1292	433	1229	2102;2103	2823;2824	2824		0	9606
QTTTGSAVPIR	Unmodified	1129.6091	0.60913632	40	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	yes	yes	0	0	0	1	0	1					14.916	14.916	2	7.6606E-11	5295	DP1141_6	149.82	92.639			0	1293	40	1230	2104	2825	2825		1	9606
QTVMFSATFPR	Oxidation (M)	1299.6282	0.6281572	445	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	yes	yes	0	1	0	1	0	1					18.903	18.903	2	0.015322	11762	DP1141_6	125.97	88.625			3287500	1294	445	1231	2105	2826	2826	328	1	9606
QVGYENAGTVEFLVDR	Unmodified	1795.8741	0.87407779	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2.5	0.5		1	1			20.564	20.564	2	6.7068E-240	14956	DP1141_7	256.47	207.52			277860000	1295	142	1232	2106;2107	2827;2828;2829	2827		3	9606
QVIGTGSFFPK	Unmodified	1179.6288	0.62880913	379	Q13642	FHL1	Four and a half LIM domains protein 1	yes	yes	0	0	0	4	0				1		19.489	19.489	2	0.0045549	13231	DP1141_9	104.42	53.078			6369300	1296	379	1233	2108	2830	2830		1	9606
QVLDNLTMEK	Oxidation (M)	1205.5962	0.59618837	19	CON__P35527;P35527	KRT9	Keratin, type I cytoskeletal 9	yes	no	0	1	0	4	0				1		17.094	17.094	2	0.018648	9268	DP1141_9	95.358	42.955		+	0	1297	19	1234	2109	2831	2831	20	1	9606
QVLIASHLPSYELR	Unmodified	1624.8937	0.89369102	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	2					18.955	18.955	2;3	0.0019869	11865	DP1141_6	101.43	49.359			620740000	1298	367	1235	2110;2111	2832;2833;2834;2835;2836	2832		5	9606
QVQAEVPGSPIFVMR	Oxidation (M)	1672.8607	0.86067633	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	0	1	0	1					19.155	19.155	2	3.7101E-08	12009	DP1141_6	158.08	98.172			333310000	1299	367	1236	2112	2837;2838	2838	283	2	9606
QVQAEVPGSPIFVMR	Unmodified	1656.8658	0.86576171	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	3					21.148	21.148	2;3	0	14091	DP1141_6	275.84	245.83			141820000	1300	367	1236	2113;2114;2115	2839;2840;2841;2842;2843;2844;2845	2842		6	9606
QVQPQVQPQAHSQGPR	Unmodified	1783.9078	0.90777795	601	Q9ULV3	CIZ1	Cip1-interacting zinc finger protein	yes	yes	0	0	0	2	0		1				13.819	13.819	3	0.0050866	4214	DP1141_7	83.856	64.018			4366100	1301	601	1237	2116	2846	2846		0	9606
QVSDLISVLR	Unmodified	1128.6503	0.65027285	163	P17844	DDX5	Probable ATP-dependent RNA helicase DDX5	yes	yes	0	0	0	4	0				1		20.573	20.573	2	0.024515	14731	DP1141_9	103.55	32.167			0	1302	163	1238	2117	2847	2847		1	9606
QVVNIPSFIVR	Unmodified	1270.7398	0.73975656	236	P46781	RPS9	40S ribosomal protein S9	yes	yes	0	0	0	5	0					1	20.892	20.892	2	4.3522E-14	15841	DP1141_10	164.46	115.04			31428000	1303	236	1239	2118	2848	2848		1	9606
QVVQTPNTVLSTPFR	Unmodified	1685.9101	0.91006937	526	Q99459	CDC5L	Cell division cycle 5-like protein	yes	yes	0	0	0	2	0		1				19.538	19.538	2	3.1945E-05	13319	DP1141_7	136.81	90.898			0	1304	526	1240	2119	2849	2849		1	9606
RAGELTEDEVER	Unmodified	1402.6688	0.66883604	293	P62269	RPS18	40S ribosomal protein S18	yes	yes	0	0	1	5	0					1	14.914	14.914	2	9.037399999999999E-32	6203	DP1141_10	167.18	112.64			0	1305	293	1241	2120	2850	2850		1	9606
RATVNTFGYIAK	Unmodified	1339.7248	0.72483478	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	2.33	0.471		2	1			16.881	16.881	2;3	0.0024144	8990	DP1141_8	94.402	70.653			412350000	1306	78	1242	2121;2122;2123	2851;2852;2853	2853		1	9606
RAYIAYELNSVQHR	Unmodified	1718.8853	0.8852516	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	1	0	1					17.153	17.153	3	1.2221E-81	9004	DP1141_6	206.66	150.68			315530000	1307	367	1243	2124	2854	2854		1	9606
REEEEFNTGPLSVLTQSVK	Unmodified	2162.0855	0.085527128	298	P62316	SNRPD2	Small nuclear ribonucleoprotein Sm D2	yes	yes	0	0	1	5	0					1	20.58	20.58	3	0.030467	15370	DP1141_10	58.835	34.11			11598000	1308	298	1244	2125	2855	2855		1	9606
RELHGQNPVVTPCNK	Unmodified	1747.8788	0.87878601	413	Q16630	CPSF6	Cleavage and polyadenylation specificity factor subunit 6	yes	yes	0	0	1	4.5	0.5				1	1	13.989	13.989	3	0.004873	4335	DP1141_9	113.53	80.223			10656000	1309	413	1245	2126;2127	2856;2857;2858	2858		2	9606
RFEDFTR	Unmodified	969.46683	0.46682918	40	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	yes	yes	0	0	1	1	0	1					16.076	16.076	2	0.020891	7087	DP1141_6	125.31	53.6			0	1310	40	1246	2128	2859	2859		1	9606
RFVTPSEPVAHSR	Unmodified	1481.7739	0.77391024	44	O14654	IRS4	Insulin receptor substrate 4	yes	yes	0	0	1	1	0	1					14.758	14.758	3	0.0002961	5092	DP1141_6	127.79	107.41			12463000	1311	44	1247	2129	2860	2860		1	9606
RGIEKPPFELPDFIK	Unmodified	1784.9825	0.98250603	374	Q13435	SF3B2	Splicing factor 3B subunit 2	yes	yes	0	0	2	2	0		1				20.045	20.045	3	0.015655	14379	DP1141_7	77.051	46.477			10375000	1312	374	1248	2130	2861	2861		1	9606
RHEAAVPPLAIPSARPEK	Unmodified	1938.0799	0.079928661	433	Q6PJT7	ZC3H14	Zinc finger CCCH domain-containing protein 14	yes	yes	0	0	2	2.5	0.5		1	1			16.184	16.184	4	0.0024491	7936	DP1141_8	93.738	77.748			52174000	1313	433	1249	2131;2132	2862;2863	2863		2	9606
RHPDYSVVLLLR	Unmodified	1466.8358	0.83578221	14	CON__P02768-1;P02768	ALB	Serum albumin	yes	no	0	0	1	2	0		1				19.453	19.453	3	0.0031305	13030	DP1141_7	96.756	74.896		+	75749000	1314	14	1250	2133	2864	2864		1	9606
RHPEYAVSVLLR	Unmodified	1438.8045	0.80448208	15	CON__P02769			yes	yes	0	0	1	3.5	0.5			1	1		17.956	17.956	3	0.0031353	10765	DP1141_9	105.95	74.295		+	68024000	1315	15	1251	2134;2135	2865;2866;2867	2867		2	
RHPYFYAPELLYYANK	Unmodified	2044.0207	0.020682448	15	CON__P02769			yes	yes	0	0	1	5	0					1	20.257	20.257	3	0.029672	14972	DP1141_10	59.634	41.096		+	17735000	1316	15	1252	2136	2868	2868		1	
RIDISPSTFR	Unmodified	1190.6408	0.6407708	612	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	yes	yes	0	0	1	2	0		1				17.499	17.499	2	0.0017159	10053	DP1141_7	109.44	65.062			25547000	1317	612	1253	2137	2869	2869		0	9606
RIGYPVMIK	Oxidation (M)	1091.6161	0.61613595	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	1	1	2	1	1		1			16.441	16.441	2	0.0043374	7909	DP1141_6	89.752	52.593			238470000	1318	521	1254	2138;2139	2870;2871	2870	376	1	9606
RIPSIVSSPLNSPLDR	Unmodified	1749.9737	0.97373226	252	P49790	NUP153	Nuclear pore complex protein Nup153	yes	yes	0	0	1	3.5	0.5			1	1		19.189	19.189	3	0.0013949	12644	DP1141_8	123.08	94.001			30318000	1319	252	1255	2140;2141	2872;2873	2872		1	9606
RIPVMYQHHTDLNPIEVAIDEMSKK	Oxidation (M)	2979.4946	0.49464719	546	Q9BZ29	DOCK9	Dedicator of cytokinesis protein 9	yes	yes	0	1	2	2	0		1				20.901	20.901	4	0.0023069	15521	DP1141_7	52.03	21.446			31511000	1320	546	1256	2142	2874	2874	391	1	9606
RIPVQAVWAGWGHASENPK	Unmodified	2102.081	0.080991294	367;40	Q13085;O00763	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	no	no	0	0	1	2.33	1.25	1	1		1		18.981	18.981	3	2.3092E-89	11965	DP1141_6	206.81	178.65			223480000	1321	367;40	1257	2143;2144;2145	2875;2876;2877	2875		2	9606
RISTLTIEEGNLDIQRPK	Unmodified	2082.1433	0.14331678	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	2	3.33	0.471			2	1		18.012	18.012	3;4	6.2030000000000006E-24	10913	DP1141_8	172.95	153.63			605660000	1322	365	1258	2146;2147;2148	2878;2879;2880;2881	2879		3	9606
RKGDEVDGVDEVAK	Unmodified	1515.7529	0.75290002	131	P09874	PARP1	Poly [ADP-ribose] polymerase 1	yes	yes	0	0	2	2	0		1				14.259	14.259	3	0.0081978	4891	DP1141_7	88.311	48.917			15445000	1323	131	1259	2149	2882;2883	2882		2	9606
RKPPAMGQAPPATNEQK	Unmodified	1819.9363	0.93630089	457	Q86UE8	TLK2	Serine/threonine-protein kinase tousled-like 2	yes	yes	0	0	2	3	0			1			12.756	12.756	3	0.004297	2837	DP1141_8	81.992	81.992			1471800	1324	457	1260	2150	2884	2884		0	9606
RKTMQPHLLTK	Oxidation (M)	1367.7707	0.77073911	495	Q92817	EVPL	Envoplakin	yes	yes	0	1	2	4	0				1		17.277	17.277	2	0.0095688	9577	DP1141_9	76.282	36.345			11036000	1325	495	1261	2151	2885	2885	360	0	9606
RLDLASLMSAPK	Acetyl (Protein N-term);Oxidation (M)	1358.7228	0.72278587	475	Q8NG04	SLC26A10	Solute carrier family 26 member 10	yes	yes	1	1	1	4	0				1		21.244	21.244	2	0.033409	15733	DP1141_9	47.706	8.159			0	1326	475	1262	2152	2886	2886	352	1	9606
RLLLMELQMWSGQDSAR	Oxidation (M)	2049.0136	0.013564934	630				yes	yes	0	1	1	5	0					1	20.825	20.825	2	0.035947	15784	DP1141_10	89.356	22.693	+		144230000	1327	630	1263	2153	2887	2887	432	1	9606
RLNISYTR	Unmodified	1021.5669	0.56687757	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	1	2.75	1.48	1	1	1		1	15.539	15.539	2	0.00017061	6264	DP1141_6	120.15	82.343			1265000000	1328	521	1264	2154;2155;2156;2157	2888;2889;2890;2891	2889		0	9606
RLPGPDELFR	Unmodified	1198.6459	0.64585618	471	Q8N6N3	C1orf52	UPF0690 protein C1orf52	yes	yes	0	0	1	5	0					1	19.027	19.027	2	0.0022405	13020	DP1141_10	95.775	21.336			15240000	1329	471	1265	2158	2892	2892		0	9606
RLQIEESSKPVR	Unmodified	1440.8049	0.80487601	150	P13984	GTF2F2	General transcription factor IIF subunit 2	yes	yes	0	0	2	5	0					1	14.33	14.33	3	5.8374E-16	5284	DP1141_10	145.81	99.013			0	1330	150	1266	2159	2893	2893		1	9606
RLTFLVAQK	Unmodified	1074.655	0.6549643	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	1	0	1					17.555	17.555	2	0.0073873	9587	DP1141_6	127.46	28.087			625780000	1331	367	1267	2160	2894	2894		0	9606
RNLDIERPTYTNLNR	Unmodified	1873.9759	0.97585752	321;442;322	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	no	no	0	0	2	3	0			1			16.612	16.612	3	0.034844	8596	DP1141_8	83.877	55.098			63565000	1332	321;322;442	1268	2161	2895	2895		0	9606
RPAEDMEEEQAFKR	Oxidation (M)	1750.7944	0.79444726	284	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	yes	yes	0	1	2	4	1			1		1	14.397	14.397	3	2.2031E-15	5464	DP1141_10	151.22	125.8			78811000	1333	284	1269	2162;2163	2896;2897	2896	230	2	9606
RPAEDMEEEQAFKR	Unmodified	1734.7995	0.79953264	284	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	yes	yes	0	0	2	3	0			1			15.284	15.284	3	5.0826E-116	6423	DP1141_8	212.03	160.42			19837000	1334	284	1269	2164	2898;2899	2898		2	9606
RPAPAVSPGSWKPGPPGSPR	Unmodified	1997.0595	0.05952757	514	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	yes	yes	0	0	2	2	0		1				16.265	16.265	3	3.0687E-13	8001	DP1141_7	166.3	152.6			37426000	1335	514	1270	2165	2900;2901	2900		2	9606
RPELLTHSTTEVTQPR	Unmodified	1863.9803	0.9802742	327	P78347	GTF2I	General transcription factor II-I	yes	yes	0	0	1	2	0		2				15.664	15.664	3;4	0.0052071	7086	DP1141_7	71.316	33.175			149650000	1336	327	1271	2166;2167	2902;2903	2903		1	9606
RPETWESPEKPK	Unmodified	1482.7467	0.74669243	425	Q5VUA4	ZNF318	Zinc finger protein 318	yes	yes	0	0	2	2.5	0.5		1	1			14.194	14.194	3	0.0054018	4798	DP1141_8	80.318	49.755			7403200	1337	425	1272	2168;2169	2904;2905;2906	2906		2	9606
RPGAALDPGCVLAK	Unmodified	1423.7606	0.76056836	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	1.33	0.471	2	1				17.036	17.036	2;3	0.0038877	8576	DP1141_6	96.371	43.581			1168200000	1338	367	1273	2170;2171;2172	2907;2908;2909;2910;2911	2908		4	9606
RPISADSAIMNPASK	Oxidation (M)	1572.793	0.7929907	336	Q00610	CLTC	Clathrin heavy chain 1	yes	yes	0	1	1	1	0	1					15.259	15.259	3	0.00178	5727	DP1141_6	105.17	64.696			5803400	1339	336	1274	2173	2912	2912	256	1	9606
RPKEEEWDPEYTPK	Unmodified	1802.8475	0.84752869	580	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	yes	yes	0	0	2	2	0		1				16.165	16.165	3	0.0018388	7984	DP1141_7	150.9	141.34			63138000	1340	580	1275	2174	2913;2914	2913		2	9606
RPLEMEQQQAYRPEMK	2 Oxidation (M)	2064.9721	0.97209405	540	Q9BUJ2	HNRNPUL1	Heterogeneous nuclear ribonucleoprotein U-like protein 1	yes	yes	0	2	2	2	0		1				14.259	14.259	3	0.00080099	4980	DP1141_7	110.56	82.01			13660000	1341	540	1276	2175	2915	2915	386;387	1	9606
RPLLLNSVLLR	Unmodified	1292.8292	0.82924027	569	Q9HCS7	XAB2	Pre-mRNA-splicing factor SYF1	yes	yes	0	0	1	2	0		1				19.968	19.968	2	0.009103	13925	DP1141_7	79.07	33.069			5463900	1342	569	1277	2176	2916	2916		0	9606
RPLPTQQQPQPSQK	Unmodified	1631.8744	0.87435256	583	Q9P0U4	CXXC1	CXXC-type zinc finger protein 1	yes	yes	0	0	1	3	0			1			12.857	12.857	3	0.0043825	2933	DP1141_8	113.54	82.578			1678600	1343	583	1278	2177	2917;2918	2917		2	9606
RPNPDILDHER	Unmodified	1360.6848	0.68476088	607	Q9UQ35	SRRM2	Serine/arginine repetitive matrix protein 2	yes	yes	0	0	1	5	0					1	14.924	14.924	3	0.0022205	6272	DP1141_10	93.766	70.848			8958200	1344	607	1279	2178	2919	2919		0	9606
RPQGESYDQAIR	Unmodified	1418.6902	0.69024019	444	Q7KZ85	SUPT6H	Transcription elongation factor SPT6	yes	yes	0	0	1	1	0	1					14.758	14.758	3	0.0035757	5098	DP1141_6	90.861	31.443			7036100	1345	444	1280	2179	2920	2920		0	9606
RPQYSNPPVQGEVMEGADNQGAGEQGRPVR	Unmodified	3222.5225	0.52246994	319	P67809	YBX1	Nuclease-sensitive element-binding protein 1	yes	yes	0	0	2	4	0				1		16.408	16.408	4	2.3092E-24	8110	DP1141_9	99.064	77.612			13496000	1346	319	1281	2180	2921	2921		0	9606
RQAVDVSPLR	Unmodified	1139.6411	0.64110515	237	P46782	RPS5	40S ribosomal protein S5;40S ribosomal protein S5, N-terminally processed	yes	yes	0	0	1	5	0					1	15.32	15.32	2	0.020055	7024	DP1141_10	82.287	36.569			17999000	1347	237	1282	2181	2922	2922		0	9606
RSAEEEAADLPTKPTK	Unmodified	1741.8846	0.88464248	486	Q8WW12	PCNP	PEST proteolytic signal-containing nuclear protein	yes	yes	0	0	2	5	0					1	14.832	14.832	3	0.021843	6126	DP1141_10	72.428	2.5494			11448000	1348	486	1283	2182	2923	2923		1	9606
RTEEGPTLSYGR	Unmodified	1364.6684	0.66844211	229	P43243	MATR3	Matrin-3	yes	yes	0	0	1	2	0		1				15.398	15.398	3	0.0046723	6653	DP1141_7	89.44	66.72			0	1349	229	1284	2183	2924	2924		1	9606
RTEITIVKPQESAHR	Unmodified	1763.9642	0.9642302	592	Q9UHD8	SEPT9	Septin-9	yes	yes	0	0	2	3	0			1			14.497	14.497	4	0.0054605	5112	DP1141_8	75.02	46.474			3925500	1350	592	1285	2184	2925	2925		1	9606
RVCLIQEPK	Unmodified	1141.6278	0.62776327	464	Q8IX01	SUGP2	SURP and G-patch domain-containing protein 2	yes	yes	0	0	1	5	0					1	15.701	15.701	2	0.0001329	7476	DP1141_10	150.4	79.019			7531900	1351	464	1286	2185	2926	2926		1	9606
RVDPVYIHLAER	Unmodified	1466.7994	0.7993967	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	2.5	1.12	1	1	1	1		17.17	17.17	3	3.9534E-56	9058	DP1141_6	169.58	134.08			684580000	1352	367	1287	2186;2187;2188;2189	2927;2928;2929;2930;2931	2927		4	9606
RVEGPGSLGLEESGSR	Unmodified	1628.8118	0.81181188	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	1	3.12	1.54	2	1	1	2	2	16.425	16.425	2;3	0	7754	DP1141_6	296.49	259.81			2333900000	1353	365	1288	2190;2191;2192;2193;2194;2195;2196;2197	2932;2933;2934;2935;2936;2937;2938;2939;2940;2941;2942;2943;2944;2945;2946;2947;2948	2943		16	9606
RVEGPGSLGLEESGSRR	Unmodified	1784.9129	0.91292291	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	2	3	1.2	1	1	3	1	1	15.613	15.613	2;3;4	1.1189E-104	6672	DP1141_9	213	169.24			869930000	1354	365	1289	2198;2199;2200;2201;2202;2203;2204	2949;2950;2951;2952;2953;2954;2955;2956;2957;2958	2957		9	9606
RVFLIDLNSTHGTFLGHIR	Unmodified	2195.1964	0.1963554	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	1	3.67	0.471			1	2		20.066	20.066	3;4	1.4495E-07	14003	DP1141_9	150.9	139.33			634470000	1355	365	1290	2205;2206;2207	2959;2960;2961;2962;2963;2964	2963		6	9606
RVPSNASWEQAMK	Oxidation (M)	1518.7249	0.72491113	74	O75400	PRPF40A	Pre-mRNA-processing factor 40 homolog A	yes	yes	0	1	1	2	0		1				15.059	15.059	3	0.020178	6315	DP1141_7	64.104	33.214			14569000	1356	74	1291	2208	2965	2965	58	1	9606
RVSALNSVHCEHVEDEGESR	Unmodified	2309.0455	0.045470003	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	1	0	1					14.858	14.858	3	3.9105E-28	5284	DP1141_6	249.49	235.87			5528600	1357	367	1292	2209	2966;2967	2966		2	9606
RWDQTADQTPGATPK	Unmodified	1670.8012	0.8012472	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	3.5	0.5			1	1		15.322	15.322	3	1.4667E-54	6265	DP1141_9	159.41	111.3			65829000	1358	78	1293	2210;2211	2968;2969	2969		2	9606
SAEEEAADLPTKPTK	Unmodified	1585.7835	0.78353145	486	Q8WW12	PCNP	PEST proteolytic signal-containing nuclear protein	yes	yes	0	0	1	5	0					2	15.158	15.158	2;3	0	6633	DP1141_10	288.61	254.52			324430000	1359	486	1294	2212;2213	2970;2971;2972;2973;2974;2975;2976	2975		7	9606
SAEFLLHMLK	Oxidation (M)	1203.6322	0.63217995	169	P18621	RPL17	60S ribosomal protein L17	yes	yes	0	1	0	5	0					1	18.537	18.537	2	0.014935	12138	DP1141_10	139.97	102.91			20943000	1360	169	1295	2214	2977	2977	154	1	9606
SAHLQWMVVR	Acetyl (Protein N-term)	1267.6496	0.64956134	235	P46779	RPL28	60S ribosomal protein L28	yes	yes	1	0	0	5	0					1	20.383	20.383	2	0.00066844	15042	DP1141_10	131.62	82.08			7407000	1361	235	1296	2215	2978	2978		1	9606
SAINEVVTR	Unmodified	987.53491	0.53490874	310	P62899	RPL31	60S ribosomal protein L31	yes	yes	0	0	0	5	0					1	16.016	16.016	2	0.019616	7982	DP1141_10	96.034	39.6			24571000	1362	310	1297	2216	2979	2979		0	9606
SANVNEFPVLK	Unmodified	1216.6452	0.64518747	270	P55060	CSE1L	Exportin-2	yes	yes	0	0	0	2	0		1				18.64	18.64	2	0.022956	11977	DP1141_7	78.655	35.791			5190600	1363	270	1298	2217	2980	2980		1	9606
SAPASPTHPGLMSPR	Oxidation (M)	1520.7406	0.7405612	333	P85037	FOXK1	Forkhead box protein K1	yes	yes	0	1	0	3	0			1			14.527	14.527	3	0.005346	5244	DP1141_8	84.173	64.962			11568000	1364	333	1299	2218	2981	2981	253	0	9606
SDLEMQYETLQEELMALK	2 Oxidation (M)	2202.0072	0.0072017319	19	CON__P35527;P35527	KRT9	Keratin, type I cytoskeletal 9	yes	no	0	2	0	2	0		1				23.393	23.393	2	2.6958E-192	19047	DP1141_7	242.4	194.29		+	4678700	1365	19	1300	2219	2982;2983	2982	21;22	2	9606
SDLEMQYETLQEELMALKK	2 Oxidation (M)	2330.1022	0.10216475	19	CON__P35527;P35527	KRT9	Keratin, type I cytoskeletal 9	yes	no	0	2	1	2.5	0.5		1	1			21.917	21.917	3	1.0563E-07	16743	DP1141_8	109.67	73.898		+	93480000	1366	19	1301	2220;2221	2984;2985	2985	21;22	1	9606
SDNGELEDKPPAPPVR	Acetyl (Protein N-term)	1761.8533	0.85334235	371	Q13177	PAK2	Serine/threonine-protein kinase PAK 2;PAK-2p27;PAK-2p34	yes	yes	1	0	1	3	0			1			17.023	17.023	2	0.021706	8965	DP1141_8	51.841	13.873			9868000	1367	371	1302	2222	2986	2986		0	9606
SDQDHSMDEMTAVVK	Acetyl (Protein N-term);2 Oxidation (M)	1765.7135	0.71347933	125	P08047	SP1	Transcription factor Sp1	yes	yes	1	2	0	5	0					1	20.126	20.126	3	0.014528	14670	DP1141_10	53.377	29.781			49543000	1368	125	1303	2223	2987	2987	117;118	1	9606
SDSEKLNLDSIIGR	Acetyl (Protein N-term)	1587.8104	0.8104149	286	P62136	PPP1CA	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit	yes	yes	1	0	1	4	0				1		20.787	20.787	2	0	15044	DP1141_9	388.54	321.62			310890000	1369	286	1304	2224	2988	2988		1	9606
SDVFPGPSFR	Unmodified	1107.5349	0.53490874	464	Q8IX01	SUGP2	SURP and G-patch domain-containing protein 2	yes	yes	0	0	0	2	0		1				19.1	19.1	2	0.03471	12630	DP1141_7	74.92	29.839			18672000	1370	464	1305	2225	2989	2989		1	9606
SDYSPHISCHDELLR	Unmodified	1827.821	0.82099636	425	Q5VUA4	ZNF318	Zinc finger protein 318	yes	yes	0	0	0	2	0		1				16.881	16.881	3	0.015777	9103	DP1141_7	63.292	46.223			15661000	1371	425	1306	2226	2990	2990		1	9606
SEGALELADVSNELPGLK	Unmodified	1840.9418	0.941823	359	Q08J23	NSUN2	tRNA (cytosine(34)-C(5))-methyltransferase	yes	yes	0	0	0	2	0		1				21.5	21.5	2	0.00020076	16185	DP1141_7	110.92	67.947			3959200	1372	359	1307	2227	2991;2992	2991		2	9606
SELDTIDSQHR	Unmodified	1299.6055	0.6055075	228	P43004	SLC1A2	Excitatory amino acid transporter 2	yes	yes	0	0	0	4	0				1		15.419	15.419	3	0.0075521	6513	DP1141_9	89.171	57.986			5802400	1373	228	1308	2228	2993	2993		0	9606
SELLVEQGR	Unmodified	1029.5455	0.54547343	497	Q92878	RAD50	DNA repair protein RAD50	yes	yes	0	0	0	2	0		1				16.544	16.544	2	0.0084812	8320	DP1141_7	131.06	81.021			23970000	1374	497	1309	2229	2994	2994		0	9606
SELLVPGSQLILGPHESK	Unmodified	1903.0415	0.041477469	528	Q99575	POP1	Ribonucleases P/MRP protein subunit POP1	yes	yes	0	0	0	2	0		1				20.165	20.165	3	0.0046171	14251	DP1141_7	87.088	55.388			4954400	1375	528	1310	2230	2995	2995		1	9606
SELVANNVTLPAGEQR	Unmodified	1696.8744	0.87441214	225	P42166	TMPO	Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin	yes	yes	0	0	0	4	0				1		17.887	17.887	2	0.033451	10631	DP1141_9	65.234	42.316			16565000	1376	225	1311	2231	2996	2996		1	9606
SEQEFQEQLESAR	Unmodified	1579.7114	0.71142914	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	0	3	0.816		1	1	1		18.07	18.07	2	2.8888E-14	10908	DP1141_9	164.81	107.03			1291900000	1377	521	1312	2232;2233;2234	2997;2998;2999	2999		3	9606
SESPKEPEQLR	Unmodified	1298.6466	0.64664404	130	P09651	HNRNPA1	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed	yes	yes	0	0	1	4.5	0.5				1	1	14.037	14.037	3	0.0080367	4351	DP1141_9	164.33	135.64			17806000	1378	130	1313	2235;2236	3000;3001;3002	3001		3	9606
SETAPAAPAAAPPAEK	Acetyl (Protein N-term)	1519.7518	0.75183739	157	P16403	HIST1H1C	Histone H1.2	yes	yes	1	0	0	4.5	0.5				1	1	16.362	16.362	2	0.00071124	8707	DP1141_10	103.75	9.7918			84896000	1379	157	1314	2237;2238	3003;3004	3003		2	9606
SFGLPSIGR	Unmodified	932.50797	0.50796571	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	0	0	1	0	1					19.556	19.556	2	0.0012266	12659	DP1141_6	127.46	55.584			39780000	1380	110	1315	2239	3005	3005		1	9606
SFTQSSHLVQHQR	Unmodified	1553.7699	0.76988749	590	Q9UEG4	ZNF629	Zinc finger protein 629	yes	yes	0	0	0	2	0		1				14.079	14.079	3	0.011832	4682	DP1141_7	76.522	54.447			8247500	1381	590	1316	2240	3006	3006		0	9606
SGASEANLIVAK	Unmodified	1158.6245	0.62445203	232	P46013	MKI67	Antigen KI-67	yes	yes	0	0	0	2	0		1				16.536	16.536	2	0.029228	8521	DP1141_7	121.5	42.013			0	1382	232	1317	2241	3007	3007		1	9606
SGEGEVSGLMR	Oxidation (M)	1136.5132	0.51318702	372	Q13263	TRIM28	Transcription intermediary factor 1-beta	yes	yes	0	1	0	2	0		1				15.164	15.164	2	0.0021489	6285	DP1141_7	94.409	54.862			48635000	1383	372	1318	2242	3008	3008	294	0	9606
SGFSSVSVSR	Unmodified	1011.4985	0.49852324	10	CON__P02538;P02538	KRT6A	Keratin, type II cytoskeletal 6A	yes	no	0	0	0	4	0				1		16.122	16.122	2	8.0844E-16	7642	DP1141_9	155.58	69.909		+	0	1384	10	1319	2243	3009	3009		1	9606
SGGASHSELIHNLR	Unmodified	1476.7433	0.74333839	175	P22061	PCMT1	Protein-L-isoaspartate(D-aspartate) O-methyltransferase	yes	yes	0	0	0	5	0					1	14.995	14.995	3	1.9847E-104	6317	DP1141_10	225.63	165.47			81286000	1385	175	1320	2244	3010	3010		0	9606
SGGASHSELIHNLRK	Unmodified	1604.8383	0.83830141	175	P22061	PCMT1	Protein-L-isoaspartate(D-aspartate) O-methyltransferase	yes	yes	0	0	1	5	0					1	14.229	14.229	4	0.0024585	5169	DP1141_10	85.536	70.971			7770800	1386	175	1321	2245	3011	3011		1	9606
SGGGFSSGSAGIINYQR	Unmodified	1656.7856	0.78559713	102	P04264;CON__P04264	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	0	0	4	0				1		18.287	18.287	2	0	11104	DP1141_9	295.26	264.2		+	8770600	1387	102	1322	2246	3012	3012		1	9606
SGNSDVYENEIPGGQYTNLHFQAHSMGLGSK	Unmodified	3336.5106	0.51056785	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	3	0			1			19.271	19.271	4	0.00051058	12819	DP1141_8	58.168	47.656			8613000	1388	142	1323	2247	3013	3013		0	9606
SGPFGQIFRPDNFVFGQSGAGNNWAK	Unmodified	2797.3361	0.33609636	122;323;381	P07437;P68371;P04350;Q13885;Q9BVA1	TUBB;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	no	no	0	0	1	3.75	0.829			2	1	1	22.266	22.266	3	1.545E-92	17758	DP1141_10	202.73	171.95			122060000	1389	122;323;381	1324	2248;2249;2250;2251	3014;3015;3016;3017;3018;3019;3020;3021;3022	3014		9	9606
SGSMDPSGAHPSVR	Unmodified	1383.6201	0.62011171	353	Q07666	KHDRBS1	KH domain-containing, RNA-binding, signal transduction-associated protein 1	yes	yes	0	0	0	3	0			1			14.131	14.131	3	0.0076287	4723	DP1141_8	83.087	63.816			2070700	1390	353	1325	2252	3023	3023		1	9606
SGTTPKPVINSTPGR	Unmodified	1510.8104	0.81035532	526	Q99459	CDC5L	Cell division cycle 5-like protein	yes	yes	0	0	1	2	0		1				14.358	14.358	3	0.011408	5111	DP1141_7	135.86	108.91			11725000	1391	526	1326	2253	3024	3024		1	9606
SGVSDHWALDDHHALHLTR	Unmodified	2166.0355	0.035497664	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3.2	0.748		1	2	2		17.314	17.314	3;4;5	5.8866E-32	9692	DP1141_9	161.91	131.49			2940799999.9999995	1392	567	1327	2254;2255;2256;2257;2258	3025;3026;3027;3028;3029;3030;3031;3032;3033;3034;3035	3035		9	9606
SGVSLAALKK	Unmodified	972.59678	0.59678072	157	P16403;P10412;P16402	HIST1H1C;HIST1H1E;HIST1H1D	Histone H1.2;Histone H1.4;Histone H1.3	yes	no	0	0	1	4	0				1		15.822	15.822	2	1.5344E-07	7191	DP1141_9	145.72	103.33			104070000	1393	157	1328	2259	3036	3036		0	9606
SIATLAITTLLK	Unmodified	1243.7751	0.77513901	588	Q9UBF2;Q9Y678	COPG2;COPG1	Coatomer subunit gamma-2;Coatomer subunit gamma-1	yes	no	0	0	0	2	0		1				23.275	23.275	2	0.023094	18899	DP1141_7	99.568	65.646			0	1394	588	1329	2260	3037	3037		1	9606
SIFQHIQSAQSQR	Unmodified	1528.7746	0.77463852	612	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	yes	yes	0	0	0	2.86	1.46	2	1	1	2	1	16.907	16.907	2;3	0.0026192	9130	DP1141_7	112.08	76.32			684690000	1395	612	1330	2261;2262;2263;2264;2265;2266;2267	3038;3039;3040;3041;3042;3043;3044	3041		6	9606
SIGVPIK	Acetyl (Protein N-term)	754.45889	0.45889025	299	P62318	SNRPD3	Small nuclear ribonucleoprotein Sm D3	yes	yes	1	0	0	5	0					1	19.027	19.027	1	0.005921	12830	DP1141_10	88.643	36.412			59597000	1396	299	1331	2268	3045	3045		1	9606
SILSPGGSCGPIK	Unmodified	1271.6544	0.65437195	327	P78347	GTF2I	General transcription factor II-I	yes	yes	0	0	0	2	0		1				17.599	17.599	2	0.019292	10332	DP1141_7	72.848	47.722			29357000	1397	327	1332	2269	3046	3046		1	9606
SILVSPTGPSR	Unmodified	1112.619	0.61897272	390	Q14684	RRP1B	Ribosomal RNA processing protein 1 homolog B	yes	yes	0	0	0	5	0					1	16.866	16.866	2	5.8053E-06	9444	DP1141_10	140.11	79.43			0	1398	390	1333	2270	3047	3047		1	9606
SIMAAAGVPVVEGYHGEDQSDQCLK	Oxidation (M)	2676.216	0.21596573	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	1	0	2.75	1.09	1		2	1		18.056	18.056	2;3	1.2284E-05	11011	DP1141_8	76.693	63.298			292000000	1399	521	1334	2271;2272;2273;2274	3048;3049;3050;3051	3049	377	4	9606
SIMAAAGVPVVEGYHGEDQSDQCLK	Unmodified	2660.2211	0.22105111	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	0	1	0	1					18.929	18.929	3	1.4273E-164	11749	DP1141_6	210.71	183.17			0	1400	521	1334	2275	3052	3052		1	9606
SIMAAAGVPVVEGYHGEDQSDQCLKEHAR	Oxidation (M)	3169.4557	0.4556955	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	1	1	2.4	1.2	2		2	1		16.933	16.933	4;5	4.7542E-31	9082	DP1141_8	158.12	138.3			497790000	1401	521	1335	2276;2277;2278;2279;2280	3053;3054;3055;3056;3057	3055	377	5	9606
SINPDEAVAYGAAVQAAILMGDK	Oxidation (M)	2319.1417	0.1416618	135	P0DMV8;P0DMV9;P34931	HSPA1A;HSPA1B;HSPA1L	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like	yes	no	0	1	0	3	0			2			23.199	23.199	2;3	1.7389E-07	18504	DP1141_8	142.72	111.85			56258000	1402	135	1336	2281;2282	3058;3059	3059	131	2	9606
SIQFVDWCPTGFK	Unmodified	1583.7442	0.74424959	321;322	P68363;P68366	TUBA1B;TUBA4A	Tubulin alpha-1B chain;Tubulin alpha-4A chain	no	no	0	0	0	3.5	0.5			1	1		21.709	21.709	2	0.00083594	16479	DP1141_8	133.42	93.795			427620000	1403	321;322	1337	2283;2284	3060;3061	3060		2	9606
SISISVAGGGGGFGAAGGFGGR	Unmodified	1837.9071	0.90710925	20	CON__P35908v2;CON__P35908;P35908	KRT2	Keratin, type II cytoskeletal 2 epidermal	yes	no	0	0	0	2	0		1				20.1	20.1	2	0.0031755	14352	DP1141_7	76.868	32.325		+	23713000	1404	20	1338	2285	3062	3062		1	9606
SISISVAR	Unmodified	831.48142	0.48141661	102	P04264;CON__P04264	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	0	0	3	1.41	1	1	1	1	1	16.597	16.597	2	1.5934E-39	8044	DP1141_6	186.67	43.306		+	1560499999.9999998	1405	102	1339	2286;2287;2288;2289;2290	3063;3064;3065;3066;3067;3068;3069;3070;3071	3065		8	9606
SIYYITGESK	Unmodified	1159.5761	0.57610486	126	P08238;Q58FF8	HSP90AB1;HSP90AB2P	Heat shock protein HSP 90-beta;Putative heat shock protein HSP 90-beta 2	yes	no	0	0	0	3	0			1			17.724	17.724	2	7.382E-05	10308	DP1141_8	148.52	97.457			15977000	1406	126	1340	2291	3072	3072		1	9606
SKGSYSCEVTHEGSTVTK	Unmodified	1955.8895	0.88946986	23	CON__Q1RMN8			yes	yes	0	0	1	5	0					1	14.183	14.183	3	4.1363E-23	5065	DP1141_10	170.79	136.53		+	79193000	1407	23	1341	2292	3073;3074	3073		2	
SKPVFSESLSD	Unmodified	1194.5768	0.57683314	62	O60220	TIMM8A	Mitochondrial import inner membrane translocase subunit Tim8 A	yes	yes	0	0	1	5	0					1	17.538	17.538	2	0.02938	10495	DP1141_10	123.35	81.479			35059000	1408	62	1342	2293	3075	3075		1	9606
SKTPEIYLAYR	Unmodified	1339.7136	0.71360139	480;499	Q8TAQ2;Q92922	SMARCC2;SMARCC1	SWI/SNF complex subunit SMARCC2;SWI/SNF complex subunit SMARCC1	no	no	0	0	1	2	0		1				17.799	17.799	3	1.0423E-13	10514	DP1141_7	165.63	102.56			13914000	1409	480;499	1343	2294	3076	3076		1	9606
SLDLDSIIAEVK	Unmodified	1301.7078	0.70784731	102	P04264;CON__P04264	KRT1	Keratin, type II cytoskeletal 1	no	no	0	0	0	2.5	1.12	1	1	1	1		22.602	22.602	2	4.654199999999999E-187	17800	DP1141_9	232.41	137.05		+	214690000	1410	102	1344	2295;2296;2297;2298	3077;3078;3079;3080;3081	3081		5	9606
SLEEGEGPIAVIMTPTR	Unmodified	1798.9135	0.91349976	445	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	yes	yes	0	0	0	1.5	0.5	1	1				21.098	21.098	2	1.2074E-09	15157	DP1141_6	156.08	123.93			11800000	1411	445	1345	2299;2300	3082;3083;3084;3085	3082		4	9606
SLEEGEGPIAVIMTPTR	Oxidation (M)	1814.9084	0.90841439	445	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	yes	yes	0	1	0	2	0		1				19.411	19.411	2	0.012265	13303	DP1141_7	79.466	38.85			20623000	1412	445	1345	2301	3086	3086	329	0	9606
SLFSPQNTLAAPTGHPPTSGVEK	Unmodified	2335.1808	0.1808245	424	Q5VT52	RPRD2	Regulation of nuclear pre-mRNA domain-containing protein 2	yes	yes	0	0	0	2	0		1				18.399	18.399	3	3.877E-08	11523	DP1141_7	104.82	83.151			49491000	1413	424	1346	2302	3087	3087		1	9606
SLGNILQAKPTSSPAK	Unmodified	1610.8992	0.89917033	373	Q13428	TCOF1	Treacle protein	yes	yes	0	0	1	2.5	0.5		1	1			16.913	16.913	3	0.0078962	9162	DP1141_7	123.72	74.57			109100000	1414	373	1347	2303;2304	3088;3089	3088		1	9606
SLGPPQGEEDSVPR	Unmodified	1466.7001	0.70013617	329	P78527	PRKDC	DNA-dependent protein kinase catalytic subunit	yes	yes	0	0	0	1	0	1					16.555	16.555	2	0.013247	7930	DP1141_6	84.188	43.194			27545000	1415	329	1348	2305	3090	3090		1	9606
SLLEGEGSSGGGGR	Unmodified	1261.5899	0.58985744	17	CON__P13645;P13645	KRT10	Keratin, type I cytoskeletal 10	yes	no	0	0	0	2.5	1.12	1	1	1	1		15.65	15.65	2	4.5259999999999996E-104	6988	DP1141_8	201.84	145.41		+	618200000	1416	17	1349	2306;2307;2308;2309	3091;3092;3093;3094;3095;3096	3093		5	9606
SLLNPQDTPVK	Unmodified	1210.6558	0.65575216	425	Q5VUA4	ZNF318	Zinc finger protein 318	yes	yes	0	0	0	2	0		1				17.599	17.599	2	0.0036303	10244	DP1141_7	128.86	44.975			20790000	1417	425	1350	2310	3097	3097		1	9606
SLNNQFASFIDK	Unmodified	1382.683	0.68302954	102	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	0	0	2.5	1.12	1	1	1	1		20.31	20.31	2	6.1066E-30	14464	DP1141_7	204.56	162.37		+	857550000	1418	102	1351	2311;2312;2313;2314	3098;3099;3100;3101;3102;3103	3099		6	9606
SLPDLGLR	Unmodified	869.49707	0.49706667	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2.5	0.5		1	1			18.913	18.913	2	0.00096247	12439	DP1141_7	124.89	78.224			814180000	1419	142	1352	2315;2316	3104;3105	3104		2	9606
SLQQVDEHSKPPHLR	Unmodified	1769.9173	0.91728001	87	O94913	PCF11	Pre-mRNA cleavage complex 2 protein Pcf11	yes	yes	0	0	1	2	0		1				14.651	14.651	4	0.0075695	5606	DP1141_7	76.759	59.681			22302000	1420	87	1353	2317	3106	3106		0	9606
SLVEIIEHGLVDEQQK	Unmodified	1835.9629	0.9628928	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	2.5	0.5		1	1			22.013	22.013	2	0	17078	DP1141_7	276.41	221.37			536250000	1421	78	1354	2318;2319	3107;3108;3109;3110	3108		4	9606
SLVNLGGSK	Unmodified	873.49198	0.4919813	102	P04264;CON__P04264	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	0	0	3.5	0.5			1	1		16.664	16.664	2	0.0044004	8562	DP1141_9	107.69	51.572		+	423190000	1422	102	1355	2320;2321	3111;3112;3113;3114	3114		4	9606
SLVQANPEVAMDSIIHMTQHISPTQR	2 Oxidation (M)	2934.4328	0.43277522	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	2	0	3.14	1.64	2	1		2	2	18.316	18.316	3;4	4.9755E-12	10865	DP1141_6	120.8	104			529960000	1423	367	1356	2322;2323;2324;2325;2326;2327;2328	3115;3116;3117;3118;3119;3120;3121;3122;3123;3124;3125;3126;3127	3123	284;285	13	9606
SLVQANPEVAMDSIIHMTQHISPTQR	Oxidation (M)	2918.4379	0.43786059	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	0	2.8	1.6	2		1	1	1	20.007	20.007	4	3.8991E-31	12921	DP1141_6	167.88	150.13			139410000	1424	367	1356	2329;2330;2331;2332;2333	3128;3129;3130;3131;3132;3133	3129	284;285	4	9606
SLVQANPEVAMDSIIHMTQHISPTQR	Unmodified	2902.4429	0.44294597	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	5	0					1	21.809	21.809	4	5.3401E-12	17121	DP1141_10	120.44	98.936			18439000	1425	367	1356	2334	3134	3134		1	9606
SLYESFVSSSDR	Unmodified	1375.6256	0.62557424	168	P18615	NELFE	Negative elongation factor E	yes	yes	0	0	0	4	0				1		19.589	19.589	2	0.020112	12747	DP1141_9	89.827	66.507			44935000	1426	168	1357	2335	3135	3135		1	9606
SLYGLGGSK	Unmodified	880.46543	0.46543219	10;101	CON__P02538;P02538;CON__P48668;CON__P04259;P48668;P04259	KRT6A;KRT6C;KRT6B	Keratin, type II cytoskeletal 6A;Keratin, type II cytoskeletal 6C;Keratin, type II cytoskeletal 6B	no	no	0	0	0	4	0				1		17.088	17.088	2	0.0098046	9273	DP1141_9	90.709	25.037		+	84159000	1427	10;101	1358	2336	3136	3136		1	9606
SMFFFLAQTEQGDIFK	Oxidation (M)	1923.9077	0.9076861	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	1	0	2	0		1				22.953	22.953	2	0	18485	DP1141_7	299.29	262.85			26980000	1428	402	1359	2337	3137	3137	309	1	9606
SMGGAAIAPPTSLVEKDKELPR	Unmodified	2266.1991	0.1991171	513	Q96I25	RBM17	Splicing factor 45	yes	yes	0	0	2	3	0			1			17.925	17.925	3	1.7376E-05	10630	DP1141_8	87.352	68.862			8845700	1429	513	1360	2338	3138	3138		0	9606
SNSNTTQETLEIMK	Acetyl (Protein N-term)	1636.7614	0.7614158	609	Q9Y2K5	R3HDM2	R3H domain-containing protein 2	yes	yes	1	0	0	3	0			1			13.538	13.538	3	0.022081	3914	DP1141_8	45.28	25.001			1375000	1430	609	1361	2339	3139	3139		1	9606
SNVSDAVAQSTR	Unmodified	1233.5949	0.59494282	275	P60174	TPI1	Triosephosphate isomerase	yes	yes	0	0	0	5	0					1	15.32	15.32	2	0.021384	6820	DP1141_10	88.056	52.788			3256000	1431	275	1362	2340	3140	3140		1	9606
SPAGPAATPAQAQAASTPR	Unmodified	1748.8806	0.88056015	373	Q13428	TCOF1	Treacle protein	yes	yes	0	0	0	2.5	0.5		1	1			15.19	15.19	2	0	6268	DP1141_7	281.54	256.47			53678000	1432	373	1363	2341;2342	3141;3142;3143;3144	3141		4	9606
SPISVPGGSALISNLGK	Unmodified	1595.8883	0.88827129	259	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	yes	yes	0	0	0	2	0.816	1	1	1			20.39	20.39	2	0.00065444	14630	DP1141_7	138.89	76.071			103820000	1433	259	1364	2343;2344;2345	3145;3146;3147;3148;3149	3146		5	9606
SPLQSVVVR	Unmodified	983.57638	0.57637963	612	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	yes	yes	0	0	0	2	0.816	1	1	1			17.058	17.058	2	1.3916E-20	9453	DP1141_7	171.53	102.33			281330000	1434	612	1365	2346;2347;2348	3150;3151;3152	3151		2	9606
SPPASPESWK	Unmodified	1084.5189	0.51892433	514	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	yes	yes	0	0	0	2	0		1				16.165	16.165	2	0.0068683	7849	DP1141_7	117.81	64.06			37223000	1435	514	1366	2349	3153	3153		1	9606
SPPHCELMAGHLR	Oxidation (M)	1519.7024	0.70240155	463	Q8IWX8	CHERP	Calcium homeostasis endoplasmic reticulum protein	yes	yes	0	1	0	2	0		1				14.655	14.655	3	0.00019619	5217	DP1141_7	136.38	108.51			47126000	1436	463	1367	2350	3154	3154	344	1	9606
SPPHCELMAGHLR	Unmodified	1503.7075	0.70748693	463	Q8IWX8	CHERP	Calcium homeostasis endoplasmic reticulum protein	yes	yes	0	0	0	3	0			1			15.524	15.524	3	0.034611	6827	DP1141_8	75.788	55.682			16658000	1437	463	1367	2351	3155	3155		1	9606
SPPPESVDTPTSTK	Unmodified	1441.6937	0.69365381	232	P46013	MKI67	Antigen KI-67	yes	yes	0	0	0	3	0.816		1	1	1		14.54	14.54	2	3.1578E-05	5289	DP1141_8	147.62	125.09			8591000	1438	232	1368	2352;2353;2354	3156;3157;3158;3159	3158		4	9606
SPPSTGSTYGSSQKEESAASGGAAYTK	Unmodified	2605.178	0.17798354	612	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	yes	yes	0	0	1	2	0		1				15.16	15.16	3	0.00054661	6441	DP1141_7	61.417	37.506			80329000	1439	612	1369	2355	3160	3160		1	9606
SPPSVTLFPPSTEELNGNK	Unmodified	2013.0055	0.0054858935	23	CON__Q1RMN8			yes	yes	0	0	0	5	0					1	19.826	19.826	2	2.3175E-07	14367	DP1141_10	152.38	100.77		+	18425000	1440	23	1370	2356	3161	3161		1	
SPQESTGDPGNSSSVSEGK	Unmodified	1848.7973	0.79734361	593	Q9UHF7	TRPS1	Zinc finger transcription factor Trps1	yes	yes	0	0	0	2	0		1				13.661	13.661	2	1.6828E-11	4121	DP1141_7	159.12	138.34			2017200	1441	593	1371	2357	3162;3163;3164	3163		3	9606
SPQPDPVDTPASTK	Unmodified	1438.694	0.69398816	232	P46013	MKI67	Antigen KI-67	yes	yes	0	0	0	2	0		1				14.983	14.983	2	0.011523	6008	DP1141_7	110.98	67.342			0	1442	232	1372	2358	3165	3165		1	9606
SPQVKPASTMGMGPLGK	2 Oxidation (M)	1716.8539	0.85387639	373	Q13428	TCOF1	Treacle protein	yes	yes	0	2	1	5	0					1	14.531	14.531	3	0.03022	5621	DP1141_10	42.149	15.123			1862500	1443	373	1373	2359	3166	3166	295;296	0	9606
SPSELFAQHIVTIVHHVK	Unmodified	2041.1109	0.11089444	612	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	yes	yes	0	0	0	2.5	0.5		1	1			19.313	19.313	3;4	0.00010391	12990	DP1141_7	138.97	107.93			341460000	1444	612	1374	2360;2361	3167;3168;3169	3168		3	9606
SPSSESSPQHPTPPARPR	Unmodified	1913.9344	0.93438664	45	O14733	MAP2K7	Dual specificity mitogen-activated protein kinase kinase 7	yes	yes	0	0	1	4	0				1		12.828	12.828	4	0.00030067	2874	DP1141_9	87.447	65.013			1155100	1445	45	1375	2362	3170	3170		0	9606
SPTWFGIPR	Unmodified	1059.5502	0.55016488	327	P78347	GTF2I	General transcription factor II-I	yes	yes	0	0	0	2.5	0.5		1	1			20.564	20.564	2	1.8956E-14	14877	DP1141_7	168.23	119.67			21151000	1446	327	1376	2363;2364	3171;3172;3173	3171		3	9606
SPYQEFTDHLVK	Unmodified	1462.7092	0.70924429	155	P15880	RPS2	40S ribosomal protein S2	yes	yes	0	0	0	4.33	0.471				2	1	18.8	18.8	2;3	1.0878E-29	12008	DP1141_9	176.95	136.07			135560000	1447	155	1377	2365;2366;2367	3174;3175;3176;3177	3176		3	9606
SQEEPKDTFEHDPSESIDEFNK	Unmodified	2607.1249	0.12488534	580	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	yes	yes	0	0	1	2	0		2				17.605	17.605	3;4	1.9837E-06	10294	DP1141_7	122.35	105.63			80838000	1448	580	1378	2368;2369	3178;3179;3180	3179		3	9606
SQIFSTASDNQPTVTIK	Unmodified	1835.9265	0.92650729	139	P11021	HSPA5	78 kDa glucose-regulated protein	yes	yes	0	0	0	3	0			1			18.425	18.425	2	0.017288	11623	DP1141_8	78.373	46.214			89398000	1449	139	1379	2370	3181	3181		1	9606
SQIHDIVLVGGSTR	Unmodified	1480.7998	0.79979063	140	P11142	HSPA8	Heat shock cognate 71 kDa protein	yes	yes	0	0	0	3	0			2			17.323	17.323	2;3	0.010056	9886	DP1141_8	87.719	63.733			184450000	1450	140	1380	2371;2372	3182;3183	3183		2	9606
SQKQEEENPAEETGEEKQDTQEK	Acetyl (Protein N-term)	2732.1897	0.18967044	60	O43768	ENSA	Alpha-endosulfine	yes	yes	1	0	2	5	0					1	14.436	14.436	3	7.2102E-239	5478	DP1141_10	251	231.98			9100000	1451	60	1381	2373	3184	3184		1	9606
SQPDPVDTPTSSKPQSK	Unmodified	1797.8745	0.87447172	232	P46013	MKI67	Antigen KI-67	yes	yes	0	0	1	3	0.816		1	1	1		13.671	13.671	3	0.00049956	4010	DP1141_8	167.29	133.98			13786000	1452	232	1382	2374;2375;2376	3185;3186;3187	3186		3	9606
SQYEQLAEQNR	Unmodified	1364.6321	0.6320566	17	CON__P13645;P13645	KRT10	Keratin, type I cytoskeletal 10	yes	no	0	0	0	1	0	1					15.917	15.917	2	0	6826	DP1141_6	332.17	259.29		+	0	1453	17	1383	2377	3188	3188		1	9606
SQYEQLAEQNRK	Unmodified	1492.727	0.72701962	17	CON__P13645;P13645	KRT10	Keratin, type I cytoskeletal 10	yes	no	0	0	1	2.8	1.47	1	2		1	1	14.812	14.812	2;3	1.8788E-176	5797	DP1141_7	242.49	189.37		+	843760000	1454	17	1384	2378;2379;2380;2381;2382	3189;3190;3191;3192;3193;3194;3195	3191		7	9606
SRAPATTNNTAHQ	Unmodified	1367.6542	0.65418903	441	Q6ZR62	ZCCHC16	Zinc finger CCHC domain-containing protein 16	yes	yes	0	0	1	1	0	1					16.715	16.715	2	0.011883	8168	DP1141_6	111.27	73.179			0	1455	441	1385	2383	3196	3196		1	9606
SREIFLSQPILLELEAPLK	Unmodified	2195.2566	0.25655562	286;212;287	P62140;P62136;P36873	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	no	no	0	0	1	3.5	0.5			1	1		22.993	22.993	3	1.3654E-06	18350	DP1141_8	150.65	133.63			62363000	1456	287;286;212	1386	2384;2385	3197;3198;3199;3200;3201	3197		5	9606
SREQSSEAAETGVSENEENPVR	Unmodified	2404.0739	0.073852823	415	Q29RF7	PDS5A	Sister chromatid cohesion protein PDS5 homolog A	yes	yes	0	0	1	2	0		1				15.26	15.26	3	5.0371E-07	6343	DP1141_7	116.35	79.492			5663700	1457	415	1387	2386	3202	3202		1	9606
SRWDETPASQMGGSTPVLTPGK	Oxidation (M)	2317.1009	0.10085962	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	1	1	2	0		1				17.299	17.299	3	0.005444	9954	DP1141_7	70.15	40.067			33917000	1458	78	1388	2387	3203	3203	72	1	9606
SSATSGDIWPGLSAYDNSPR	Unmodified	2079.9498	0.94976193	580	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	yes	yes	0	0	0	2	0		1				20.7	20.7	2	4.5688E-201	15105	DP1141_7	271.08	236.16			29677000	1459	580	1389	2388	3204;3205	3204		2	9606
SSDAFTTQHALR	Unmodified	1332.6422	0.64222736	89	O95239	KIF4A	Chromosome-associated kinesin KIF4A	yes	yes	0	0	0	2	0		1				15.459	15.459	3	0.020723	6831	DP1141_7	72.731	46.792			35949000	1460	89	1390	2389	3206	3206		0	9606
SSFYPDGGDQETAK	Unmodified	1500.6369	0.63686721	580	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	yes	yes	0	0	0	2.5	0.5		1	1			16.465	16.465	2	6.2256E-30	8312	DP1141_7	178.46	140.9			43168000	1461	580	1391	2390;2391	3207;3208;3209	3207		3	9606
SSGGREDLESSGLQR	Unmodified	1576.7441	0.74412625	596	Q9UK76	HN1	Hematological and neurological expressed 1 protein;Hematological and neurological expressed 1 protein, N-terminally processed	yes	yes	0	0	1	5	0					2	14.995	14.995	2;3	8.4938E-60	6289	DP1141_10	195.77	129.58			95407000	1462	596	1392	2392;2393	3210;3211	3211		1	9606
SSGHSSSELSPDAVEK	Unmodified	1615.7326	0.73255851	607	Q9UQ35	SRRM2	Serine/arginine repetitive matrix protein 2	yes	yes	0	0	0	1	0	1					14.658	14.658	3	0.020893	4959	DP1141_6	61.649	42.45			1175500	1463	607	1393	2394	3212	3212		1	9606
SSGPTSLFAVTVAPPGAR	Unmodified	1713.905	0.90498399	337	Q00839	HNRNPU	Heterogeneous nuclear ribonucleoprotein U	yes	yes	0	0	0	1.5	0.5	1	1				20.516	20.516	2	0.0015444	14833	DP1141_7	157.5	102.71			97393000	1464	337	1394	2395;2396	3213;3214	3214		2	9606
SSGPYGGGGQYFAKPR	Unmodified	1627.7743	0.77430417	130	P09651	HNRNPA1	Heterogeneous nuclear ribonucleoprotein A1;Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed	yes	yes	0	0	1	4	0				2		16.308	16.308	2;3	7.1623E-211	8037	DP1141_9	242.97	209.01			273790000	1465	130	1395	2397;2398	3215;3216;3217	3216		3	9606
SSMSGLHLVK	Unmodified	1057.559	0.559015	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					16.355	16.355	2	0.0023511	7462	DP1141_6	129.42	85.304			59376000	1466	367	1396	2399	3218;3219	3218		2	9606
SSNPSISDDSYFR	Unmodified	1473.6372	0.63720156	464	Q8IX01	SUGP2	SURP and G-patch domain-containing protein 2	yes	yes	0	0	0	2	0		1				18.099	18.099	2	0.0045082	11133	DP1141_7	115.91	74.921			7871100	1467	464	1397	2400	3220	3220		1	9606
SSPSVKPAVDPAAAK	Unmodified	1423.7671	0.76709352	430	Q6FI81	CIAPIN1	Anamorsin	yes	yes	0	0	1	4	0				1		14.432	14.432	3	0.013003	4918	DP1141_9	95.195	62.901			11271000	1468	430	1398	2401	3221	3221		1	9606
SSRPGREDVGAAGAR	Acetyl (Protein N-term)	1526.755	0.75496571	479	Q8TA86	RP9	Retinitis pigmentosa 9 protein	yes	yes	1	0	2	4.5	0.5				1	1	13.637	13.637	3	0.022182	4362	DP1141_10	80.371	47.873			1960400	1469	479	1399	2402;2403	3222;3223	3222		1	9606
SSSSSAASDTATSTQRPLR	Unmodified	1908.9137	0.91371077	525	Q96T37	RBM15	Putative RNA-binding protein 15	yes	yes	0	0	1	2	0		1				13.99	13.99	3	7.3534E-07	4546	DP1141_7	112.5	58.672			16570000	1470	525	1400	2404	3224	3224		0	9606
SSTATHPPGPAVQLNK	Unmodified	1603.8318	0.83181904	390	Q14684	RRP1B	Ribosomal RNA processing protein 1 homolog B	yes	yes	0	0	0	5	0					1	14.995	14.995	3	0.0087901	6375	DP1141_10	100.73	65.829			36484000	1471	390	1401	2405	3225	3225		1	9606
SSTPLPTISSSAENTR	Unmodified	1646.8111	0.81114318	225	P42166	TMPO	Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin	yes	yes	0	0	0	3.5	0.5			1	1		17.188	17.188	2	4.9838E-75	9567	DP1141_8	188.96	127.01			79875000	1472	225	1402	2406;2407	3226;3227	3226		1	9606
SSVETTPSVIQHVGQPPATPAK	Unmodified	2230.1594	0.15936077	438	Q6W2J9	BCOR	BCL-6 corepressor	yes	yes	0	0	0	2	0		1				16.899	16.899	3	1.7065E-09	9232	DP1141_7	108.12	81.315			13270000	1473	438	1403	2408	3228;3229	3228		2	9606
STADSGGEGLETAPK	Unmodified	1418.6525	0.65251728	474	Q8NFC6	BOD1L1	Biorientation of chromosomes in cell division protein 1-like 1	yes	yes	0	0	0	2	0		1				14.859	14.859	2	9.8607E-06	5841	DP1141_7	133.07	96.376			14227000	1474	474	1404	2409	3230	3230		0	9606
STELLIR	Unmodified	830.48617	0.48616764	324	Q71DI3;Q16695;P84243;P68431;Q5TEC6;Q6NXT2	HIST2H3A;HIST3H3;H3F3A;HIST1H3A;HIST2H3PS2;H3F3C	Histone H3.2;Histone H3.1t;Histone H3.3;Histone H3.1;Histone H3;Histone H3.3C	yes	no	0	0	0	5	0					2	17.237	17.237	1;2	2.4702E-95	10083	DP1141_10	212.65	70.128			1234800000	1475	324	1405	2410;2411	3231;3232;3233;3234	3231		4	9606
STESLQANVQR	Unmodified	1231.6157	0.61567826	188	P26373	RPL13	60S ribosomal protein L13	yes	yes	0	0	0	3	2	1				1	14.976	14.976	2	5.3307E-176	5472	DP1141_6	239.82	195.45			147310000	1476	188	1406	2412;2413	3235;3236	3236		2	9606
STFREESPLR	Unmodified	1220.6149	0.61494998	580	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	yes	yes	0	0	1	2	0		1				15.664	15.664	2	0.0060657	7032	DP1141_7	93.598	44.156			51912000	1477	580	1407	2414	3237	3237		0	9606
STFVLDEFKR	Unmodified	1240.6452	0.64518747	189	P26641	EEF1G	Elongation factor 1-gamma	yes	yes	0	0	1	4	0				1		18.787	18.787	2	0.0075795	11952	DP1141_9	118.33	88.08			8249700	1478	189	1408	2415	3238	3238		0	9606
STGEAFVQFASQEIAEK	Unmodified	1840.8843	0.88430813	200;272	P31943;P55795	HNRNPH1;HNRNPH2	Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H2	no	no	0	0	0	4	0				1		21.283	21.283	2	0	15793	DP1141_9	289.37	230.3			0	1479	200;272	1409	2416	3239	3239		1	9606
STGLELETPSLVPVKK	Unmodified	1696.9611	0.96110188	520	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	yes	yes	0	0	1	2.5	0.5		1	1			18.762	18.762	3	0.00033824	12096	DP1141_7	112.02	112.02			89324000	1480	520	1410	2417;2418	3240;3241	3240		0	9606
STLVGHDTFTK	Unmodified	1204.6088	0.60880197	29	CON__Streptavidin			yes	yes	0	0	0	3.25	1.64	2	1	1	1	3	18.056	18.056	2;3	1.1745E-132	6781	DP1141_7	231.38	168.8		+	26616000000	1481	29	1411	2419;2420;2421;2422;2423;2424;2425;2426	3242;3243;3244;3245;3246;3247;3248;3249;3250;3251;3252;3253;3254;3255;3256;3257;3258	3256		17	
STNENANTPAAR	Acetyl (Protein N-term)	1286.5851	0.58510641	264	P52292	KPNA2	Importin subunit alpha-1	yes	yes	1	0	0	3	0			1			14.17	14.17	2	3.5616E-23	4676	DP1141_8	158.79	105.03			0	1482	264	1412	2427	3259	3259		1	9606
STNGDTFLGGEDFDQALLR	Unmodified	2054.9545	0.95451296	217	P38646	HSPA9	Stress-70 protein, mitochondrial	yes	yes	0	0	0	3	0			1			21.829	21.829	2	0.00062927	17035	DP1141_8	130.88	98.381			11091000	1483	217	1413	2428	3260	3260		1	9606
STPKEETVNDPEEAGHR	Unmodified	1894.8657	0.86569795	38	O00567	NOP56	Nucleolar protein 56	yes	yes	0	0	1	3	0			2			12.972	12.972	3;4	0.0012766	3210	DP1141_8	97.579	59.486			2790100	1484	38	1414	2429;2430	3261;3262;3263	3262		2	9606
STSESFIQHIVSLVHHVK	Unmodified	2047.0851	0.085073618	580	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	yes	yes	0	0	0	2	0		2				21.2	21.2	3;4	9.7463E-05	15785	DP1141_7	104.78	92.741			211950000	1485	580	1415	2431;2432	3264;3265;3266;3267	3264		4	9606
STTLDAGNIK	Unmodified	1018.5295	0.52948901	74	O75400	PRPF40A	Pre-mRNA-processing factor 40 homolog A	yes	yes	0	0	0	2	0		1				15.442	15.442	2	0.005905	6670	DP1141_7	115.49	64.301			21258000	1486	74	1416	2433	3268	3268		1	9606
SVAGGFVYTYK	Unmodified	1190.5972	0.59717465	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	0	1.5	0.5	1	1				18.527	18.527	2	0.0044145	11152	DP1141_6	105.2	26.931			477140000	1487	402	1417	2434;2435	3269;3270	3269		2	9606
SVAVYGGGSMWEQAK	Oxidation (M)	1584.7242	0.72424243	460	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	yes	yes	0	1	0	2	0		1				17.699	17.699	2	0.018785	10373	DP1141_7	95.401	61.023			63675000	1488	460	1418	2436	3271	3271	340	1	9606
SVHSSVPLLNSK	Unmodified	1266.6932	0.6932003	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	2					16.155	16.155	2;3	2.3497E-96	6936	DP1141_6	215.72	140.8			451560000	1489	367	1419	2437;2438	3272;3273;3274;3275;3276;3277	3273		6	9606
SVHSSVPLLNSKDPIDR	Unmodified	1862.985	0.98502522	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	2	1.07	3	2	1	1		17.028	17.028	2;3;4	3.0673E-191	8668	DP1141_6	242.4	204.38			1374900000	1490	367	1420	2439;2440;2441;2442;2443;2444;2445	3278;3279;3280;3281;3282;3283;3284;3285;3286;3287;3288	3282		10	9606
SVIDPVPAPVGDSHVDGAAK	Unmodified	1929.9796	0.97960549	371	Q13177	PAK2	Serine/threonine-protein kinase PAK 2;PAK-2p27;PAK-2p34	yes	yes	0	0	0	4	0				1		17.387	17.387	3	0.035067	9717	DP1141_9	66.606	32.329			10051000	1491	371	1421	2446	3289	3289		0	9606
SVNDQPSGNLPFLKPDDIQYFDK	Unmodified	2636.2758	0.27584709	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	2	0.816	1	1	1			21.228	21.228	3	1.0691000000000001E-31	15740	DP1141_7	170.02	139.81			573030000	1492	78	1422	2447;2448;2449	3290;3291;3292;3293;3294;3295	3291		6	9606
SVSLTGAPESVQK	Unmodified	1301.6827	0.68269519	500	Q92945	KHSRP	Far upstream element-binding protein 2	yes	yes	0	0	0	3	0			1			16.226	16.226	2	0.0054196	8016	DP1141_8	134.84	52.894			20853000	1493	500	1423	2450	3296	3296		1	9606
SVTCTYSPALNK	Unmodified	1339.6442	0.6442012	104	P04637	TP53	Cellular tumor antigen p53	yes	yes	0	0	0	3	0			1			16.226	16.226	2	1.975E-15	7918	DP1141_8	175.91	137.64			138180000	1494	104	1424	2451	3297	3297		1	9606
SVTEQGAELSNEER	Unmodified	1547.7063	0.70634376	316	P63104	YWHAZ	14-3-3 protein zeta/delta	yes	yes	0	0	0	5	0					1	15.595	15.595	2	0	7346	DP1141_10	299.42	206.58			11155000	1495	316	1425	2452	3298	3298		1	9606
SVTNEDVTQEELGGAK	Unmodified	1675.7901	0.79007339	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	2	1	1		1			16.68	16.68	2	0	8692	DP1141_8	304.57	230.11			47998000	1496	111	1426	2453;2454	3299;3300	3300		2	9606
SVTWPEEGKLR	Unmodified	1300.6776	0.67755023	520	Q96QC0	PPP1R10	Serine/threonine-protein phosphatase 1 regulatory subunit 10	yes	yes	0	0	1	2	0		1				17.374	17.374	2	0.021516	9889	DP1141_7	94.692	45.269			0	1497	520	1427	2455	3301	3301		1	9606
SVVEFLQGYIGVPHGGFPEPFR	Unmodified	2431.2325	0.23246614	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2	0		1				23.321	23.321	3	9.4148E-08	19024	DP1141_7	117.03	84.515			74270000	1498	142	1428	2456	3302;3303	3302		2	9606
SVVPPNR	Acetyl (Protein N-term)	809.43955	0.43955179	61	O43809	NUDT21	Cleavage and polyadenylation specificity factor subunit 5	yes	yes	1	0	0	5	0					1	16.116	16.116	1	0.029294	8094	DP1141_10	44.611	12.14			56656000	1499	61	1429	2457	3304	3304		1	9606
SWAQASVTHGAHGDGGR	Unmodified	1692.7717	0.7716784	243	P48634	PRRC2A	Protein PRRC2A	yes	yes	0	0	0	3.5	1.5		1			1	14.533	14.533	3	0.016974	5356	DP1141_10	68.845	44.314			22521000	1500	243	1430	2458;2459	3305;3306;3307	3305		2	9606
SWLSYSYQSR	Unmodified	1275.5884	0.58840088	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	0	2	0		1				19.49	19.49	2	3.4569E-32	13249	DP1141_7	169.44	101.42			0	1501	402	1431	2460	3308	3308		1	9606
SYCAEIAHNVSSK	Unmodified	1464.6667	0.66672755	312	P62910	RPL32	60S ribosomal protein L32	yes	yes	0	0	0	5	0					1	15.736	15.736	2	0.018977	7715	DP1141_10	92.112	63.935			15118000	1502	312	1432	2461	3309	3309		1	9606
SYELPDGQVITIGNER	Unmodified	1789.8846	0.88464248	277;318	P60709;Q6S8J3;P68133;P68032;A5A3E0;Q9BYX7;P63267;P62736;P63261	ACTB;POTEE;ACTA1;ACTC1;POTEF;POTEKP;ACTG2;ACTA2;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;POTE ankyrin domain family member E;Actin, alpha skeletal muscle;Actin, alpha cardiac muscle 1;POTE ankyrin domain family member F;Putative beta-actin-like protein 3;Putative beta-actin-like protein 3, N-terminally processed;Actin, gamma-enteric smooth muscle;Actin, aortic smooth muscle;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	no	no	0	0	0	3.67	1.25		1		1	1	20.661	20.661	2	3.7082E-11	14993	DP1141_7	150.22	113.63			68453000	1503	277;318	1433	2462;2463;2464	3310;3311;3312	3311		1	9606
SYLNMDAIMEAIKK	2 Oxidation (M)	1657.8055	0.80552922	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	2	1	3.5	0.5			1	1		18.156	18.156	3	0.010912	11017	DP1141_8	65.043	40.512			126380000	1504	110	1434	2465;2466	3313;3314	3313	97;98	0	9606
SYSDPPLK	Unmodified	905.44945	0.44944778	266	P52597	HNRNPF	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed	yes	yes	0	0	0	4	0				1		15.238	15.238	2	0.0068425	6257	DP1141_9	113.5	78.394			31729000	1505	266	1435	2467	3315	3315		1	9606
SYYFPVK	Unmodified	902.4538	0.45380487	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	0	1	0	1					18.36	18.36	2	0.032661	10802	DP1141_6	95.793	60.299			96186000	1506	402	1436	2468	3316	3316		1	9606
TAAFIWPMLIHIMDQK	2 Oxidation (M)	1945.9794	0.97941126	460	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	yes	yes	0	2	0	2	0		1				21.7	21.7	3	0.0056563	16581	DP1141_7	73.833	47.855			12879000	1507	460	1437	2469	3317	3317	341;342	1	9606
TAAFIWPMLIHIMDQK	Oxidation (M)	1929.9845	0.98449664	460	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	yes	yes	0	1	0	2	0		1				23.103	23.103	3	0.0068845	18216	DP1141_7	73.833	47.104			3906500	1508	460	1437	2470	3318	3318	341;342	0	9606
TAPTLSPEHWK	Unmodified	1265.6404	0.64043645	514	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	yes	yes	0	0	0	2	0		1				16.565	16.565	2	0.0049956	8649	DP1141_7	114.89	86.813			32808000	1509	514	1438	2471	3319	3319		1	9606
TAQIMFQAYGDK	Unmodified	1371.6493	0.64928657	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					18.755	18.755	2	0.0050881	11572	DP1141_6	121.29	86.109			316990000	1510	367	1439	2472	3320	3320		1	9606
TAVCDIPPR	Unmodified	1027.5121	0.51206481	122;323;381	P07437;Q3ZCM7;A6NNZ2;P68371;P04350;Q13885;Q9BVA1	TUBB;TUBB8;TUBB4B;TUBB4A;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-8 chain;Tubulin beta-8 chain-like protein LOC260334;Tubulin beta-4B chain;Tubulin beta-4A chain;Tubulin beta-2A chain;Tubulin beta-2B chain	no	no	0	0	0	3.4	1.36	1		1	2	1	15.885	15.885	2	0.00049575	6106	DP1141_9	132.76	65.959			542410000	1511	122;323;381	1440	2473;2474;2475;2476;2477	3321;3322;3323;3324;3325;3326;3327;3328;3329;3330;3331;3332	3329		12	9606
TAVETAVLLLR	Unmodified	1184.7129	0.71287311	246	P49368	CCT3	T-complex protein 1 subunit gamma	yes	yes	0	0	0	3	0			1			20.928	20.928	2	0.0042907	15250	DP1141_8	131.62	82.822			30944000	1512	246	1441	2478	3333	3333		1	9606
TAWAETSRPPETEPGPPAPKPPLPPPHR	Unmodified	3009.5461	0.54608914	243	P48634	PRRC2A	Protein PRRC2A	yes	yes	0	0	2	2	0		1				16.895	16.895	4	0.0069731	9210	DP1141_7	42.172	29.08			16668000	1513	243	1442	2479	3334	3334		1	9606
TAWTMGARGLDKR	Acetyl (Protein N-term)	1503.7616	0.76163099	489	Q8WYP3	RIN2	Ras and Rab interactor 2	yes	yes	1	0	2	2	0		1				15.675	15.675	3	0.018723	7271	DP1141_7	51.841	21.905			17292000	1514	489	1443	2480	3335	3335		1	9606
TCPVQLWVDSTPPPGTR	Unmodified	1909.9356	0.93563219	104	P04637	TP53	Cellular tumor antigen p53	yes	yes	0	0	0	3.5	0.5			1	1		20.307	20.307	2	2.6629E-23	14296	DP1141_8	212.1	174.4			75422000	1515	104	1444	2481;2482	3336;3337;3338;3339	3337		4	9606
TCVFEKENDPSVMR	Unmodified	1710.7705	0.7705407	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	1	0	2					16.647	16.647	2;3	0.00011756	8114	DP1141_6	147.73	129.32			92969000	1516	367	1445	2483;2484	3340;3341	3340		2	9606
TCVFEKENDPSVMR	Oxidation (M)	1726.7655	0.76545532	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	1	2	0		1				15.584	15.584	3	0.010845	6966	DP1141_7	68.751	37.536			12278000	1517	367	1445	2485	3342	3342	286	0	9606
TDAAVSFAK	Acetyl (Protein N-term)	950.47091	0.4709115	109	P05141	SLC25A5	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed	yes	yes	1	0	0	1	0	1					18.654	18.654	2	0.015432	11283	DP1141_6	82.75	57.176			16592000	1518	109	1446	2486	3343	3343		0	9606
TDCDIEDDRLAAMFR	Unmodified	1826.7927	0.7927327	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	1	0	1					20.238	20.238	3	0.011514	13687	DP1141_6	104.59	71.585			29377000	1519	367	1447	2487	3344	3344		0	9606
TDCNHIFLNFVPTVIMDPSK	Oxidation (M)	2363.129	0.12898862	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	0	1	0	1					21.825	21.825	3	3.416E-05	16230	DP1141_6	139.38	118.76			30162000	1520	367	1448	2488	3345;3346;3347	3346	287	3	9606
TDEKVDESGPPAPSKPR	Unmodified	1808.8905	0.89045614	415	Q29RF7	PDS5A	Sister chromatid cohesion protein PDS5 homolog A	yes	yes	0	0	2	2.67	0.943		2		1		13.185	13.185	3;4	0.0051791	3330	DP1141_7	82.942	55.004			3952700	1521	415	1449	2489;2490;2491	3348;3349;3350;3351;3352	3351		5	9606
TDFGIFR	Unmodified	854.42865	0.42865276	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3.5	1.12		1	1	1	1	19.81	19.81	2	1.2298E-05	13695	DP1141_9	129.96	97.032			1828699999.9999998	1522	567	1450	2492;2493;2494;2495	3353;3354;3355;3356	3356		4	9606
TDPENTDYTMEHGATR	Oxidation (M)	1852.7534	0.75337031	542	Q9BW85	CCDC94	Coiled-coil domain-containing protein 94	yes	yes	0	1	0	4	0				1		14.344	14.344	3	0.0071484	4813	DP1141_9	68.978	49.284			3070800	1523	542	1451	2496	3357	3357	388	0	9606
TDRGGDSIGETPTPGASK	Unmodified	1744.8228	0.8227705	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	3	1.58	1	1		1	1	14.447	14.447	2;3	5.2819E-44	5248	DP1141_7	187.08	127			50817000	1524	78	1452	2497;2498;2499;2500	3358;3359;3360;3361	3360		4	9606
TDRGGDSIGETPTPGASKR	Unmodified	1900.9239	0.92388153	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	2	2.71	1.03	1	2	2	2		13.834	13.834	3;4	1.0123E-05	4280	DP1141_7	121.51	103.81			92679000	1525	78	1453	2501;2502;2503;2504;2505;2506;2507	3362;3363;3364;3365;3366;3367;3368;3369;3370;3371;3372	3366		11	9606
TDRYTIHSQLEHLQSK	Acetyl (Protein N-term)	1996.9967	0.99665254	543	Q9BWJ5	SF3B5	Splicing factor 3B subunit 5	yes	yes	1	0	1	5	0					1	17.432	17.432	3	0.00054783	10237	DP1141_10	133.87	113.27			27803000	1526	543	1454	2508	3373;3374	3373		2	9606
TDTNVSKPSFAAESVGQSAEPPKPSVEPALQQHR	Unmodified	3588.7809	0.78085269	438	Q6W2J9	BCOR	BCL-6 corepressor	yes	yes	0	0	2	2	0		1				17.099	17.099	5	6.0126E-20	9543	DP1141_7	102.75	81.558			13329000	1527	438	1455	2509	3375	3375		1	9606
TDYNASVSVPDSSGPER	Unmodified	1779.7911	0.79113602	284	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	yes	yes	0	0	0	4	0.816			1	1	1	16.886	16.886	2	0	9526	DP1141_10	297.5	258.33			282190000	1528	284	1456	2510;2511;2512	3376;3377;3378;3379;3380;3381	3376		6	9606
TEDFIIDTLELR	Unmodified	1463.7508	0.75077476	340	Q01780	EXOSC10	Exosome component 10	yes	yes	0	0	0	2.5	0.5		1	1			22.72	22.72	2	5.0308999999999997E-23	18126	DP1141_7	162.36	116.2			6410700	1529	340	1457	2513;2514	3382;3383	3382		2	9606
TEELEEESFPER	Unmodified	1493.6522	0.65218292	612	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	yes	yes	0	0	0	2	0.816	1	1	1			17.626	17.626	2	2.5796999999999997E-80	10475	DP1141_7	204.52	177.77			40268000	1530	612	1458	2515;2516;2517	3384;3385;3386;3387;3388	3386		5	9606
TEELNKEVASNSELVQSSR	Unmodified	2119.0393	0.039305217	16	CON__P08779;P08779	KRT16	Keratin, type I cytoskeletal 16	yes	no	0	0	1	4	0				2		16.821	16.821	2;3	3.1618999999999996E-248	8936	DP1141_9	258.41	184.46		+	229180000	1531	16	1459	2518;2519	3389;3390;3391	3391		3	9606
TEIIILATR	Unmodified	1028.623	0.62299547	182	P23396	RPS3	40S ribosomal protein S3	yes	yes	0	0	0	5	0					1	19.227	19.227	2	0.0097966	13354	DP1141_10	90.657	61.184			74243000	1532	182	1460	2520	3392	3392		1	9606
TEILPPFFK	Unmodified	1090.6063	0.60628277	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	2	0.707	1	2	1			21.316	21.316	1;2	4.8081E-05	15988	DP1141_7	147.34	20.314			1002099999.9999999	1533	78	1461	2521;2522;2523;2524	3393;3394;3395;3396;3397	3394		4	9606
TERDTPGHGSGWAETPR	Unmodified	1852.8452	0.84523728	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	2	0		1				14.658	14.658	3	1.7613E-05	5541	DP1141_7	114.03	92.198			48282000	1534	78	1462	2525	3398	3398		0	9606
TFAPEEISAMVLTK	Unmodified	1535.7905	0.79053108	139	P11021	HSPA5	78 kDa glucose-regulated protein	yes	yes	0	0	0	3	0			1			21.629	21.629	2	0.026986	16275	DP1141_8	69.815	28.126			17190000	1535	139	1463	2526	3399	3399		1	9606
TFEDFVR	Unmodified	912.43413	0.43413207	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	2					18.654	18.654	1;2	5.0987E-12	11477	DP1141_6	158.53	121.95			457310000	1536	367	1464	2527;2528	3400;3401;3402	3401		3	9606
TFQVLGNLYSEGDCTYLK	Unmodified	2106.9932	0.99320665	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	0	4	1			1		1	21.529	21.529	2	6.5303E-06	16259	DP1141_8	193.51	159.32			40353000	1537	521	1465	2529;2530	3403;3404;3405	3404		3	9606
TFTDCFNCLPIAAIVDEK	Unmodified	2112.986	0.98601278	286;212;287	P62140;P62136;P36873	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	no	no	0	0	0	3.5	0.957		1	2	2	1	23.202	23.202	2;3	0	19217	DP1141_10	324.48	291.25			860200000	1538	287;286;212	1466	2531;2532;2533;2534;2535;2536	3406;3407;3408;3409;3410;3411;3412;3413;3414;3415;3416;3417;3418;3419;3420;3421;3422;3423	3407		18	9606
TFYNQAIMSSK	Oxidation (M)	1304.6071	0.60708741	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	1	0	4	0.816			1	1	1	16.855	16.855	2	0.0077566	8932	DP1141_9	110.53	85.658			389740000	1539	567	1467	2537;2538;2539	3424;3425;3426	3426	407	3	9606
TFYNQAIMSSK	Unmodified	1288.6122	0.61217279	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3	0			1			17.925	17.925	2	0.011616	10841	DP1141_8	88.496	67.032			302240000	1540	567	1467	2540	3427	3427		1	9606
TGAIVDVPVGEELLGR	Unmodified	1623.8832	0.88318591	187	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	yes	yes	0	0	0	3	0			1			21.028	21.028	2	0.0032358	15349	DP1141_8	180.24	134.48			25819000	1541	187	1468	2541	3428	3428		1	9606
TGEEDKKINEELESQYQQSMDSK	Oxidation (M)	2731.213	0.21304842	32	O00193	SMAP	Small acidic protein	yes	yes	0	1	2	5	0					1	17.237	17.237	3	1.5207E-08	10273	DP1141_10	145.73	119.1			16892000	1542	32	1469	2542	3429	3429	30	1	9606
TGLREEHLACFGHVR	Unmodified	1780.8791	0.87912036	510	Q96F63	CCDC97	Coiled-coil domain-containing protein 97	yes	yes	0	0	1	4	0				1		16.208	16.208	4	0.025246	7773	DP1141_9	60.937	42.114			147260000	1543	510	1470	2543	3430	3430		0	9606
TGTAEMSSILEER	Oxidation (M)	1438.661	0.66097347	187	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	yes	yes	0	1	0	5	0					1	16.646	16.646	2	0.0043778	9039	DP1141_10	125.23	64.397			19810000	1544	187	1471	2544	3431	3431	163	1	9606
TGTTGQSGAESGTTEPSAR	Unmodified	1793.8028	0.80276334	452	Q7Z5P9	MUC19	Mucin-19	yes	yes	0	0	0	3.5	1.12		1	1	1	1	20.135	20.135	2	1.9945E-05	14040	DP1141_9	114.21	67.253			1332500000	1545	452	1472	2545;2546;2547;2548	3432;3433;3434;3435	3435		4	9606
TGVVPQLVK	Unmodified	939.57532	0.57531699	264	P52292	KPNA2	Importin subunit alpha-1	yes	yes	0	0	0	3	0			1			17.48	17.48	2	0.019317	10013	DP1141_8	84.916	40.799			17148000	1546	264	1473	2549	3436	3436		1	9606
THEDIEAQIR	Unmodified	1210.5942	0.59421454	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	3.43	1.4	1	1	1	2	2	15.295	15.295	2;3	1.806E-30	6420	DP1141_8	150.27	107.18			570700000	1547	78	1474	2550;2551;2552;2553;2554;2555;2556	3437;3438;3439;3440;3441;3442;3443;3444;3445	3443		9	9606
THNLEPYFESFINNLR	Unmodified	1992.9694	0.96937516	102	P04264;CON__P04264	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	0	0	3.33	1.11		2	1	2	1	22.699	22.699	2;3	5.3544E-288	18047	DP1141_7	230.96	212.28		+	160800000	1548	102	1475	2557;2558;2559;2560;2561;2562	3446;3447;3448;3449;3450;3451;3452;3453;3454;3455;3456;3457;3458	3450		13	9606
THNLEPYFESFINNLRR	Unmodified	2149.0705	0.070486187	102	P04264;CON__P04264	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	0	1	2.33	0.471		2	1			21.91	21.91	3;4	0.00023335	16819	DP1141_7	119.54	93.987		+	57857000	1549	102	1476	2563;2564;2565	3459;3460;3461	3460		3	9606
THSDQFLVAFK	Unmodified	1291.6561	0.65608651	210	P36542	ATP5C1	ATP synthase subunit gamma, mitochondrial	yes	yes	0	0	0	4	0				1		18.656	18.656	2	7.617400000000001E-70	11791	DP1141_9	188.91	130.68			0	1550	210	1477	2566	3462	3462		1	9606
THVTHHPLSDHEATLR	Unmodified	1849.9183	0.91834264	137	P10321	HLA-C	HLA class I histocompatibility antigen, Cw-7 alpha chain	yes	yes	0	0	0	4	0				1		13.731	13.731	4	0.013929	3790	DP1141_9	58.723	0			1232300	1551	137	1478	2567	3463	3463		1	9606
TIAECLADELINAAK	Unmodified	1630.8236	0.82362212	237	P46782	RPS5	40S ribosomal protein S5;40S ribosomal protein S5, N-terminally processed	yes	yes	0	0	0	5	0					1	23.439	23.439	2	4.2076999999999997E-100	19577	DP1141_10	246.56	208.85			33499000	1552	237	1479	2568	3464;3465;3466;3467	3466		4	9606
TIAEQLAEK	Unmodified	1001.5393	0.53932542	445	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	yes	yes	0	0	0	1	0	1					16.455	16.455	2	5.4008E-05	7723	DP1141_6	147.29	45.962			18560000	1553	445	1480	2569	3468	3468		1	9606
TIAFLLPMFR	Unmodified	1207.6787	0.67873621	445	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	yes	yes	0	0	0	2.5	0.5		1	1			23.977	23.977	2	3.2244E-21	19956	DP1141_7	174.27	134.2			18906000	1554	445	1481	2570;2571	3469;3470	3469		2	9606
TIAFLLPMFR	Oxidation (M)	1223.6737	0.67365083	445	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	yes	yes	0	1	0	2.5	0.5		1	1			22.61	22.61	2	0.0082303	17928	DP1141_7	110.81	70.74			5756200	1555	445	1481	2572;2573	3471;3472	3471	330	1	9606
TIAQDYGVLK	Unmodified	1106.5972	0.59717465	348	Q06830	PRDX1	Peroxiredoxin-1	yes	yes	0	0	0	5	0					1	18.063	18.063	2	0.0049522	11367	DP1141_10	112.41	73.605			45050000	1556	348	1482	2574	3473	3473		0	9606
TICSHVQNMIK	Oxidation (M)	1345.6482	0.64824072	203	P32969	RPL9	60S ribosomal protein L9	yes	yes	0	1	0	5	0					1	14.769	14.769	3	0.02012	5948	DP1141_10	66.92	44.359			80038000	1557	203	1483	2575	3474	3474	173	1	9606
TIDEGDADEVTK	Unmodified	1291.578	0.57795535	447	Q7LBC6	KDM3B	Lysine-specific demethylase 3B	yes	yes	0	0	0	3	1		1		1		15.341	15.341	2	0.0026578	6423	DP1141_9	123.79	83.069			48381000	1558	447	1484	2576;2577	3475;3476	3476		2	9606
TIDGILLLIER	Unmodified	1254.7547	0.75473792	378	Q13619;Q13620	CUL4A;CUL4B	Cullin-4A;Cullin-4B	yes	no	0	0	0	2	0		1				23.978	23.978	2	1.6585E-14	19415	DP1141_7	167.12	138.91			4558100	1559	378	1485	2578	3477;3478	3477		2	9606
TIEYLQPNPASR	Unmodified	1387.7096	0.70957864	534	Q99962;Q99961	SH3GL2;SH3GL1	Endophilin-A1;Endophilin-A2	yes	no	0	0	0	1	0	1					17.579	17.579	2	0.023367	9575	DP1141_6	107.79	64.346			0	1560	534	1486	2579	3479	3479		1	9606
TIGGGDDSFNTFFSETGAGK	Unmodified	2006.8858	0.88576469	321;442	P68363;Q71U36;P0DPH8;P0DPH7;Q6PEY2	TUBA1B;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	no	no	0	0	0	3.5	1.12		1	1	1	1	21.216	21.216	2	1.5571999999999998E-256	15760	DP1141_8	254.1	233.25			710060000	1561	321;442	1487	2580;2581;2582;2583	3480;3481;3482;3483;3484;3485;3486	3482		7	9606
TILQGSSEGTGLSALLPQPK	Unmodified	1996.0841	0.084070566	492	Q92733	PRCC	Proline-rich protein PRCC	yes	yes	0	0	0	3	0			1			21.128	21.128	2	0.00010609	15547	DP1141_8	139.64	100.05			11980000	1562	492	1488	2584	3487	3487		1	9606
TINLYPLTNYTFGTK	Unmodified	1744.9036	0.903587	61	O43809	NUDT21	Cleavage and polyadenylation specificity factor subunit 5	yes	yes	0	0	0	5	0					1	21.809	21.809	2	3.3903999999999994E-21	17274	DP1141_10	168.83	110.15			70014000	1563	61	1489	2585	3488;3489;3490	3489		3	9606
TIPNDPGFVVTLSNR	Unmodified	1628.8522	0.85222014	501	Q93009	USP7	Ubiquitin carboxyl-terminal hydrolase 7	yes	yes	0	0	0	2	0		1				19.9	19.9	2	0.022056	14055	DP1141_7	68.44	54.431			20051000	1564	501	1490	2586	3491	3491		1	9606
TIQFVDWCPTGFK	Unmodified	1597.7599	0.75989966	442	Q71U36;P0DPH8;P0DPH7;Q6PEY2	TUBA1A;TUBA3E	Tubulin alpha-1A chain;Tubulin alpha-3E chain	no	no	0	0	0	3.5	0.5			1	1		21.806	21.806	2	9.7594E-116	16453	DP1141_8	224.75	148.58			61748000	1565	442	1491	2587;2588	3492;3493;3494;3495;3496	3493		5	9606
TIQVENSHLILTGAGALNK	Unmodified	1978.0847	0.084739268	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	2					18.851	18.851	2;3	4.2989000000000005E-221	11650	DP1141_6	277.94	236.25			165120000	1566	367	1492	2589;2590	3497;3498;3499;3500	3499		4	9606
TISTMKVMQFQGMKR	2 Oxidation (M)	1816.8998	0.89978073	527	Q99538	LGMN	Legumain	yes	yes	0	2	2	3	0			1			22.393	22.393	2	0.035652	17371	DP1141_8	56.404	13.687			0	1567	527	1493	2591	3501	3501	380;381	1	9606
TITLEVEPSDTIENVK	Unmodified	1786.92	0.92002493	134	P62987;P62979;P0CG47;P0CG48	UBA52;RPS27A;UBB;UBC	Ubiquitin-60S ribosomal protein L40;Ubiquitin;60S ribosomal protein L40;Ubiquitin-40S ribosomal protein S27a;Ubiquitin;40S ribosomal protein S27a;Polyubiquitin-B;Ubiquitin;Polyubiquitin-C;Ubiquitin	yes	no	0	0	0	3	1.63	1		1		1	19.436	19.436	2	1.7557E-162	13053	DP1141_8	238.98	186.7			128220000	1568	134	1494	2592;2593;2594	3502;3503;3504;3505;3506;3507	3506		6	9606
TIVQLENEIYQIK	Unmodified	1589.8665	0.86647322	83	O75934	BCAS2	Pre-mRNA-splicing factor SPF27	yes	yes	0	0	0	5	0					1	21.326	21.326	2	0.035343	16560	DP1141_10	71.03	37.07			18365000	1569	83	1495	2595	3508	3508		1	9606
TKDHTLVQTIAR	Unmodified	1381.7678	0.76776223	390	Q14684	RRP1B	Ribosomal RNA processing protein 1 homolog B	yes	yes	0	0	1	2	0		1				15.059	15.059	3	0.013297	6198	DP1141_7	103.14	54.394			13067000	1570	390	1496	2596	3509	3509		0	9606
TKEAVLLLK	Unmodified	1013.6485	0.64848194	211	P36578	RPL4	60S ribosomal protein L4	yes	yes	0	0	1	4	0				1		16.598	16.598	2	0.03032	8398	DP1141_9	123.86	64.707			23420000	1571	211	1497	2597	3510	3510		0	9606
TKTPGPGAQSALR	Unmodified	1282.6993	0.69934831	291	P62263	RPS14	40S ribosomal protein S14	yes	yes	0	0	1	5	0					1	13.904	13.904	3	1.6127E-20	4655	DP1141_10	167.22	137.88			8385600	1572	291	1498	2598	3511;3512	3512		2	9606
TKYEHELALR	Unmodified	1258.667	0.66698555	16	CON__P08779;P08779	KRT16	Keratin, type I cytoskeletal 16	yes	no	0	0	1	4	0				1		15.224	15.224	3	0.01064	6023	DP1141_9	141.91	124.19		+	93995000	1573	16	1499	2599	3513;3514	3513		2	9606
TLATDILMGVLK	Oxidation (M)	1289.7265	0.72647426	54	O43143	DHX15	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15	yes	yes	0	1	0	2	0		1				23.161	23.161	2	0.033097	18739	DP1141_7	94.409	72.559			12702000	1574	54	1500	2600	3515	3515	49	1	9606
TLGSSDTQQLR	Unmodified	1204.6048	0.60477922	537	Q9BRD0	BUD13	BUD13 homolog	yes	yes	0	0	0	4	0				1		15.247	15.247	2	0.0055637	6105	DP1141_9	112.75	71.3			29778000	1575	537	1501	2601	3516	3516		1	9606
TLLDIDNTR	Unmodified	1059.556	0.55603811	19	CON__P35527;P35527	KRT9	Keratin, type I cytoskeletal 9	yes	no	0	0	0	2.5	1.5	1			1		18.272	18.272	2	1.2498E-36	10762	DP1141_6	206.09	119.29		+	387380000	1576	19	1502	2602;2603	3517;3518	3517		1	9606
TLLEGEESR	Unmodified	1032.5088	0.50875357	102	P04264;CON__P04264;CON__ENSEMBL:ENSBTAP00000038253	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	0	0	3	1.41	1	1	1	1	1	15.817	15.817	2	1.3916E-20	7165	DP1141_8	171.53	125.85		+	1041399999.9999999	1577	102	1503	2604;2605;2606;2607;2608	3519;3520;3521;3522;3523;3524;3525;3526	3524		8	9606
TLLWTELFR	Unmodified	1177.6495	0.64954457	33	O00217	NDUFS8	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial	yes	yes	0	0	0	5	0					1	23.719	23.719	2	0.010037	19842	DP1141_10	98.629	67.326			1703800	1578	33	1504	2609	3527	3527		1	9606
TLMNLGGLAVAR	Oxidation (M)	1230.6754	0.67544174	213	P37802	TAGLN2	Transgelin-2	yes	yes	0	1	0	5	0					1	18.637	18.637	2	0.029452	12491	DP1141_10	101.65	68.268			190570000	1579	213	1505	2610	3528	3528	179	1	9606
TLNDMRQEYEQLIAK	Oxidation (M)	1866.9146	0.9145624	19	CON__P35527;P35527	KRT9	Keratin, type I cytoskeletal 9	yes	no	0	1	1	2	0		1				18.359	18.359	3	0.029541	11451	DP1141_7	56.46	9.4224		+	92249000	1580	19	1506	2611	3529	3529	23	0	9606
TLRDPSLPLLELQDIMTSVSGR	Oxidation (M)	2456.2945	0.29447405	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	1	1.5	0.5	1	1				22.139	22.139	3	1.2513E-07	17279	DP1141_7	140.2	110.38			36171000	1581	367	1507	2612;2613	3530;3531;3532;3533;3534;3535	3535	265	6	9606
TLTAVHDAILEDLVFPSEIVGK	Unmodified	2366.2733	0.2733279	285	P62081	RPS7	40S ribosomal protein S7	yes	yes	0	0	0	5	0					1	23.265	23.265	3	0.0054195	19430	DP1141_10	60.325	37.672			6079900	1582	285	1508	2614	3536	3536		1	9606
TLTEPRTNLK	Unmodified	1171.6561	0.65608651	37	O00481	BTN3A1	Butyrophilin subfamily 3 member A1	yes	yes	0	0	1	2	0		1				21.996	21.996	2	0.014654	16295	DP1141_7	94.114	26.134			7022400	1583	37	1509	2615	3537	3537		0	9606
TLTNYAARTKSLDMEIQALK	Oxidation (M)	2282.194	0.19403172	628				yes	yes	0	1	2	2	0		1				13.908	13.908	5	0.035947	4529	DP1141_7	42.633	17.84	+		7022100	1584	628	1510	2616	3538	3538	431	1	9606
TLVSTVGSMVFNEGEAQR	Oxidation (M)	1939.9309	0.93094074	585	Q9P2E9	RRBP1	Ribosome-binding protein 1	yes	yes	0	1	0	4	0				1		20.486	20.486	2	0.034842	15100	DP1141_9	74.611	38.164			88599000	1585	585	1511	2617	3539	3539	413	0	9606
TLYGFGG	Unmodified	713.33844	0.33844077	303	P62805	HIST1H4A	Histone H4	yes	yes	0	0	0	5	0					1	20.226	20.226	1	1.962E-09	14816	DP1141_10	143.88	143.88			132400000	1586	303	1512	2618	3540;3541	3541		2	9606
TMIISPER	Unmodified	945.49535	0.49535211	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	2	0		1				16.694	16.694	2	0.0049658	8653	DP1141_7	116.88	66.181			46858000	1587	78	1513	2619	3542;3543	3542		2	9606
TMIISPER	Oxidation (M)	961.49027	0.49026674	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	1	0	3	0			1			15.333	15.333	2	0.02727	6447	DP1141_8	85.064	49.184			0	1588	78	1513	2620	3544	3544	73	1	9606
TNAENEFVTIK	Unmodified	1264.6299	0.62993134	102	P04264;CON__P04264	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	0	0	5	0					1	17.793	17.793	2	0.028693	10952	DP1141_10	85.533	44.104		+	12447000	1589	102	1514	2621	3545	3545		0	9606
TNAENEFVTIKK	Unmodified	1392.7249	0.72489436	102	P04264;CON__P04264	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	0	1	2.33	1.25	1	1		1		16.143	16.143	3	1.4907999999999999E-52	7730	DP1141_9	193.15	130.62		+	1199600000	1590	102	1515	2622;2623;2624	3546;3547;3548	3548		2	9606
TNVVTMPTAHPR	Oxidation (M)	1338.6714	0.671419	373	Q13428	TCOF1	Treacle protein	yes	yes	0	1	0	2	0		1				13.478	13.478	3	0.0090182	3827	DP1141_7	74.698	58.606			2551600	1591	373	1516	2625	3549;3550	3549	297	2	9606
TPAQYDASELK	Unmodified	1221.5877	0.58773217	3	P07355;A6NMY6	ANXA2;ANXA2P2	Annexin A2;Putative annexin A2-like protein	yes	no	0	0	0	4	0				1		16.108	16.108	2	6.3284E-08	7583	DP1141_9	161.19	121.64			19409000	1592	3	1517	2626	3551	3551		0	9606
TPCNAGTFSQPEK	Unmodified	1435.6402	0.64017845	59	O43684	BUB3	Mitotic checkpoint protein BUB3	yes	yes	0	0	0	4	0				1		15.192	15.192	2	0.005002	6127	DP1141_9	110.93	76.746			10987000	1593	59	1518	2627	3552	3552		1	9606
TPGPGAQSALR	Unmodified	1053.5567	0.55670682	291	P62263	RPS14	40S ribosomal protein S14	yes	yes	0	0	0	5	0					1	14.769	14.769	2	8.4351E-53	5889	DP1141_10	195.57	167.69			224690000	1594	291	1519	2628	3553;3554;3555	3554		3	9606
TPLGPLSSR	Unmodified	926.51853	0.5185304	339	Q01167	FOXK2	Forkhead box protein K2	yes	yes	0	0	0	3	0			1			16.669	16.669	2	0.0050352	8690	DP1141_8	111.74	76.245			32216000	1595	339	1520	2629	3556	3556		1	9606
TPSPAAEDAREPEAK	Unmodified	1567.7478	0.74781464	494	Q92797	SYMPK	Symplekin	yes	yes	0	0	1	2	0		1				13.74	13.74	3	0.0050892	4177	DP1141_7	143.56	115.24			8556600	1596	494	1521	2630	3557	3557		1	9606
TPTQTNGSNVPFKPR	Unmodified	1642.8427	0.84271808	327	P78347	GTF2I	General transcription factor II-I	yes	yes	0	0	1	2	0		1				15.252	15.252	3	0.0078678	6375	DP1141_7	117.48	87.303			9720300	1597	327	1522	2631	3558	3558		1	9606
TPTSSPASSPLVAK	Unmodified	1341.714	0.71399532	390	Q14684	RRP1B	Ribosomal RNA processing protein 1 homolog B	yes	yes	0	0	0	4	1			1		1	15.692	15.692	2	1.14E-135	7463	DP1141_10	231.07	156.69			72139000	1598	390	1523	2632;2633	3559;3560;3561;3562;3563	3560		5	9606
TPVEEVPAAIAPFQGR	Unmodified	1680.8835	0.88352026	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	0	1.5	0.5	1	1				19.828	19.828	2	1.0189E-239	13292	DP1141_6	254.07	201.83			415890000	1599	402	1524	2634;2635	3564;3565;3566;3567	3564		4	9606
TPVEPEVAIHR	Unmodified	1246.667	0.66698555	279	P60866	RPS20	40S ribosomal protein S20	yes	yes	0	0	0	5	0					1	15.736	15.736	3	0.0027291	7697	DP1141_10	106.16	73.1			40910000	1600	279	1525	2636	3568	3568		1	9606
TQDENPVVHFFK	Unmodified	1459.7096	0.70957864	99	P02686	MBP	Myelin basic protein	yes	yes	0	0	0	2	0		1				19	19	3	0.010734	12592	DP1141_7	80.318	47.841			18766000	1601	99	1526	2637	3569	3569		1	9606
TQGVPAVLK	Unmodified	911.54402	0.54401687	259	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	yes	yes	0	0	0	2	0		1				16.465	16.465	2	0.028801	8390	DP1141_7	76.478	39.777			73850000	1602	259	1527	2638	3570	3570		1	9606
TQLSLLPR	Unmodified	926.55492	0.5549159	398	Q15020	SART3	Squamous cell carcinoma antigen recognized by T-cells 3	yes	yes	0	0	0	2	0		1				18.6	18.6	2	1.4826E-05	11900	DP1141_7	139.68	76.532			37600000	1603	398	1528	2639	3571	3571		1	9606
TQSRPGGPPNPPGPSPK	Unmodified	1669.8536	0.85361712	94	O95785	WIZ	Protein Wiz	yes	yes	0	0	1	2	0		1				14.079	14.079	3	0.022083	4513	DP1141_7	79.837	54.963			9787600	1604	94	1529	2640	3572	3572		0	9606
TRLEQEIATYR	Unmodified	1378.7205	0.72047768	16;9;21	CON__P02533;P02533;CON__Q6IFX2;CON__P19012;CON__A2A4G1;P19012;CON__Q04695;Q04695;CON__Q9QWL7;CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8	KRT14;KRT15;KRT17;KRT16	Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 15;Keratin, type I cytoskeletal 17;Keratin, type I cytoskeletal 16	no	no	0	0	1	4	0				2		17.586	17.586	2;3	1.1483000000000001E-20	10120	DP1141_9	172.17	113.02		+	177030000	1605	9;21;16	1530	2641;2642	3573;3574	3574		2	9606
TSAAQAIHPGCGFLSENMEFAELCK	Oxidation (M)	2783.2353	0.23532096	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	1	0	3	0			1			20.007	20.007	3	1.1452E-11	13848	DP1141_8	130.72	111.51			36735000	1606	521	1531	2643	3575	3575	378	1	9606
TSASIGSLCADAR	Unmodified	1307.614	0.6139637	276	P60201	PLP1	Myelin proteolipid protein	yes	yes	0	0	0	3	1.58	1	1		1	1	16.893	16.893	2	0	8512	DP1141_6	279.77	240.47			330170000	1607	276	1532	2644;2645;2646;2647	3576;3577;3578;3579;3580;3581;3582;3583;3584	3577		9	9606
TSASIILR	Unmodified	859.51272	0.51271674	165	P17987	TCP1	T-complex protein 1 subunit alpha	yes	yes	0	0	0	4	0				1		16.886	16.886	2	0.002243	8893	DP1141_9	124.59	58.791			9026400	1608	165	1533	2648	3585	3585		0	9606
TSEEEKNGSEELVEK	Unmodified	1706.7847	0.78465366	552	Q9H0C8	ILKAP	Integrin-linked kinase-associated serine/threonine phosphatase 2C	yes	yes	0	0	1	4	0				1		14.28	14.28	3	3.0382E-05	4719	DP1141_9	122.33	93.548			6255200	1609	552	1534	2649	3586	3586		0	9606
TSEEEKNGSEELVEKK	Unmodified	1834.8796	0.87961668	552	Q9H0C8	ILKAP	Integrin-linked kinase-associated serine/threonine phosphatase 2C	yes	yes	0	0	2	4	0				1		13.537	13.537	3	0.025506	3681	DP1141_9	84.508	54.4			504700	1610	552	1535	2650	3587	3587		1	9606
TSIAIDTIINQK	Unmodified	1315.7347	0.73473076	187	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	yes	yes	0	0	0	3	0			1			19.377	19.377	2	0	12914	DP1141_8	271.26	204.99			10006000	1611	187	1536	2651	3588	3588		1	9606
TSPASLDFPESQK	Unmodified	1405.6725	0.67252444	514	Q96JM3	CHAMP1	Chromosome alignment-maintaining phosphoprotein 1	yes	yes	0	0	0	2	0		1				17.699	17.699	2	0.0061576	10330	DP1141_7	91.469	50.389			18218000	1612	514	1537	2652	3589	3589		1	9606
TSQNSELNNMQDLVEDYKK	Oxidation (M)	2271.0325	0.03250528	20	CON__P35908v2;CON__P35908;P35908	KRT2	Keratin, type II cytoskeletal 2 epidermal	yes	no	0	1	1	2.33	1.25	1	1		1		16.901	16.901	3	2.1039E-05	8517	DP1141_6	119.51	91.395		+	144840000	1613	20	1538	2653;2654;2655	3590;3591;3592;3593	3590	25	4	9606
TSSGDASSLSIEETNKLR	Unmodified	1893.928	0.92796385	57	O43290	SART1	U4/U6.U5 tri-snRNP-associated protein 1	yes	yes	0	0	1	2	0		1				16.903	16.903	3	0.00021983	9191	DP1141_7	98.421	70.655			22029000	1614	57	1539	2656	3594	3594		0	9606
TSTAPAASPNVR	Unmodified	1170.5993	0.59929991	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2.67	1.7	1	1			1	13.772	13.772	2	1.4342E-05	4072	DP1141_7	150.35	99.546			21836000	1615	142	1540	2657;2658;2659	3595;3596;3597;3598;3599;3600	3599		6	9606
TSTTSSMVASAEQPR	Oxidation (M)	1567.7148	0.71479996	224	Q6NXS1;P41236	PPP1R2P3;PPP1R2	Protein phosphatase inhibitor 2-like protein 3;Protein phosphatase inhibitor 2	yes	no	0	1	0	4.67	0.471				1	2	14.258	14.258	2;3	0.008722	5259	DP1141_10	63.29	39.834			117690000	1616	224	1541	2660;2661;2662	3601;3602;3603;3604	3603	183	4	9606
TTAARPTFEPAR	Acetyl (Protein N-term)	1358.6943	0.69426293	581	Q9P013	CWC15	Spliceosome-associated protein CWC15 homolog	yes	yes	1	0	1	4.5	0.5				1	1	16.57	16.57	2	0.0032852	9033	DP1141_10	116.55	52.73			44673000	1617	581	1542	2663;2664	3605;3606	3605		2	9606
TTAENEFVMLKK	Oxidation (M)	1425.7174	0.71736614	18	CON__P13647;P13647	KRT5	Keratin, type II cytoskeletal 5	no	no	0	1	1	2.67	1.25	1		1	1		16.613	16.613	3	0.0047261	8454	DP1141_9	80.245	34.416		+	16209000	1618	18	1543	2665;2666;2667	3607;3608;3609	3609	17	2	9606
TTASEPVEQSEATSK	Unmodified	1563.7264	0.7264105	397	Q15007	WTAP	Pre-mRNA-splicing regulator WTAP	yes	yes	0	0	0	4	0				1		13.947	13.947	2	0.0028658	4235	DP1141_9	139.76	97.424			1623700	1619	397	1544	2668	3610;3611	3610		2	9606
TTDGYLLR	Unmodified	937.4869	0.48689592	280	P61247	RPS3A	40S ribosomal protein S3a	yes	yes	0	0	0	4	0				1		17.279	17.279	2	0.021931	9571	DP1141_9	115.46	30.099			0	1620	280	1545	2669	3612	3612		1	9606
TTHFVEGGDAGNREDQINR	Unmodified	2114.973	0.97295699	167	P18124	RPL7	60S ribosomal protein L7	yes	yes	0	0	1	5	0					2	14.924	14.924	3;4	0.019822	6170	DP1141_10	117.13	78.136			395900000	1621	167	1546	2670;2671	3613;3614	3613		2	9606
TTLTAAITK	Unmodified	918.5386	0.53859714	247	P49411	TUFM	Elongation factor Tu, mitochondrial	yes	yes	0	0	0	4	0				1		16.283	16.283	2	0.006255	7844	DP1141_9	115.49	82.001			3163500	1622	247	1547	2672	3615	3615		1	9606
TTPDVIFVFGFR	Unmodified	1397.7343	0.73433683	307	P62847	RPS24	40S ribosomal protein S24	yes	yes	0	0	0	5	0					1	23.402	23.402	2	0.0020935	19572	DP1141_10	128.6	86.004			44835000	1623	307	1548	2673	3616;3617	3616		2	9606
TTPSYVAFTDTER	Unmodified	1486.694	0.69398816	135;140;161	P0DMV8;P0DMV9;P34931;P11142;P54652;P17066;P48741	HSPA1A;HSPA1B;HSPA1L;HSPA8;HSPA2;HSPA6;HSPA7	Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B;Heat shock 70 kDa protein 1-like;Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2;Heat shock 70 kDa protein 6;Putative heat shock 70 kDa protein 7	no	no	0	0	0	4	0.816			1	1	1	18.416	18.416	2	4.1576E-09	12011	DP1141_10	155.53	130.74			2700800000	1624	135;140;161	1549	2674;2675;2676	3618;3619;3620	3618		3	9606
TTQQIDLQGPGPWGFR	Acetyl (Protein N-term)	1841.906	0.90604662	31	O00151	PDLIM1	PDZ and LIM domain protein 1	yes	yes	1	0	0	4	0				1		22.89	22.89	2	1.1833E-06	18281	DP1141_9	185.25	114.1			3446100	1625	31	1550	2677	3621;3622	3621		2	9606
TTTAAAVASTGPSSR	Unmodified	1376.6896	0.68957148	192	P27816	MAP4	Microtubule-associated protein 4	yes	yes	0	0	0	2	0		1				14.358	14.358	2	0.0079628	5074	DP1141_7	104.94	43.724			7158000	1626	192	1551	2678	3623	3623		0	9606
TTVEYLIK	Unmodified	965.54335	0.54334816	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					18.055	18.055	2	0.013455	10401	DP1141_6	90.777	54.897			1093400000	1627	367	1552	2679	3624	3624		1	9606
TTVQQEPLESGAK	Unmodified	1386.6991	0.69907354	250	P49750	YLPM1	YLP motif-containing protein 1	yes	yes	0	0	0	1	0	1					15.01	15.01	2	4.5795E-10	5431	DP1141_6	150.1	88.51			0	1628	250	1553	2680	3625	3625		1	9606
TVAIHSDVDASSVHVK	Unmodified	1663.8529	0.85294842	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	0	0	2.67	1.25	1		1	1		15.399	15.399	3;4	3.3614E-06	6606	DP1141_8	153.2	127.08			291260000	1629	110	1554	2681;2682;2683	3626;3627;3628	3627		3	9606
TVAIYSEQDTGQMHR	Oxidation (M)	1750.7944	0.79444726	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	1	0	2.83	1.34	1	2	1	1	1	15.294	15.294	2;3	0.00070394	6313	DP1141_9	123.02	92.885			917070000	1630	142	1555	2684;2685;2686;2687;2688;2689	3629;3630;3631;3632;3633;3634;3635;3636	3636	145	8	9606
TVAIYSEQDTGQMHR	Unmodified	1734.7995	0.79953264	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2	0.816	1	1	1			16.149	16.149	3	0.00047918	7823	DP1141_7	163.51	139.42			441110000	1631	142	1555	2690;2691;2692	3637;3638;3639;3640	3638		4	9606
TVANLLSGK	Unmodified	901.52328	0.52328142	373	Q13428	TCOF1	Treacle protein	yes	yes	0	0	0	2	0		1				17.499	17.499	2	0.0023994	10121	DP1141_7	113.66	45.276			18277000	1632	373	1556	2693	3641	3641		0	9606
TVAVWDSETGER	Unmodified	1348.6259	0.62590859	505	Q96DI7	SNRNP40	U5 small nuclear ribonucleoprotein 40 kDa protein	yes	yes	0	0	0	4	0				1		17.588	17.588	2	5.4162E-06	10095	DP1141_9	152.97	106.51			7334200	1633	505	1557	2694	3642	3642		1	9606
TVCQIPLMKEMLK	2 Oxidation (M)	1621.8242	0.82415617	548	Q9C037	TRIM4	E3 ubiquitin-protein ligase TRIM4	yes	yes	0	2	1	2	0		1				17.999	17.999	3	0.029885	10929	DP1141_7	50.786	24.804			43949000	1634	548	1558	2695	3643	3643	394;395	0	9606
TVDPTEAAQAGGLDEDGKGPEQNPAEHKPSVIVTR	Unmodified	3612.7656	0.76559656	432	Q6PJG2	ELMSAN1	ELM2 and SANT domain-containing protein 1	yes	yes	0	0	2	3	0			1			16.923	16.923	5	2.1132E-06	9014	DP1141_8	48.831	34.125			18268000	1635	432	1559	2696	3644	3644		1	9606
TVEGAGSIAAATGFVK	Unmodified	1477.7777	0.77765821	214	P37840	SNCA	Alpha-synuclein	yes	yes	0	0	0	5	0					1	19.227	19.227	2	1.1492E-23	13198	DP1141_10	152.96	127.57			12377000	1636	214	1560	2697	3645	3645		0	9606
TVEGVLIVHEHR	Unmodified	1387.7572	0.75719754	61	O43809	NUDT21	Cleavage and polyadenylation specificity factor subunit 5	yes	yes	0	0	0	5	0					2	16.016	16.016	2;3	0.0021812	8020	DP1141_10	145.23	97.332			247870000	1637	61	1561	2698;2699	3646;3647	3646		2	9606
TVELSIPADPANLDSEAK	Unmodified	1868.9367	0.93673763	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	2.67	1.25	1		1	1		19.857	19.857	2	5.3779E-58	13200	DP1141_6	192.4	148.44			644030000	1638	367	1562	2700;2701;2702	3648;3649;3650;3651;3652;3653	3649		5	9606
TVFAEHISDECKR	Unmodified	1590.746	0.7460405	219	P39023	RPL3	60S ribosomal protein L3	yes	yes	0	0	1	1	0	1					15.358	15.358	3	0.0023489	6010	DP1141_6	119.74	87.128			8300600	1639	219	1563	2703	3654	3654		1	9606
TVGATALPR	Unmodified	884.50797	0.50796571	257	P50990	CCT8	T-complex protein 1 subunit theta	yes	yes	0	0	0	3	0			1			15.42	15.42	2	0.007402	6754	DP1141_8	101.33	38.863			51512000	1640	257	1564	2704	3655	3655		1	9606
TVGIVGNQPK	Unmodified	1011.5713	0.57129425	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3.25	1.48	1		1	1	1	14.955	14.955	2	0.0041685	6254	DP1141_10	124.08	52.203			87587000	1641	111	1565	2705;2706;2707;2708	3656;3657;3658;3659;3660;3661	3656		5	9606
TVINYDVAR	Unmodified	1049.5506	0.55055881	460	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	yes	yes	0	0	0	2	0		1				16.903	16.903	2	0.0047811	9134	DP1141_7	110.12	48.158			233170000	1642	460	1566	2709	3662	3662		1	9606
TVLDPVTGDLSDTR	Unmodified	1487.7468	0.74675201	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	0	1.5	0.5	1	1				18.877	18.877	2	2.8241999999999997E-157	11605	DP1141_6	236.69	185.25			371770000	1643	402	1567	2710;2711	3663;3664;3665;3666;3667	3663		5	9606
TVLIMELINNVAK	Oxidation (M)	1472.8273	0.82725094	118	P06576	ATP5B	ATP synthase subunit beta, mitochondrial	yes	yes	0	1	0	5	0					1	22.309	22.309	2	0.030763	17744	DP1141_10	83.869	40.218			4579200	1644	118	1568	2712	3668	3668	103	0	9606
TVNATGSSAAPGSSDKPSDPR	Unmodified	2000.9399	0.93992552	606	Q9UPT8	ZC3H4	Zinc finger CCCH domain-containing protein 4	yes	yes	0	0	1	3	0			1			13.849	13.849	3	0.025495	4306	DP1141_8	51.31	27.257			8514700	1645	606	1569	2713	3669	3669		1	9606
TVQTAVFLYSLYK	Unmodified	1531.8286	0.82863115	394	Q14839	CHD4	Chromodomain-helicase-DNA-binding protein 4	yes	yes	0	0	0	2	0		1				22.051	22.051	2	0.017602	17051	DP1141_7	118.9	83.727			0	1646	394	1570	2714	3670	3670		1	9606
TVTAAGAENIQQK	Unmodified	1329.6888	0.6888432	415	Q29RF7	PDS5A	Sister chromatid cohesion protein PDS5 homolog A	yes	yes	0	0	0	2	0		1				14.658	14.658	2	0.00065698	5627	DP1141_7	136.52	74.75			4920400	1647	415	1571	2715	3671	3671		1	9606
TVTAMDVVYALK	Unmodified	1309.6952	0.69517413	303	P62805	HIST1H4A	Histone H4	yes	yes	0	0	0	3	2	1				1	21.33	21.33	2	0.0044173	15423	DP1141_6	119.68	90.984			100350000	1648	303	1572	2716;2717	3672;3673;3674	3673		3	9606
TVTAMDVVYALKR	Oxidation (M)	1481.7912	0.79119978	303	P62805	HIST1H4A	Histone H4	yes	yes	0	1	1	5	0					1	18.929	18.929	3	8.3407E-10	12804	DP1141_10	145.23	118.99			0	1649	303	1573	2718	3675	3675	237	1	9606
TVTNAVVTVPAYFNDSQR	Unmodified	1980.9905	0.99050453	140	P11142	HSPA8	Heat shock cognate 71 kDa protein	yes	yes	0	0	0	3	0			1			19.926	19.926	2	1.6201E-295	13752	DP1141_8	315.43	254.79			145410000	1650	140	1574	2719	3676;3677	3677		2	9606
TVVLDLLR	Unmodified	927.57532	0.57531699	40	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	yes	yes	0	0	0	1	0	1					20.732	20.732	2	0.018358	14450	DP1141_6	101.28	42.303			4962000	1651	40	1575	2720	3678	3678		0	9606
TWNDPSVQQDIK	Unmodified	1429.6838	0.68375782	139	P11021	HSPA5	78 kDa glucose-regulated protein	yes	yes	0	0	0	3	0			1			17.524	17.524	2	3.4811E-09	10098	DP1141_8	173.64	137.26			67834000	1652	139	1576	2721	3679	3679		1	9606
TYMDVMREQHLTKEER	2 Oxidation (M)	2096.9619	0.96192329	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	2	2	2.33	0.471		2	1			14.12	14.12	3;4	0.0097677	4774	DP1141_7	59.634	44.38			38807000	1653	78	1577	2722;2723;2724	3680;3681;3682	3680	74;75	3	9606
TYPGVMHSSCPQEMAAVK	2 Oxidation (M)	2023.8802	0.8801675	90	O95372	LYPLA2	Acyl-protein thioesterase 2	yes	yes	0	2	0	5	0					1	14.924	14.924	3	0.0038902	6136	DP1141_10	75.97	66.913			75463000	1654	90	1578	2725	3683;3684	3683	78;79	2	9606
TYPGVMHSSCPQEMAAVK	Oxidation (M)	2007.8853	0.88525288	90	O95372	LYPLA2	Acyl-protein thioesterase 2	yes	yes	0	1	0	5	0					1	15.796	15.796	3	0.023328	7957	DP1141_10	52.254	33.392			26584000	1655	90	1578	2726	3685	3685	78;79	1	9606
TYQAIKDFNR	Unmodified	1254.6357	0.63568542	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	1	0	2					16.155	16.155	2;3	0.014964	7240	DP1141_6	131.52	102.79			261940000	1656	367	1579	2727;2728	3686;3687	3686		1	9606
TYQGSYGFR	Unmodified	1077.488	0.48795855	104	P04637	TP53	Cellular tumor antigen p53	yes	yes	0	0	0	4	0.816			1	1	1	16.892	16.892	2	3.5656E-06	8961	DP1141_9	153.78	130.01			458270000	1657	104	1580	2729;2730;2731	3688;3689;3690;3691	3690		3	9606
TYSYLTPDLWK	Unmodified	1385.6867	0.68671794	155	P15880	RPS2	40S ribosomal protein S2	yes	yes	0	0	0	4	0				1		21.288	21.288	2	0.0062642	15677	DP1141_9	123.21	83.955			9975300	1658	155	1581	2732	3692;3693;3694	3692		3	9606
TYTDELTPIESAVSVFK	Unmodified	1898.9513	0.95132506	77	O75489	NDUFS3	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial	yes	yes	0	0	0	5	0					1	22.836	22.836	2	0.010769	18776	DP1141_10	107.53	84.517			3245100	1659	77	1582	2733	3695	3695		1	9606
VAALQNLVK	Unmodified	954.58622	0.58621603	395	Q14974	KPNB1	Importin subunit beta-1	yes	yes	0	0	0	2	0		1				17.799	17.799	2	0.019419	10598	DP1141_7	89.369	30.554			15937000	1660	395	1583	2734	3696	3696		0	9606
VACIGAWHPAR	Unmodified	1236.6186	0.61859557	219	P39023;Q92901	RPL3;RPL3L	60S ribosomal protein L3;60S ribosomal protein L3-like	yes	no	0	0	0	1	0	2					16.667	16.667	2;3	0.0039883	8124	DP1141_6	98.044	67.877			18958000	1661	219	1584	2735;2736	3697;3698	3698		2	9606
VADMALHYANK	Oxidation (M)	1247.5969	0.59685707	257	P50990	CCT8	T-complex protein 1 subunit theta	yes	yes	0	1	0	4	0				1		14.678	14.678	3	0.0069762	5323	DP1141_9	77.533	39.817			7163000	1662	257	1585	2737	3699	3699	206	1	9606
VAEIPFNSTNK	Unmodified	1218.6245	0.62445203	147	P13637;P50993;Q13733;P54707	ATP1A3;ATP1A2;ATP1A4;ATP12A	Sodium/potassium-transporting ATPase subunit alpha-3;Sodium/potassium-transporting ATPase subunit alpha-2;Sodium/potassium-transporting ATPase subunit alpha-4;Potassium-transporting ATPase alpha chain 2	yes	no	0	0	0	4	0				1		17.188	17.188	2	0.010114	9338	DP1141_9	101.65	26.434			11219000	1663	147	1586	2738	3700	3700		0	9606
VAFGSLAANGPTTLVDK	Unmodified	1659.8832	0.88318591	600	Q9UKX7	NUP50	Nuclear pore complex protein Nup50	yes	yes	0	0	0	3	0			1			19.726	19.726	2	0.023808	13491	DP1141_8	78.615	35.112			12454000	1664	600	1587	2739	3701	3701		0	9606
VAISNPPQR	Unmodified	980.54033	0.54032847	398	Q15020	SART3	Squamous cell carcinoma antigen recognized by T-cells 3	yes	yes	0	0	0	2	0		1				14.358	14.358	2	0.0056523	5026	DP1141_7	113.7	67.978			2240000	1665	398	1588	2740	3702	3702		1	9606
VAPAQPSEEGPGR	Unmodified	1293.6313	0.63132832	184	P23588	EIF4B	Eukaryotic translation initiation factor 4B	yes	yes	0	0	0	3	0			1			14.086	14.086	2	0.00033678	4600	DP1141_8	142	124.63			8077600	1666	184	1589	2741	3703	3703		1	9606
VAPEEHPVLLTEAPLNPK	Unmodified	1953.0571	0.057127534	277;318	P60709;P63261	ACTB;ACTG1	Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed	no	no	0	0	0	4	0				1		18.387	18.387	3	0.031387	11372	DP1141_9	57.197	14.25			92714000	1667	277;318	1590	2742	3704	3704		1	9606
VAPSKWEAVDESELEAQAVTTSK	Unmodified	2474.2177	0.21766351	49	O15042	U2SURP	U2 snRNP-associated SURP motif-containing protein	yes	yes	0	0	1	2	0		1				19.2	19.2	3	6.9711E-19	12718	DP1141_7	118.08	99.456			36951000	1668	49	1591	2743	3705	3705		0	9606
VAPSWPESHSSADSASLAK	Unmodified	1925.9119	0.91191986	447	Q7LBC6	KDM3B	Lysine-specific demethylase 3B	yes	yes	0	0	0	2	0		1				16.694	16.694	3	0.010012	8829	DP1141_7	92.307	68.818			40890000	1669	447	1592	2744	3706	3706		1	9606
VASDSPKPALTLQQGQEFSAGGQNAENLCQFFK	Unmodified	3566.71	0.70999593	429	Q69YH5	CDCA2	Cell division cycle-associated protein 2	yes	yes	0	0	1	2	0		1				20.939	20.939	3	0.017906	15424	DP1141_7	48.085	33.709			0	1670	429	1593	2745	3707	3707		1	9606
VASGCLDINSSVK	Unmodified	1348.6657	0.66566492	111	P05166	PCCB	Propionyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	4	1			1		1	16.742	16.742	2	6.0607E-97	8789	DP1141_8	212.72	165.12			90081000	1671	111	1594	2746;2747	3708;3709;3710;3711	3710		4	9606
VASIQGRPQDTKPGVK	Unmodified	1679.9319	0.93186744	507	Q96EV2	RBM33	RNA-binding protein 33	yes	yes	0	0	2	3	0			1			13.548	13.548	3	0.021189	3824	DP1141_8	73.022	42.964			2793900	1672	507	1595	2748	3712	3712		1	9606
VASLEESEGNKQDLK	Unmodified	1645.8159	0.81589421	351	Q07065	CKAP4	Cytoskeleton-associated protein 4	yes	yes	0	0	1	3	0			1			14.822	14.822	3	0.01315	5628	DP1141_8	160.56	101.33			15642000	1673	351	1596	2749	3713	3713		1	9606
VASSPVMVSNPATR	Oxidation (M)	1430.7188	0.71876312	259	P51610	HCFC1	Host cell factor 1;HCF N-terminal chain 1;HCF N-terminal chain 2;HCF N-terminal chain 3;HCF N-terminal chain 4;HCF N-terminal chain 5;HCF N-terminal chain 6;HCF C-terminal chain 1;HCF C-terminal chain 2;HCF C-terminal chain 3;HCF C-terminal chain 4;HCF C-terminal chain 5;HCF C-terminal chain 6	yes	yes	0	1	0	1.5	0.5	1	1				15.758	15.758	2	0.0031133	7318	DP1141_7	113.61	76.053			6480500	1674	259	1597	2750;2751	3714;3715;3716	3716	209	3	9606
VATVSLPR	Unmodified	841.50215	0.50215205	8	CON__P00761			yes	yes	0	0	0	2.43	1.5	3	1	1	1	1	16.499	16.499	2	6.285E-21	8065	DP1141_8	172.03	64.714		+	36953000000	1675	8	1598	2752;2753;2754;2755;2756;2757;2758	3717;3718;3719;3720;3721;3722;3723;3724;3725;3726;3727;3728;3729;3730;3731;3732;3733;3734;3735;3736;3737;3738;3739;3740;3741	3734		25	
VATWFNQPAR	Unmodified	1188.604	0.60399136	188	P26373	RPL13	60S ribosomal protein L13	yes	yes	0	0	0	5	0					1	18.637	18.637	2	0.0026424	12495	DP1141_10	127.46	74.676			89572000	1676	188	1599	2759	3742	3742		1	9606
VAVCDIPPR	Unmodified	1025.5328	0.53280025	376	Q13509;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7	TUBB3;TUBB1	Tubulin beta-3 chain;Tubulin beta-1 chain	no	no	0	0	0	3	0			1			15.89	15.89	2	0.0047407	7470	DP1141_8	109.86	82.732			8345500	1677	376	1600	2760	3743;3744	3744		2	9606
VAYVSFGPHAGK	Unmodified	1231.635	0.63495714	256	P50914	RPL14	60S ribosomal protein L14	yes	yes	0	0	0	5	0					1	16.687	16.687	3	0.0027099	9119	DP1141_10	110.84	93.099			49493000	1678	256	1601	2761	3745;3746	3745		2	9606
VCNPIITK	Unmodified	943.51609	0.51608756	140	P11142	HSPA8	Heat shock cognate 71 kDa protein	yes	yes	0	0	0	3	0			1			15.726	15.726	2	0.014512	7085	DP1141_8	90.37	18.992			201790000	1679	140	1602	2762	3747	3747		1	9606
VDDEPMDVDKGPGSTK	Oxidation (M)	1704.7512	0.75124504	368	Q13123	IK	Protein Red	yes	yes	0	1	1	3.5	0.5			1	1		14.197	14.197	3	0.0055416	4768	DP1141_8	137.21	102.76			16790000	1680	368	1603	2763;2764	3748;3749	3748	289	2	9606
VDLLNQEIEFLK	Unmodified	1459.7922	0.79224564	20	CON__P35908v2;CON__P35908;P35908	KRT2	Keratin, type II cytoskeletal 2 epidermal	yes	no	0	0	0	2.33	1.25	1	1		1		22.333	22.333	2	5.6349E-96	17036	DP1141_6	211.86	158.18		+	116360000	1681	20	1604	2765;2766;2767	3750;3751;3752;3753	3750		3	9606
VDNEFLNMLLDK	Oxidation (M)	1465.7123	0.71228076	464	Q8IX01	SUGP2	SURP and G-patch domain-containing protein 2	yes	yes	0	1	0	2	0		1				22.195	22.195	2	0.008566	17036	DP1141_7	78.903	38.966			13357000	1682	464	1605	2768	3754	3754	345	0	9606
VDNSSLTGESEPQTR	Unmodified	1618.7435	0.74345755	147;106;172	P05023;P13637;P50993;P20648	ATP1A1;ATP1A3;ATP1A2;ATP4A	Sodium/potassium-transporting ATPase subunit alpha-1;Sodium/potassium-transporting ATPase subunit alpha-3;Sodium/potassium-transporting ATPase subunit alpha-2;Potassium-transporting ATPase alpha chain 1	no	no	0	0	0	2.67	1.25	1		1	1		15.242	15.242	2	0.00013139	5963	DP1141_6	147.24	104.9			28591000	1683	106;147;172	1606	2769;2770;2771	3755;3756;3757;3758;3759	3755		5	9606
VDPVYIHLAER	Unmodified	1310.6983	0.69828568	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					18.167	18.167	3	0.0044866	10535	DP1141_6	110.08	67.741			0	1684	367	1607	2772	3760	3760		1	9606
VDSGIQPGSDISIYYDPMISK	Oxidation (M)	2300.0882	0.088229245	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	1	0	1	0	1					20.438	20.438	2	0.0032515	14270	DP1141_6	96.489	60.68			7753700	1685	110	1608	2773	3761	3761	99	1	9606
VDSQYPPVQR	Unmodified	1187.5935	0.59348625	252	P49790	NUP153	Nuclear pore complex protein Nup153	yes	yes	0	0	0	2	0		1				15.16	15.16	2	0.03039	6189	DP1141_7	75.738	45.663			12607000	1686	252	1609	2774	3762	3762		1	9606
VDWQENDFSK	Unmodified	1266.5517	0.55168102	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					18.155	18.155	2	0.0021007	10680	DP1141_6	131.11	109.81			258090000	1687	367	1610	2775	3763;3764;3765	3764		3	9606
VDWQENDFSKR	Unmodified	1422.6528	0.65279205	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	1.5	0.5	1	1				17.126	17.126	3	0.0034286	8804	DP1141_6	114.89	70.28			108000000	1688	367	1611	2776;2777	3766;3767	3766		2	9606
VEAKPEVQSQPPR	Unmodified	1463.7732	0.77324153	604	Q9UN86	G3BP2	Ras GTPase-activating protein-binding protein 2	yes	yes	0	0	1	3.33	0.471			2	1		13.564	13.564	3	1.7321E-15	3917	DP1141_8	169.58	98.895			1337100	1689	604	1612	2778;2779;2780	3768;3769;3770;3771	3768		4	9606
VEEQEPELTSTPNFVVEVIK	Unmodified	2286.1631	0.16310875	350	Q07021	C1QBP	Complement component 1 Q subcomponent-binding protein, mitochondrial	yes	yes	0	0	0	5	0					1	21.609	21.609	2	4.4995E-19	16996	DP1141_10	166.64	113.27			47665000	1690	350	1613	2781	3772;3773	3772		2	9606
VEEQEPELTSTPNFVVEVIKNDDGKK	Unmodified	2943.4713	0.47131202	350	Q07021	C1QBP	Complement component 1 Q subcomponent-binding protein, mitochondrial	yes	yes	0	0	2	5	0					1	20.426	20.426	4	4.2987E-14	15043	DP1141_10	146.45	128.15			54746000	1691	350	1614	2782	3774;3775	3774		2	9606
VEGPGSLGLEESGSR	Unmodified	1472.7107	0.71070086	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	0	3	1.41	1	1	1	1	1	17.461	17.461	2	1.6861E-100	9399	DP1141_6	216.91	181.26			1715599999.9999998	1692	365	1615	2783;2784;2785;2786;2787	3776;3777;3778;3779;3780;3781;3782;3783	3778		8	9606
VEGRPGASLPPLDLQALEK	Unmodified	1989.0895	0.089490294	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	1	2.75	0.829		2	1	1		19.904	19.904	2;3	1.7961E-06	13950	DP1141_7	149.42	103.56			1323300000	1693	142	1616	2788;2789;2790;2791	3784;3785;3786;3787;3788;3789	3784		6	9606
VEGTEPTTAFNLFVGNLNFNK	Unmodified	2311.1485	0.14846174	171	P19338	NCL	Nucleolin	yes	yes	0	0	0	2	0		1				23.395	23.395	2	3.2351E-38	19160	DP1141_7	223.03	202.19			11635000	1694	171	1617	2792	3790	3790		1	9606
VEILANDQGNR	Unmodified	1227.6208	0.62076364	161	P17066;P48741	HSPA6;HSPA7	Heat shock 70 kDa protein 6;Putative heat shock 70 kDa protein 7	yes	no	0	0	0	3.5	0.5			1	1		15.624	15.624	2	1.0939999999999999E-66	6939	DP1141_8	203.29	0			2104599999.9999998	1695	161	1618	2793;2794	3791;3792;3793	3792		2	9606
VEITPESILSALSK	Unmodified	1485.829	0.82902508	424	Q5VT52	RPRD2	Regulation of nuclear pre-mRNA domain-containing protein 2	yes	yes	0	0	0	2	0		1				23.692	23.692	2	5.2623999999999996E-67	19544	DP1141_7	187.31	159.13			49804000	1696	424	1619	2795	3794;3795;3796	3795		3	9606
VEQATKPSFESGR	Unmodified	1434.7103	0.71030693	215	P38159	RBMX	RNA-binding motif protein, X chromosome;RNA-binding motif protein, X chromosome, N-terminally processed	yes	yes	0	0	1	4	0				1		14.365	14.365	3	0.012895	4830	DP1141_9	107.99	59.554			0	1697	215	1620	2796	3797	3797		1	9606
VEQTETPEMMEAR	2 Oxidation (M)	1581.6651	0.66507257	268	P52701	MSH6	DNA mismatch repair protein Msh6	yes	yes	0	2	0	1	0	1					13.874	13.874	2	0.0087584	3903	DP1141_6	96.229	72.625			0	1698	268	1621	2797	3798	3798	222;223	1	9606
VETQFQNGHYDK	Unmodified	1464.6634	0.66335673	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1.5	0.5	1	1				14.723	14.723	3	0.0011899	5078	DP1141_6	129.34	70.144			229590000	1699	367	1622	2798;2799	3799;3800	3799		2	9606
VEVEEDGQLK	Unmodified	1144.5612	0.56118307	70	O75190;Q8NHS0;P25686	DNAJB6;DNAJB8;DNAJB2	DnaJ homolog subfamily B member 6;DnaJ homolog subfamily B member 8;DnaJ homolog subfamily B member 2	yes	no	0	0	0	5	0					1	15.696	15.696	2	0.029843	7505	DP1141_10	101.54	42.625			4199300	1700	70	1623	2800	3801	3801		0	9606
VEVGTEVTDYR	Unmodified	1266.6092	0.6091959	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					17.153	17.153	2	3.9705E-30	8944	DP1141_6	175.91	113.45			1093300000	1701	367	1624	2801	3802;3803;3804	3803		3	9606
VEVYPVELLLVR	Unmodified	1427.8388	0.8388019	260	P51784	USP11	Ubiquitin carboxyl-terminal hydrolase 11	yes	yes	0	0	0	2	0		1				23.394	23.394	2	0.0028627	19060	DP1141_7	120.45	63.537			8962500	1702	260	1625	2802	3805;3806	3805		2	9606
VEYLDDRNTFR	Unmodified	1426.6841	0.68409218	104	P04637	TP53	Cellular tumor antigen p53	yes	yes	0	0	1	4	0				1		17.175	17.175	2	1.7984E-06	9403	DP1141_9	116.52	62.761			0	1703	104	1626	2803	3807	3807		1	9606
VFDYSEYWEGAR	Unmodified	1520.6572	0.65720872	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	1.5	0.5	1	1				20.8	20.8	2	3.1773999999999996E-66	15370	DP1141_7	200.56	171.85			144700000	1704	142	1627	2804;2805	3808;3809;3810	3809		3	9606
VFLENVIR	Unmodified	988.57057	0.57056597	303	P62805	HIST1H4A	Histone H4	yes	yes	0	0	0	3	2	1				1	19.641	19.641	2	1.2027E-42	12858	DP1141_6	213.54	129.73			1026799999.9999999	1705	303	1628	2806;2807	3811;3812	3812		1	9606
VFLIDLNSTHGTFLGHIR	Unmodified	2039.0952	0.095244374	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	0	3.4	0.49			3	2		23.998	23.998	2;3;4	4.2902E-06	15078	DP1141_8	198.95	112.4			1646999999.9999998	1706	365	1629	2808;2809;2810;2811;2812	3813;3814;3815;3816;3817;3818;3819	3813		7	9606
VFPGSTTEDYNLIVIER	Unmodified	1951.9891	0.98910755	372	Q13263	TRIM28	Transcription intermediary factor 1-beta	yes	yes	0	0	0	2	0		1				21.104	21.104	2	0.0016332	15818	DP1141_7	161.25	106.91			37492000	1707	372	1630	2813	3820;3821	3820		2	9606
VFQPPPPPPPAPSGDAPAEKER	Unmodified	2280.1539	0.15388147	523	Q96SB3	PPP1R9B	Neurabin-2	yes	yes	0	0	1	2	0		1				16.565	16.565	3	0.0010836	8716	DP1141_7	95.622	71.823			10072000	1708	523	1631	2814	3822	3822		1	9606
VFQTEAELQEVISDLQSK	Unmodified	2063.0423	0.04226533	497	Q92878	RAD50	DNA repair protein RAD50	yes	yes	0	0	0	2	0		2				23.394	23.394	2;3	0.00010869	19066	DP1141_7	85.046	59.81			19255000	1709	497	1632	2815;2816	3823;3824	3823		2	9606
VGAAEIISR	Unmodified	914.51853	0.5185304	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	2	1	1		1			16.341	16.341	2	2.6952E-26	8120	DP1141_8	166.68	56.559			208270000	1710	78	1633	2817;2818	3825;3826	3826		1	9606
VGAEDIEKTIK	Unmodified	1201.6554	0.65541781	35	O00300	TNFRSF11B	Tumor necrosis factor receptor superfamily member 11B	yes	yes	0	0	1	1	0	1					15.753	15.753	2	0.02183	6657	DP1141_6	77.318	47			28204000	1711	35	1634	2819	3827	3827		0	9606
VGINYQPPTVVPGGDLAK	Unmodified	1823.9781	0.97814893	321;442;322	P68363;P68366;Q71U36;P0DPH8;P0DPH7;Q6PEY2	TUBA1B;TUBA4A;TUBA1A;TUBA3E	Tubulin alpha-1B chain;Tubulin alpha-4A chain;Tubulin alpha-1A chain;Tubulin alpha-3E chain	no	no	0	0	0	3.5	1.12		1	1	1	1	19.46	19.46	2	1.2929E-58	13084	DP1141_8	196.02	148.18			640420000	1712	321;322;442	1635	2820;2821;2822;2823	3828;3829;3830;3831;3832;3833;3834;3835	3833		8	9606
VGMVETNSQDRPVDDVK	Oxidation (M)	1903.8946	0.89455524	616	Q9Y3C6	PPIL1	Peptidyl-prolyl cis-trans isomerase-like 1	yes	yes	0	1	1	5	0					1	14.769	14.769	3	0.00036203	6098	DP1141_10	115.09	80.577			49059000	1713	616	1636	2824	3836;3837	3837	424	2	9606
VGPATPSAQVGK	Unmodified	1110.6033	0.60332266	373	Q13428	TCOF1	Treacle protein	yes	yes	0	0	0	2	0		1				14.658	14.658	2	0.0018975	5399	DP1141_7	125.57	91.566			27072000	1714	373	1637	2825	3838	3838		1	9606
VGPEELPVVGQLLR	Unmodified	1504.8613	0.86132826	577	Q9NXF1	TEX10	Testis-expressed sequence 10 protein	yes	yes	0	0	0	2	0		1				22.195	22.195	2	0.010898	17357	DP1141_7	84.31	45.557			3296300	1715	577	1638	2826	3839	3839		0	9606
VGVNGFGR	Unmodified	804.42424	0.42423608	103	P04406	GAPDH	Glyceraldehyde-3-phosphate dehydrogenase	yes	yes	0	0	0	4	0				1		15.722	15.722	2	0.01274	7775	DP1141_9	103.29	58.755			10537000	1716	103	1639	2827	3840	3840		0	9606
VHAALVYHK	Unmodified	1036.5818	0.58179936	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	0	3	0.816		1	1	1		13.636	13.636	2	2.8723E-05	4003	DP1141_8	148.21	113.01			23973000	1717	365	1640	2828;2829;2830	3841;3842;3843;3844	3842		4	9606
VHAALVYHKHLK	Unmodified	1414.8197	0.81973822	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	1	2	1	1		1			13.679	13.679	3	0.021019	3544	DP1141_8	99.53	99.53			4047900	1718	365	1641	2831;2832	3845;3846	3846		2	9606
VHAALVYHKHLKR	Unmodified	1570.9208	0.92084924	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	2	2	1	1		1			13.718	13.718	3	0.0075914	3715	DP1141_6	90.913	63.241			4813700	1719	365	1642	2833;2834	3847;3848;3849;3850	3847		4	9606
VHCCPHGAFCDLVHTR	Unmodified	1964.8556	0.8556245	193	P28799	GRN	Granulins;Acrogranin;Paragranulin;Granulin-1;Granulin-2;Granulin-3;Granulin-4;Granulin-5;Granulin-6;Granulin-7	yes	yes	0	0	0	5	0					1	16.216	16.216	4	0.021776	8254	DP1141_10	52.862	41.543			17845000	1720	193	1643	2835	3851	3851		1	9606
VHIEIGPDGR	Unmodified	1091.5724	0.57235688	266;200;272	P52597;P31943;P55795	HNRNPF;HNRNPH1;HNRNPH2	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed;Heterogeneous nuclear ribonucleoprotein H2	no	no	0	0	0	4	0.707			1	2	1	16.117	16.117	2;3	7.315299999999999E-21	7562	DP1141_9	172.25	132.6			358150000	1721	266;200;272	1644	2836;2837;2838;2839	3852;3853;3854;3855;3856	3854		5	9606
VHIGQVIMSIR	Oxidation (M)	1267.7071	0.70707622	190	P27635;Q96L21	RPL10;RPL10L	60S ribosomal protein L10;60S ribosomal protein L10-like	yes	no	0	1	0	5	0					1	18.137	18.137	3	0.0085588	11547	DP1141_10	75.566	51.715			64037000	1722	190	1645	2840	3857	3857	166	1	9606
VHLTPYTVDSPICDFLELQR	Unmodified	2402.194	0.19403172	467	Q8N163	CCAR2	Cell cycle and apoptosis regulator protein 2	yes	yes	0	0	0	2	0		1				22.67	22.67	3	2.5281E-37	18053	DP1141_7	176.68	152.67			17300000	1723	467	1646	2841	3858	3858		1	9606
VHNEGLPAPIVR	Unmodified	1300.7252	0.72516913	7	CON__ENSEMBL:ENSBTAP00000024466;CON__ENSEMBL:ENSBTAP00000024462			yes	no	0	0	0	3	0			1			16.426	16.426	3	0.011724	8179	DP1141_8	78.342	42.057		+	56560000	1724	7	1647	2842	3859	3859		1	
VHPAEPFTGELPAQQTLPILGEK	Unmodified	2471.306	0.30602501	40	O00763	ACACB	Acetyl-CoA carboxylase 2;Biotin carboxylase	yes	yes	0	0	0	1	0	1					20.532	20.532	3	1.4559E-09	14302	DP1141_6	106.23	83.057			12589000	1725	40	1648	2843	3860	3860		1	9606
VIAGLYQR	Unmodified	918.5287	0.52870115	329	P78527	PRKDC	DNA-dependent protein kinase catalytic subunit	yes	yes	0	0	0	1.5	0.5	1	1				16.898	16.898	2	0.0062657	9048	DP1141_7	114.54	61.188			37574000	1726	329	1649	2844;2845	3861;3862;3863	3863		3	9606
VIEHIMEDLDTNADK	Oxidation (M)	1757.8142	0.81417965	119	P06702	S100A9	Protein S100-A9	yes	yes	0	1	0	5	0					1	16.606	16.606	3	0.0014647	9067	DP1141_10	116.58	93.591			12383000	1727	119	1650	2846	3864	3864	104	1	9606
VIGLQIFNIDTDR	Unmodified	1502.8093	0.80929269	429	Q69YH5	CDCA2	Cell division cycle-associated protein 2	yes	yes	0	0	0	2	0		1				22.295	22.295	2	0.0045438	17457	DP1141_7	115.57	83.731			6125200	1728	429	1651	2847	3865;3866	3865		2	9606
VIGSGCNLDSAR	Unmodified	1247.5928	0.59283433	121	P07195;Q6ZMR3;P07864;P00338	LDHB;LDHAL6A;LDHC;LDHA	L-lactate dehydrogenase B chain;L-lactate dehydrogenase A-like 6A;L-lactate dehydrogenase C chain;L-lactate dehydrogenase A chain	yes	no	0	0	0	1	0	1					15.611	15.611	2	4.2255E-15	6337	DP1141_6	147.95	89.271			0	1729	121	1652	2848	3867	3867		1	9606
VIHLSNLPHSGYSDSAVLK	Unmodified	2036.0691	0.069089203	229	P43243	MATR3	Matrin-3	yes	yes	0	0	0	2	0		1				17.899	17.899	4	0.010237	10635	DP1141_7	47	25.554			55569000	1730	229	1653	2849	3868	3868		1	9606
VIISAPSADAPMFVMGVNHEK	2 Oxidation (M)	2244.0919	0.091874835	103	P04406	GAPDH	Glyceraldehyde-3-phosphate dehydrogenase	yes	yes	0	2	0	3	1		1		1		18.404	18.404	3	0.0035016	11543	DP1141_7	63.69	48.6			87043000	1731	103	1654	2850;2851	3869;3870	3869	86;87	2	9606
VIISAPSADAPMFVMGVNHEK	Oxidation (M)	2228.097	0.096960213	103	P04406	GAPDH	Glyceraldehyde-3-phosphate dehydrogenase	yes	yes	0	1	0	4	0				1		19.398	19.398	3	0.017007	12705	DP1141_9	47.822	23.811			9973600	1732	103	1654	2852	3871	3871	86;87	1	9606
VIMVTGDHPITAK	Oxidation (M)	1396.7384	0.73843593	147;106;172	P05023;P13637;P50993;Q13733;P54707;P20648	ATP1A1;ATP1A3;ATP1A2;ATP1A4;ATP12A;ATP4A	Sodium/potassium-transporting ATPase subunit alpha-1;Sodium/potassium-transporting ATPase subunit alpha-3;Sodium/potassium-transporting ATPase subunit alpha-2;Sodium/potassium-transporting ATPase subunit alpha-4;Potassium-transporting ATPase alpha chain 2;Potassium-transporting ATPase alpha chain 1	no	no	0	1	0	3	2	1				1	15.561	15.561	3	0.018278	7254	DP1141_10	63.966	38.074			78624000	1733	106;147;172	1655	2853;2854	3872;3873	3872	90	2	9606
VITEEEKNFK	Unmodified	1235.6398	0.63976774	188	P26373	RPL13	60S ribosomal protein L13	yes	yes	0	0	1	5	0					1	14.843	14.843	3	0.0064399	6139	DP1141_10	131.11	84.648			70376000	1734	188	1656	2855	3874	3874		1	9606
VITNFNSAHDTDR	Unmodified	1488.6957	0.69571949	356	Q08188	TGM3	Protein-glutamine gamma-glutamyltransferase E;Protein-glutamine gamma-glutamyltransferase E 50 kDa catalytic chain;Protein-glutamine gamma-glutamyltransferase E 27 kDa non-catalytic chain	yes	yes	0	0	0	3	0			1			15.166	15.166	3	0.0027451	6016	DP1141_8	109.15	62.987			1948700	1735	356	1657	2856	3875	3875		1	9606
VIVSDVQESFIWVR	Unmodified	1675.8934	0.89335667	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	0	2	0		1				22.043	22.043	2	0.022129	17161	DP1141_7	75.229	38.558			6440400	1736	402	1658	2857	3876	3876		1	9606
VIVVGNPANTNCLTASK	Unmodified	1756.9142	0.91416847	222	P40925	MDH1	Malate dehydrogenase, cytoplasmic	yes	yes	0	0	0	5	0					1	17.809	17.809	2	8.82E-97	11003	DP1141_10	193.28	143.25			0	1737	222	1659	2858	3877	3877		1	9606
VKADRDESSPYAAMLAAQDVAQR	Oxidation (M)	2507.2074	0.20744995	291	P62263	RPS14	40S ribosomal protein S14	yes	yes	0	1	2	5	0					1	16.973	16.973	4	0.0009964	9704	DP1141_10	79.942	57.834			33055000	1738	291	1660	2859	3878	3878	234	1	9606
VKDLVLSVHNR	Unmodified	1278.7408	0.74081919	398	Q15020	SART3	Squamous cell carcinoma antigen recognized by T-cells 3	yes	yes	0	0	1	2	0		1				15.26	15.26	3	0.017023	6552	DP1141_7	103.08	61.603			42539000	1739	398	1661	2860	3879	3879		1	9606
VKDMAAPGTSSVPAPTAGNAEK	Oxidation (M)	2114.0314	0.031383068	445	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	yes	yes	0	1	1	1	0	1					14.858	14.858	3	0.00050429	5148	DP1141_6	81.017	67.113			6497700	1740	445	1662	2861	3880	3880	331	0	9606
VKPLQDQNELFGK	Unmodified	1514.8093	0.80929269	361	Q12874	SF3A3	Splicing factor 3A subunit 3	yes	yes	0	0	1	3	0			1			17.289	17.289	2	0.013714	9655	DP1141_8	110.08	52.218			0	1741	361	1663	2862	3881	3881		1	9606
VKPYLPQICGTVLWR	Unmodified	1829.0022	0.002195612	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	2	0		1				20.692	20.692	3	2.7845E-118	15107	DP1141_7	222.56	182.01			301410000	1742	78	1664	2863	3882;3883;3884;3885	3884		4	9606
VLANPGNSQVAR	Unmodified	1224.6575	0.65748349	395	Q14974	KPNB1	Importin subunit beta-1	yes	yes	0	0	0	3	1		1		1		14.753	14.753	2	0.001808	5677	DP1141_7	142.43	111.86			33804000	1743	395	1665	2864;2865	3886;3887	3886		2	9606
VLATVTKPVGGDK	Unmodified	1283.7449	0.74490152	343	Q02878	RPL6	60S ribosomal protein L6	yes	yes	0	0	1	2	1.41	2			1		14.574	14.574	2;3	3.9442E-29	5166	DP1141_9	178.95	133.8			33009000	1744	343	1666	2866;2867;2868	3888;3889;3890	3890		3	9606
VLCAVSGPR	Unmodified	957.50659	0.5065855	418	Q5RKV6	EXOSC6	Exosome complex component MTR3	yes	yes	0	0	0	5	0					1	15.32	15.32	2	0.011293	6918	DP1141_10	89.752	58.463			66145000	1745	418	1667	2869	3891	3891		1	9606
VLDELTLTK	Unmodified	1030.591	0.59102664	17	CON__P13645;P13645	KRT10	Keratin, type I cytoskeletal 10	yes	no	0	0	0	2	1	1		1			18.525	18.525	2	2.2838E-09	11034	DP1141_6	145.16	65.705		+	86163000	1746	17	1668	2870;2871	3892;3893	3892		2	9606
VLDSGAPIK	Unmodified	898.51238	0.51238239	118	P06576	ATP5B	ATP synthase subunit beta, mitochondrial	yes	yes	0	0	0	1	0	1					15.45	15.45	2	0.0074117	6001	DP1141_6	133.12	38.854			6725500	1747	118	1669	2872	3894	3894		0	9606
VLEENQEHYHIVQK	Unmodified	1764.8795	0.87949752	273	P57740	NUP107	Nuclear pore complex protein Nup107	yes	yes	0	0	0	2	0		1				15.059	15.059	3	0.0043949	6125	DP1141_7	94.547	61.614			20533000	1748	273	1670	2873	3895	3895		0	9606
VLELNASDER	Unmodified	1144.5724	0.57241646	207	P35249	RFC4	Replication factor C subunit 4	yes	yes	0	0	0	4	0				1		16.643	16.643	2	0.0031002	8547	DP1141_9	107.57	35.882			17774000	1749	207	1671	2874	3896	3896		1	9606
VLETAEDIQER	Unmodified	1301.6463	0.64630969	380	Q13813	SPTAN1	Spectrin alpha chain, non-erythrocytic 1	yes	yes	0	0	0	1	0	1					16.392	16.392	2	4.9523E-10	7624	DP1141_6	145.9	94.558			0	1750	380	1672	2875	3897	3897		1	9606
VLGQSSSKPAAAATGPPPGNTSSTQK	Unmodified	2438.2401	0.24013029	559	Q9H2P0	ADNP	Activity-dependent neuroprotector homeobox protein	yes	yes	0	0	1	2	0.816	1	1	1			14.476	14.476	3	3.9943E-11	5254	DP1141_7	116.92	95.564			27498000	1751	559	1673	2876;2877;2878	3898;3899;3900;3901;3902	3900		5	9606
VLHNAQEVEKEPGQR	Unmodified	1732.8856	0.88564553	253	P49916	LIG3	DNA ligase 3	yes	yes	0	0	1	2.5	0.5		2	2			13.714	13.714	3;4	0.0046013	4061	DP1141_7	146.96	109.36			17675000	1752	253	1674	2879;2880;2881;2882	3903;3904;3905;3906;3907	3905		4	9606
VLIANNGIAAVK	Unmodified	1181.7132	0.71320746	367;40	Q13085;O00763	ACACA;ACACB	Acetyl-CoA carboxylase 1;Biotin carboxylase;Acetyl-CoA carboxylase 2;Biotin carboxylase	no	no	0	0	0	1	0	1					17.655	17.655	2	0.0098034	9728	DP1141_6	88.37	35.433			305200000	1753	367;40	1675	2883	3908	3908		1	9606
VLIFSQMTK	Oxidation (M)	1081.5842	0.58416712	394	Q14839;Q8TDI0;Q12873	CHD4;CHD5;CHD3	Chromodomain-helicase-DNA-binding protein 4;Chromodomain-helicase-DNA-binding protein 5;Chromodomain-helicase-DNA-binding protein 3	yes	no	0	1	0	1	0	1					17.96	17.96	2	0.028256	10202	DP1141_6	95.815	55.243			0	1754	394	1676	2884	3909	3909	303	1	9606
VLLATLSIPITPER	Unmodified	1521.913	0.91302948	383	Q14152	EIF3A	Eukaryotic translation initiation factor 3 subunit A	yes	yes	0	0	0	2	0		1				21.6	21.6	2	0.0045038	16560	DP1141_7	95.618	74.784			13592000	1755	383	1677	2885	3910	3910		1	9606
VLLDNVENK	Unmodified	1042.5659	0.56587452	501	Q93009	USP7	Ubiquitin carboxyl-terminal hydrolase 7	yes	yes	0	0	0	2	0		1				16.565	16.565	2	0.019603	8625	DP1141_7	84.743	30.132			64534000	1756	501	1678	2886	3911	3911		1	9606
VLNTNIDGR	Unmodified	1000.5302	0.53015772	293	P62269	RPS18	40S ribosomal protein S18	yes	yes	0	0	0	5	0					1	15.569	15.569	2	2.1335E-26	7395	DP1141_10	199.07	124.73			25890000	1757	293	1679	2887	3912	3912		0	9606
VLPPPAGYVPIR	Unmodified	1277.7496	0.74959297	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	3.25	1.48	1		1	1	1	18.87	18.87	2	0.0047009	11660	DP1141_6	118.74	93.184			94542000	1758	78	1680	2888;2889;2890;2891	3913;3914;3915;3916;3917;3918;3919;3920;3921;3922;3923;3924	3917		12	9606
VLPSITTEILK	Unmodified	1212.7329	0.73293985	206	P35232	PHB	Prohibitin	yes	yes	0	0	0	5	0					1	20.226	20.226	2	0.019786	14886	DP1141_10	83.647	39.252			43240000	1759	206	1681	2892	3925	3925		1	9606
VLPSIVNEVLK	Unmodified	1209.7333	0.7332742	529	Q99623	PHB2	Prohibitin-2	yes	yes	0	0	0	4	0				1		20.987	20.987	2	4.104E-05	15385	DP1141_9	148.94	97.885			47915000	1760	529	1682	2893	3926;3927	3927		2	9606
VLRPPGGGSNFSLGFDEPTEQPVRK	Unmodified	2683.3718	0.37181317	596	Q9UK76	HN1	Hematological and neurological expressed 1 protein;Hematological and neurological expressed 1 protein, N-terminally processed	yes	yes	0	0	2	5	0					1	18.637	18.637	4	3.7271E-17	12362	DP1141_10	149.71	126.31			67572000	1761	596	1683	2894	3928	3928		1	9606
VLSAPPHFHFGQTNR	Unmodified	1706.8641	0.86412223	189	P26641	EEF1G	Elongation factor 1-gamma	yes	yes	0	0	0	5	0					1	17.173	17.173	4	0.012492	10007	DP1141_10	58.831	35.652			4270500	1762	189	1684	2895	3929	3929		1	9606
VLSGTIHAGQPVK	Unmodified	1305.7405	0.74048484	399	Q15029	EFTUD2	116 kDa U5 small nuclear ribonucleoprotein component	yes	yes	0	0	0	2.5	0.5		1	1			14.96	14.96	3	0.00299	5932	DP1141_7	103.44	57.549			44638000	1763	399	1685	2896;2897	3930;3931	3930		2	9606
VLSIGDGIAR	Unmodified	999.57129	0.57129425	187	P25705	ATP5A1	ATP synthase subunit alpha, mitochondrial	yes	yes	0	0	0	3	0			1			18.025	18.025	2	1.0166E-13	10894	DP1141_8	166.68	76.776			66181000	1764	187	1686	2898	3932;3933	3933		2	9606
VLSQSTPGTPSK	Unmodified	1200.635	0.63501672	431	Q6MZP7	LIN54	Protein lin-54 homolog	yes	yes	0	0	0	3	0			1			14.131	14.131	2	2.1251E-05	4694	DP1141_8	148.32	104.51			5659800	1765	431	1687	2899	3934;3935;3936	3935		3	9606
VLTANSNPSSPSAAK	Unmodified	1442.7365	0.73652168	576	Q9NV56	MRGBP	MRG/MORF4L-binding protein	yes	yes	0	0	0	5	0					1	14.313	14.313	2	0.0062005	5362	DP1141_10	92.925	41.833			4849500	1766	576	1688	2900	3937	3937		1	9606
VLYDAEISQIHQSVTDTNVILSMDNSR	Oxidation (M)	3063.4819	0.48189348	20	CON__P35908v2;CON__P35908;P35908	KRT2	Keratin, type II cytoskeletal 2 epidermal	yes	no	0	1	0	2	0		1				20.849	20.849	3	5.923E-05	15386	DP1141_7	57.648	38.536		+	28305000	1767	20	1689	2901	3938	3938	26	1	9606
VLYLLSQLQQSQMAEK	Oxidation (M)	1893.987	0.98699906	89	O95239	KIF4A	Chromosome-associated kinesin KIF4A	yes	yes	0	1	0	2	0		1				21.035	21.035	2	0.0025294	15561	DP1141_7	110.38	74.059			0	1768	89	1690	2902	3939	3939	76	1	9606
VMEETLSYLLGR	Oxidation (M)	1425.7174	0.71736614	107	P05089	ARG1	Arginase-1	yes	yes	0	1	0	4	0				1		20.687	20.687	2	0.031351	15099	DP1141_9	74.162	41.412			7280300	1769	107	1691	2903	3940	3940	91	0	9606
VMIIENSHVK	Oxidation (M)	1184.6223	0.62234354	146	P13569	CFTR	Cystic fibrosis transmembrane conductance regulator	yes	yes	0	1	0	2	0		1				18.289	18.289	2	0.025948	11377	DP1141_7	90.601	55.306			0	1770	146	1692	2904	3941	3941	148	1	9606
VMQQQQQTTQQQLPQK	Oxidation (M)	1956.9687	0.96872323	405	Q15459	SF3A1	Splicing factor 3A subunit 1	yes	yes	0	1	0	2	0		1				14.162	14.162	2	0.012048	4928	DP1141_7	105.13	80.624			15638000	1771	405	1693	2905	3942	3942	311	1	9606
VMTDVAGNPEEERR	Oxidation (M)	1617.7417	0.74168341	434	Q6STE5	SMARCD3	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3	yes	yes	0	1	1	3	0			1			14.226	14.226	3	0.0072025	4725	DP1141_8	75.479	36.315			3403100	1772	434	1694	2906	3943	3943	324	1	9606
VNLLYSR	Unmodified	863.4865	0.48650199	366	Q13011	ECH1	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial	yes	yes	0	0	0	5	0					1	17.538	17.538	2	0.010463	10548	DP1141_10	104.45	62.946			22095000	1773	366	1695	2907	3944	3944		1	9606
VNNADDFPNLFR	Unmodified	1420.6735	0.67352749	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	1					20.732	20.732	2	3.9463000000000002E-177	14485	DP1141_6	240.38	211.65			235640000	1774	367	1696	2908	3945;3946	3945		2	9606
VPAGNWVLIEGVDQPIVK	Unmodified	1933.0673	0.067298289	399	Q15029	EFTUD2	116 kDa U5 small nuclear ribonucleoprotein component	yes	yes	0	0	0	2	0		1				21.738	21.738	2	0	16592	DP1141_7	299.25	253.1			0	1775	399	1697	2909	3947	3947		1	9606
VPEWVDTVK	Unmodified	1071.5601	0.56006086	218	P39019	RPS19	40S ribosomal protein S19	yes	yes	0	0	0	5	0					1	18.537	18.537	2	0.01891	12171	DP1141_10	85.161	46.342			3352300	1776	218	1698	2910	3948	3948		1	9606
VPIPVKESIEEPSAK	Unmodified	1621.8927	0.89268797	80	O75643	SNRNP200	U5 small nuclear ribonucleoprotein 200 kDa helicase	yes	yes	0	0	1	1	0	1					16.68	16.68	3	0.01888	8085	DP1141_6	105.99	70.183			6558900	1777	80	1699	2911	3949	3949		1	9606
VPLPSLSPTMQAGTIAR	Oxidation (M)	1753.9397	0.93965493	138	P10515	DLAT	Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial	yes	yes	0	1	0	1	0	1					18.945	18.945	2	0.023714	11776	DP1141_6	77.279	29.977			0	1778	138	1700	2912	3950	3950	132	1	9606
VPPPPPIAR	Unmodified	942.56509	0.56508666	124	P07910	HNRNPC	Heterogeneous nuclear ribonucleoproteins C1/C2	yes	yes	0	0	0	4	0				1		15.625	15.625	2	0.00044127	6853	DP1141_9	133.47	75.302			107170000	1779	124	1701	2913	3951;3952	3951		2	9606
VPPPWLIAMQR	Unmodified	1306.722	0.72199801	374	Q13435	SF3B2	Splicing factor 3B subunit 2	yes	yes	0	0	0	2	0		1				21.6	21.6	2	0.018234	16541	DP1141_7	84.568	56.555			49553000	1780	374	1702	2914	3953	3953		1	9606
VPVFSHEVVPDHLR	Unmodified	1629.8627	0.86272524	511	Q96G25	MED8	Mediator of RNA polymerase II transcription subunit 8	yes	yes	0	0	0	5	0					1	17.438	17.438	3	0.0029814	10485	DP1141_10	93.766	61.698			6247400	1781	511	1703	2915	3954	3954		1	9606
VQDQDLPNTPHSK	Unmodified	1477.7161	0.71612058	358	Q08554	DSC1	Desmocollin-1	yes	yes	0	0	0	1	0	1					14.097	14.097	3	0.0098398	4285	DP1141_6	80.318	42.324			1328000	1782	358	1704	2916	3955	3955		1	9606
VQENCIDLVGR	Unmodified	1301.6398	0.63978452	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	2.5	0.5		1	1			17.612	17.612	2	2.3944999999999997E-52	10318	DP1141_7	192.64	107.43			725780000	1783	78	1705	2917;2918	3956;3957;3958	3957		3	9606
VQISPDSGGLPER	Unmodified	1353.6888	0.6888432	500	Q92945	KHSRP	Far upstream element-binding protein 2	yes	yes	0	0	0	3	0			1			16.923	16.923	2	0.0060949	9233	DP1141_8	90.653	78.94			32450000	1784	500	1706	2919	3959	3959		1	9606
VQQAELHTGSLPR	Unmodified	1434.7579	0.75792582	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1	0	2					15.563	15.563	2;3	0.015431	6148	DP1141_6	107.34	71.607			270110000	1785	367	1707	2920;2921	3960;3961;3962	3962		3	9606
VQSLQATFGTFESILR	Unmodified	1795.9468	0.9468488	351	Q07065	CKAP4	Cytoskeleton-associated protein 4	yes	yes	0	0	0	3	0			1			23.505	23.505	2	7.4991E-23	19097	DP1141_8	175.48	137.24			9107100	1786	351	1708	2922	3963	3963		1	9606
VRMQGQEAVLAMSSR	2 Oxidation (M)	1693.824	0.82397325	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	2	1	1	0	1					14.597	14.597	3	0.0086083	4831	DP1141_6	70.197	29.34			579420	1787	402	1709	2923	3964	3964	307;308	1	9606
VRPDYTAQNLDHGK	Unmodified	1612.7958	0.79576789	330	P82930	MRPS34	28S ribosomal protein S34, mitochondrial	yes	yes	0	0	1	5	0					1	14.509	14.509	3	0.0060755	5606	DP1141_10	119.62	107.69			17114000	1788	330	1710	2924	3965	3965		1	9606
VRQQAADLISR	Unmodified	1255.6997	0.69968266	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	1	2	0		2				15.16	15.16	2;3	7.519000000000001E-69	6364	DP1141_7	219.5	133.83			35846000	1789	78	1711	2925;2926	3966;3967	3967		1	9606
VRVELSTGMPR	Oxidation (M)	1259.6656	0.66560534	412	Q16629	SRSF7	Serine/arginine-rich splicing factor 7	yes	yes	0	1	1	5	0					1	15.24	15.24	3	0.02999	6766	DP1141_10	76.332	51.317			15981000	1790	412	1712	2927	3968	3968	314	1	9606
VSALNSVHCEHVEDEGESR	Unmodified	2152.9444	0.94435897	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1.67	0.943	2		1			15.179	15.179	2;3;4	6.3577E-60	6222	DP1141_8	195.25	168.21			553310000	1791	367	1713	2928;2929;2930	3969;3970;3971;3972	3972		4	9606
VSGAAPPRPGSSFAHFGFDEQLMHQIR	Unmodified	2938.4297	0.42967917	460	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	yes	yes	0	0	1	2	0		1				19.501	19.501	4	0.0036711	13316	DP1141_7	52.927	38.864			45388000	1792	460	1714	2931	3973	3973		1	9606
VSGVECMIIANDATVK	Oxidation (M)	1721.8328	0.8328066	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	1	0	3	0			1			18.135	18.135	2	0.0030097	11007	DP1141_8	115.34	79.665			0	1793	567	1715	2932	3974	3974	408	1	9606
VSGVECMIIANDATVK	Unmodified	1705.8379	0.83789198	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3	0			1			19.628	19.628	2	0.0043931	13283	DP1141_8	133.88	85.984			0	1794	567	1715	2933	3975	3975		1	9606
VSISEGDDKIEYR	Unmodified	1509.7311	0.73110195	176	P22087	FBL	rRNA 2'-O-methyltransferase fibrillarin	yes	yes	0	0	1	4	0				1		16.643	16.643	3	0.0014681	8550	DP1141_9	159.44	129.89			79141000	1795	176	1716	2934	3976	3976		1	9606
VSVADHSLHLSK	Unmodified	1291.6884	0.68844927	370	Q13162	PRDX4	Peroxiredoxin-4	yes	yes	0	0	0	5	0					1	15.245	15.245	3	0.029141	6775	DP1141_10	68.44	33.216			11159000	1796	370	1717	2935	3977	3977		1	9606
VSWLGEEPVAGVWSEK	Unmodified	1771.8781	0.87810054	536	Q9BQ67	GRWD1	Glutamate-rich WD repeat-containing protein 1	yes	yes	0	0	0	3	0			1			21.397	21.397	2	0.00050294	16274	DP1141_8	146.5	104.03			14257000	1797	536	1718	2936	3978	3978		1	9606
VSYFAVFDGHGGIR	Unmodified	1523.7521	0.75211216	552	Q9H0C8	ILKAP	Integrin-linked kinase-associated serine/threonine phosphatase 2C	yes	yes	0	0	0	4	0				1		19.988	19.988	3	0.0093097	13868	DP1141_9	116.74	85.211			19454000	1798	552	1719	2937	3979	3979		1	9606
VTEDTSSVLR	Unmodified	1105.5615	0.56151742	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	0	0	5	0					1	15.741	15.741	2	3.0419E-84	7545	DP1141_10	193.41	122.5			0	1799	110	1720	2938	3980	3980		1	9606
VTFSEDDEIINPEDVDPSVGR	Unmodified	2332.0707	0.070664925	365	Q12972	PPP1R8	Nuclear inhibitor of protein phosphatase 1;Activator of RNA decay	yes	yes	0	0	0	2.67	1.49	2	1	1	1	1	20.717	20.717	2;3	0	15551	DP1141_10	438.97	415.48			655220000	1800	365	1721	2939;2940;2941;2942;2943;2944	3981;3982;3983;3984;3985;3986;3987;3988;3989	3982		9	9606
VTGEADVEFATHEEAVAAMSK	Oxidation (M)	2207.0052	0.005227897	266	P52597	HNRNPF	Heterogeneous nuclear ribonucleoprotein F;Heterogeneous nuclear ribonucleoprotein F, N-terminally processed	yes	yes	0	1	0	4.5	0.5				1	1	18.262	18.262	3	8.5048E-08	11250	DP1141_9	105.38	83.702			111970000	1801	266	1722	2945;2946	3990;3991	3991	221	2	9606
VTHAVVTVPAYFNDAQR	Unmodified	1886.9639	0.96389585	139	P11021	HSPA5	78 kDa glucose-regulated protein	yes	yes	0	0	0	3	0			1			18.525	18.525	3	0.00010403	11532	DP1141_8	118.21	92.597			53470000	1802	139	1723	2947	3992;3993	3992		2	9606
VTIAQGGVLPNIQAVLLPK	Unmodified	1930.1615	0.16153303	105	Q99878;Q96KK5;Q9BTM1;Q16777;Q93077;Q7L7L0;Q6FI13;P20671;P0C0S8;P04908	HIST1H2AJ;HIST1H2AH;H2AFJ;HIST2H2AC;HIST1H2AC;HIST3H2A;HIST2H2AA3;HIST1H2AD;HIST1H2AG;HIST1H2AB	Histone H2A type 1-J;Histone H2A type 1-H;Histone H2A.J;Histone H2A type 2-C;Histone H2A type 1-C;Histone H2A type 3;Histone H2A type 2-A;Histone H2A type 1-D;Histone H2A type 1;Histone H2A type 1-B/E	yes	no	0	0	0	2.67	1.49	2	1	1	1	1	22.704	22.704	2;3	1.2389E-59	18268	DP1141_10	248.67	203.31			551670000	1803	105	1724	2948;2949;2950;2951;2952;2953	3994;3995;3996;3997;3998;3999;4000;4001;4002;4003;4004;4005	3994		12	9606
VTIASLPR	Unmodified	855.5178	0.51780212	363	Q12912	LRMP	Lymphoid-restricted membrane protein;Processed lymphoid-restricted membrane protein	yes	yes	0	0	0	4	0				1		16.643	16.643	1	0.018914	8574	DP1141_9	67.032	2.4649			27894000	1804	363	1725	2954	4006	4006		0	9606
VTMQNLNDR	Unmodified	1089.5237	0.52369213	17;16;9	CON__P13645;P13645;CON__P02535-1;Q7Z3Y7;CON__Q148H6;CON__Q7Z3Y7;CON__Q7Z3Y8;CON__Q7Z3Z0;Q7Z3Y8;Q7Z3Z0;CON__Q7Z3Y9;Q7Z3Y9;CON__P02533;P02533;CON__A2A4G1;CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8	KRT10;KRT28;KRT27;KRT25;KRT26;KRT14;KRT16	Keratin, type I cytoskeletal 10;Keratin, type I cytoskeletal 28;Keratin, type I cytoskeletal 27;Keratin, type I cytoskeletal 25;Keratin, type I cytoskeletal 26;Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 16	no	no	0	0	0	1.5	0.5	1	1				15.664	15.664	2	0.00050388	6336	DP1141_6	143.73	64.964		+	77793000	1805	17;9;16	1726	2955;2956	4007;4008;4009	4007		3	9606
VTMQNLNDR	Oxidation (M)	1105.5186	0.51860675	17;16;9	CON__P13645;P13645;CON__P02535-1;Q7Z3Y7;CON__Q148H6;CON__Q7Z3Y7;CON__Q7Z3Y8;CON__Q7Z3Z0;Q7Z3Y8;Q7Z3Z0;CON__Q7Z3Y9;Q7Z3Y9;CON__P02533;P02533;CON__A2A4G1;CON__P08779;P08779;CON__Q9Z2K1;CON__Q3ZAW8	KRT10;KRT28;KRT27;KRT25;KRT26;KRT14;KRT16	Keratin, type I cytoskeletal 10;Keratin, type I cytoskeletal 28;Keratin, type I cytoskeletal 27;Keratin, type I cytoskeletal 25;Keratin, type I cytoskeletal 26;Keratin, type I cytoskeletal 14;Keratin, type I cytoskeletal 16	no	no	0	1	0	4	0				2		14.022	14.022	2	0.029454	3937	DP1141_9	88.948	50.71		+	0	1806	17;9;16	1726	2957;2958	4010;4011	4010	10	2	9606
VTQDELKEVFEDAAEIR	Unmodified	1990.9848	0.98475045	171	P19338	NCL	Nucleolin	yes	yes	0	0	1	2	0		1				21.76	21.76	3	0.034231	16700	DP1141_7	95.9	62.635			10982000	1807	171	1727	2959	4012	4012		1	9606
VTQSNFAVGYK	Unmodified	1212.6139	0.61388734	174	P21796	VDAC1	Voltage-dependent anion-selective channel protein 1	yes	yes	0	0	0	5	0					1	16.832	16.832	2	0.0077658	9448	DP1141_10	94.692	63.27			36673000	1808	174	1728	2960	4013	4013		1	9606
VVDRDSEEAEIIRK	Unmodified	1657.8635	0.8635131	131	P09874	PARP1	Poly [ADP-ribose] polymerase 1	yes	yes	0	0	2	2	0		1				15.16	15.16	3	0.035326	6395	DP1141_7	77.527	37.011			10578000	1809	131	1729	2961	4014	4014		1	9606
VVEEAPSIFLDAETR	Unmodified	1674.8465	0.84646606	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	0	0	3	0			1			20.527	20.527	2	0.0018584	14780	DP1141_8	125.28	92.553			56447000	1810	110	1730	2962	4015	4015		1	9606
VVEEAPSIFLDAETRR	Unmodified	1830.9476	0.94757708	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	0	1	2	1	1		1			19.379	19.379	3	0.00073399	12938	DP1141_8	145.1	112.57			54470000	1811	110	1731	2963;2964	4016;4017;4018	4017		3	9606
VVEGTPLIDGR	Unmodified	1154.6295	0.62953741	392	Q14739	LBR	Lamin-B receptor	yes	yes	0	0	0	1	0	1					17.254	17.254	2	0.0045698	9184	DP1141_6	139.98	105.79			28030000	1812	392	1732	2965	4019;4020	4019		2	9606
VVEIAPAAHLDPQLR	Unmodified	1627.9046	0.90459006	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	2	0.707	1	2	1			18.32	18.32	2;3	0.0030233	11500	DP1141_7	130.56	97.156			3278099999.9999995	1813	142	1733	2966;2967;2968;2969	4021;4022;4023;4024;4025;4026;4027	4025		7	9606
VVHIMDFQR	Oxidation (M)	1159.5808	0.58081308	229	P43243	MATR3	Matrin-3	yes	yes	0	1	0	2	0		1				16.212	16.212	2	0.035514	7975	DP1141_7	79.713	41.985			0	1814	229	1734	2970	4028	4028	184	1	9606
VVHSYEELEENYTR	Unmodified	1766.8111	0.81114318	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	0	0	3	1.22		2	1		1	17.665	17.665	2;3	8.682099999999999E-67	10472	DP1141_7	223.77	223.77			1195800000	1815	142	1735	2971;2972;2973;2974	4029;4030;4031;4032	4030		2	9606
VVLIGGKPDR	Unmodified	1052.6342	0.63422886	284	P61978	HNRNPK	Heterogeneous nuclear ribonucleoprotein K	yes	yes	0	0	1	3	0			1			15.122	15.122	2	0.020127	6160	DP1141_8	106.68	51.907			43679000	1816	284	1736	2975	4033	4033		0	9606
VVNANQNASPNVPGKR	Unmodified	1663.8754	0.87541519	462	Q8IWI9	MGA	MAX gene-associated protein	yes	yes	0	0	1	1.5	0.5	1	1				13.74	13.74	3	0.002235	4180	DP1141_7	150.26	89.963			9358300	1817	462	1737	2976;2977	4034;4035;4036	4035		3	9606
VVQGDIGEANEDVTQIVEILHSGPSK	Unmodified	2733.3821	0.38210308	460	Q86XP3	DDX42	ATP-dependent RNA helicase DDX42	yes	yes	0	0	0	2	0		1				22.288	22.288	3	2.6079E-17	17505	DP1141_7	150.26	130.28			99275000	1818	460	1738	2978	4037;4038	4037		2	9606
VWDDGIIDPADTR	Unmodified	1471.6943	0.69432251	567	Q9HCC0	MCCC2	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	yes	yes	0	0	0	3.2	1.17		2	1	1	1	19.93	19.93	2	2.4730999999999997E-52	13583	DP1141_8	192.5	132.39			1005399999.9999999	1819	567	1739	2979;2980;2981;2982;2983	4039;4040;4041;4042;4043;4044;4045;4046;4047;4048	4044		10	9606
VWSPLVTEEGKR	Unmodified	1399.746	0.74596415	31	O00151	PDLIM1	PDZ and LIM domain protein 1	yes	yes	0	0	1	4	0				1		17.742	17.742	3	0.0064019	10321	DP1141_9	98.156	51.427			0	1820	31	1740	2984	4049	4049		1	9606
VYADGIFDLFHSGHAR	Unmodified	1803.8693	0.86926718	248	P49585;Q9Y5K3	PCYT1A;PCYT1B	Choline-phosphate cytidylyltransferase A;Choline-phosphate cytidylyltransferase B	yes	no	0	0	0	4	0				1		20.687	20.687	3	0.0011567	14769	DP1141_9	98.676	79.688			6437900	1821	248	1741	2985	4050	4050		0	9606
VYAEDPYK	Unmodified	983.46001	0.46001246	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	0	0	2	1	1		1			15.739	15.739	2	1.2787E-05	7097	DP1141_8	138.37	101.35			247970000	1822	110	1742	2986;2987	4051;4052;4053	4053		3	9606
VYMHLPQTDNK	Oxidation (M)	1360.6445	0.64453555	185	P24928	POLR2A	DNA-directed RNA polymerase II subunit RPB1	yes	yes	0	1	0	2	0		1				14.358	14.358	3	0.030688	5035	DP1141_7	55.721	29.603			3789800	1823	185	1743	2988	4054	4054	162	1	9606
VYNVTQHAVGIVVNK	Unmodified	1639.9046	0.90459006	234	P46778	RPL21	60S ribosomal protein L21	yes	yes	0	0	0	5	0					1	17.538	17.538	3	0.012233	10593	DP1141_10	63.727	44.199			82223000	1824	234	1744	2989	4055	4055		1	9606
WDQTADQTPGATPK	Unmodified	1514.7001	0.70013617	78	O75533	SF3B1	Splicing factor 3B subunit 1	yes	yes	0	0	0	2	0		1				15.664	15.664	2	0	7189	DP1141_7	300.35	276.36			307240000	1825	78	1745	2990	4056;4057	4056		2	9606
WECKNDTLLGIK	Unmodified	1475.7442	0.74424959	180	P22897	MRC1	Macrophage mannose receptor 1	yes	yes	0	0	1	2	0		1				20.2	20.2	2	0.015953	14394	DP1141_7	124.92	72.667			34008000	1826	180	1746	2991	4058	4058		1	9606
WEGLVYAPPGK	Unmodified	1215.6288	0.62880913	612	Q9Y2W1	THRAP3	Thyroid hormone receptor-associated protein 3	yes	yes	0	0	0	2	0		1				19.401	19.401	2	0.017561	13074	DP1141_7	99.802	64.994			44949000	1827	612	1747	2992	4059	4059		0	9606
WELLQQVDTSTR	Unmodified	1474.7416	0.74160705	102	P04264;CON__P04264	KRT1	Keratin, type II cytoskeletal 1	yes	no	0	0	0	2.75	1.48	1	1	1		1	20.234	20.234	2	9.9177E-43	14484	DP1141_7	172.8	114.95		+	291150000	1828	102	1748	2993;2994;2995;2996	4060;4061;4062;4063;4064;4065	4063		6	9606
WEWLVNQHR	Unmodified	1266.6258	0.62578944	543	Q9BWJ5	SF3B5	Splicing factor 3B subunit 5	yes	yes	0	0	0	5	0					1	19.127	19.127	3	0.0055249	13127	DP1141_10	80.438	48.944			77610000	1829	543	1749	2997	4066	4066		1	9606
WFLTCINQPQFR	Unmodified	1608.7871	0.78711746	189	P26641	EEF1G	Elongation factor 1-gamma	yes	yes	0	0	0	3	0			1			21.829	21.829	2	0.022668	16519	DP1141_8	96.143	26.115			4764500	1830	189	1750	2998	4067	4067		1	9606
WFNGQPIHAELSPVTDFR	Unmodified	2113.0381	0.038123426	338	Q01081	U2AF1	Splicing factor U2AF 35 kDa subunit	yes	yes	0	0	0	4	0				1		20.548	20.548	3	0.015869	14693	DP1141_9	76.378	40.905			0	1831	338	1751	2999	4068	4068		1	9606
WLQDNLTLR	Unmodified	1157.6193	0.61930707	497	Q92878	RAD50	DNA repair protein RAD50	yes	yes	0	0	0	2	0		1				19.7	19.7	2	0.027943	13609	DP1141_7	77.318	34.453			40147000	1832	497	1752	3000	4069	4069		1	9606
WMLAGRPHPTQK	Oxidation (M)	1436.7347	0.73468796	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	1	1	1	0	1					15.054	15.054	3	0.0078145	5507	DP1141_6	92.943	52.428			90616000	1833	367	1753	3001	4070	4070	288	1	9606
WMLAGRPHPTQK	Unmodified	1420.7398	0.73977334	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	1	0	1					15.685	15.685	3	0.013897	6289	DP1141_6	120.86	58.327			88431000	1834	367	1753	3002	4071	4071		0	9606
WNTDSVEEFLSEK	Unmodified	1582.7151	0.71511753	63	O60613	SEP15	15 kDa selenoprotein	yes	yes	0	0	0	1	0	1					18.055	18.055	2	0.015305	10338	DP1141_6	82.831	28.108			31079000	1835	63	1754	3003	4072	4072		1	9606
WQNNLLPSR	Unmodified	1126.5883	0.5883413	288	P62244	RPS15A	40S ribosomal protein S15a	yes	yes	0	0	0	5	0					1	18.437	18.437	2	2.3902E-08	11909	DP1141_10	155	131.47			116910000	1836	288	1755	3004	4073;4074	4073		2	9606
WVTTASLLDYDTVAGADK	Unmodified	1924.9418	0.941823	402	Q15393	SF3B3	Splicing factor 3B subunit 3	yes	yes	0	0	0	1	0	1					21.558	21.558	2	7.9546E-105	15766	DP1141_6	211.77	182.23			9111700	1837	402	1756	3005	4075;4076;4077	4075		3	9606
YCLPFLQPGR	Unmodified	1249.6278	0.62776327	226	P42285	SKIV2L2	Superkiller viralicidic activity 2-like 2	yes	yes	0	0	0	2	0		1				21	21	2	0.014981	15640	DP1141_7	89.296	56.976			3753800	1838	226	1757	3006	4078	4078		1	9606
YDGIILPGK	Unmodified	974.54368	0.54368251	313	P62913	RPL11	60S ribosomal protein L11	yes	yes	0	0	0	5	0					1	18.537	18.537	2	0.010359	12267	DP1141_10	98.299	67.01			267760000	1839	313	1758	3007	4079	4079		1	9606
YDGPIEILRLNNMMVTK	2 Oxidation (M)	2038.0227	0.022732637	241	P48169	GABRA4	Gamma-aminobutyric acid receptor subunit alpha-4	yes	yes	0	2	1	5	0					1	21.326	21.326	3	0.021139	16443	DP1141_10	49.265	20.625			235720000	1840	241	1759	3008	4080	4080	190;191	0	9606
YDSAPATDGSGTALGWTVAWK	Unmodified	2153.0065	0.006548526	29	CON__Streptavidin			yes	yes	0	0	0	4	1.41		1			2	21.609	21.609	2;3	0	16874	DP1141_10	277.98	235.73		+	904690000	1841	29	1760	3009;3010;3011	4081;4082;4083;4084;4085;4086;4087;4088	4081		8	
YEEELEINDFPQTAR	Unmodified	1852.8479	0.84792262	445	Q7L014	DDX46	Probable ATP-dependent RNA helicase DDX46	yes	yes	0	0	0	1.5	0.5	1	1				19.695	19.695	2	0.0034732	13095	DP1141_6	101.53	69.278			14855000	1842	445	1761	3012;3013	4089;4090	4089		2	9606
YEELQITAGR	Unmodified	1178.5932	0.5931519	102;101	P04259;P04264;CON__P04264	KRT6B;KRT1	Keratin, type II cytoskeletal 6B;Keratin, type II cytoskeletal 1	no	no	0	0	0	4	0				1		17.588	17.588	2	0.028111	10233	DP1141_9	76.17	42.167		+	173300000	1843	101;102	1762	3014	4091	4091		1	9606
YEELQQTAGR	Unmodified	1193.5677	0.56766543	18	CON__P13647;P13647	KRT5	Keratin, type II cytoskeletal 5	no	no	0	0	0	2.5	1.5	1			1		15.158	15.158	2	0.01097	6201	DP1141_9	96.331	62.535		+	35606000	1844	18	1763	3015;3016	4092;4093	4093		2	9606
YEELQVTVGR	Unmodified	1192.6088	0.60880197	20	CON__P35908v2;CON__P35908;P35908	KRT2	Keratin, type II cytoskeletal 2 epidermal	yes	no	0	0	0	1	0	1					17.755	17.755	2	0.012363	9989	DP1141_6	93.178	42.119		+	20786000	1845	20	1764	3017	4094	4094		1	9606
YEGFFSLWK	Unmodified	1175.5651	0.56514624	344	Q02978	SLC25A11	Mitochondrial 2-oxoglutarate/malate carrier protein	yes	yes	0	0	0	5	0					1	23.019	23.019	2	4.9501E-05	18944	DP1141_10	139.97	77.424			0	1846	344	1765	3018	4095	4095		1	9606
YENEVALR	Unmodified	992.49271	0.49270958	17	CON__P13645;P13645	KRT10	Keratin, type I cytoskeletal 10	yes	no	0	0	0	2	0		1				15.964	15.964	2	0.00072315	7643	DP1141_7	111.01	43.838		+	96276000	1847	17	1766	3019	4096	4096		0	9606
YESLTDPSK	Unmodified	1038.487	0.4869555	126	P08238;Q58FF8;P07900;Q58FF6;Q58FF7	HSP90AB1;HSP90AB2P;HSP90AA1;HSP90AB4P;HSP90AB3P	Heat shock protein HSP 90-beta;Putative heat shock protein HSP 90-beta 2;Heat shock protein HSP 90-alpha;Putative heat shock protein HSP 90-beta 4;Putative heat shock protein HSP 90-beta-3	yes	no	0	0	0	1	0	1					15.492	15.492	2	0.0095425	6211	DP1141_6	99.136	74.933			2119500	1848	126	1767	3020	4097	4097		1	9606
YFPTQALNFAFK	Unmodified	1445.7343	0.73433683	109	P05141;P12236;P12235;Q9H0C2	SLC25A5;SLC25A6;SLC25A4;SLC25A31	ADP/ATP translocase 2;ADP/ATP translocase 2, N-terminally processed;ADP/ATP translocase 3;ADP/ATP translocase 3, N-terminally processed;ADP/ATP translocase 1;ADP/ATP translocase 4;ADP/ATP translocase 4, N-terminally processed	yes	no	0	0	0	2.67	1.7	1	1			1	22.013	22.013	2	0.004913	16558	DP1141_6	114.89	85.725			99169000	1849	109	1768	3021;3022;3023	4098;4099;4100;4101	4099		4	9606
YFSADHCSSVDHR	Unmodified	1579.6474	0.64738909	425	Q5VUA4	ZNF318	Zinc finger protein 318	yes	yes	0	0	0	2	0		1				14.259	14.259	3	0.017353	4876	DP1141_7	82.774	75.881			5445400	1850	425	1769	3024	4102	4102		0	9606
YGINTDPPK	Unmodified	1003.4975	0.4974606	615	Q9Y3B4	SF3B6	Splicing factor 3B subunit 6	yes	yes	0	0	0	5	0					1	15.736	15.736	2	0.0073009	7193	DP1141_10	101.43	52.072			288760000	1851	615	1770	3025	4103	4103		1	9606
YGQFSGLNPGGR	Unmodified	1251.5996	0.59963426	286	P62136	PPP1CA	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit	yes	yes	0	0	0	4	0				1		17.787	17.787	2	0.0048892	10416	DP1141_9	128.27	128.27			46461000	1852	286	1771	3026	4104	4104		1	9606
YGSALASAGDPGHPNHPLHASQNSAR	Unmodified	2611.2276	0.22760854	88	O95071	UBR5	E3 ubiquitin-protein ligase UBR5	yes	yes	0	0	0	1.5	0.5	1	1				14.902	14.902	4;5	7.1414E-07	5337	DP1141_6	90.758	63.978			7092700	1853	88	1772	3027;3028	4105;4106	4105		1	9606
YGVNPGPIVGTTR	Unmodified	1329.7041	0.70409934	225	P42166	TMPO	Lamina-associated polypeptide 2, isoform alpha;Thymopoietin;Thymopentin	yes	yes	0	0	0	3.5	0.5			1	1		17.556	17.556	2	0.0053496	10078	DP1141_9	108.9	75.525			263370000	1854	225	1773	3029;3030	4107;4108	4108		2	9606
YHVLVNLGK	Unmodified	1041.5971	0.59711507	80	O75643	SNRNP200	U5 small nuclear ribonucleoprotein 200 kDa helicase	yes	yes	0	0	0	1	0	1					17.182	17.182	2	0.009415	8937	DP1141_6	132.09	58.861			0	1855	80	1774	3031	4109	4109		1	9606
YICDNQDTISSK	Unmodified	1442.6348	0.63475872	15	CON__P02769			yes	yes	0	0	0	4	0				1		15.486	15.486	2	0.016597	6598	DP1141_9	100.88	39.717		+	0	1856	15	1775	3032	4110	4110		1	
YIDQEELNK	Unmodified	1150.5506	0.55061839	126	P08238;Q58FF8;P07900;Q14568	HSP90AB1;HSP90AB2P;HSP90AA1;HSP90AA2P	Heat shock protein HSP 90-beta;Putative heat shock protein HSP 90-beta 2;Heat shock protein HSP 90-alpha;Heat shock protein HSP 90-alpha A2	yes	no	0	0	0	4	0				1		15.822	15.822	2	0.0055569	7130	DP1141_9	113.41	61.624			12708000	1857	126	1776	3033	4111	4111		1	9606
YIQAEPPTNK	Unmodified	1159.5873	0.58733824	480	Q8TAQ2	SMARCC2	SWI/SNF complex subunit SMARCC2	yes	yes	0	0	0	2	0		1				14.859	14.859	2	1.1706000000000001E-29	5728	DP1141_7	175.91	104.22			26871000	1858	480	1777	3034	4112	4112		1	9606
YIQQTKPLTLER	Unmodified	1488.83	0.83002813	61	O43809	NUDT21	Cleavage and polyadenylation specificity factor subunit 5	yes	yes	0	0	1	5	0					1	16.316	16.316	3	0.0084026	8537	DP1141_10	153.54	114.66			274150000	1859	61	1778	3035	4113;4114	4114		2	9606
YKITDIIGK	Unmodified	1049.6121	0.61209643	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	1	0	1					18.355	18.355	2	0.0027213	10725	DP1141_6	107.69	61.741			8716900	1860	367	1779	3036	4115	4115		0	9606
YKPYEEALLQAEAPR	Unmodified	1776.9046	0.90464964	398	Q15020	SART3	Squamous cell carcinoma antigen recognized by T-cells 3	yes	yes	0	0	1	2	0		1				18.754	18.754	2	6.930700000000001E-25	12113	DP1141_7	158.25	124.49			0	1861	398	1780	3037	4116	4116		1	9606
YLAEVAAGDDKK	Unmodified	1278.6456	0.6455814	316	P63104	YWHAZ	14-3-3 protein zeta/delta	yes	yes	0	0	1	5	0					1	14.843	14.843	2	0.034658	6229	DP1141_10	114.97	59.598			16224000	1862	316	1781	3038	4117	4117		1	9606
YLANIEQQHGNSGR	Unmodified	1585.7597	0.75971673	600	Q9UKX7	NUP50	Nuclear pore complex protein Nup50	yes	yes	0	0	0	3	0			1			15.122	15.122	3	0.013822	6001	DP1141_8	80.905	56.715			98745000	1863	600	1782	3039	4118	4118		0	9606
YLDFSSIITEVR	Unmodified	1441.7453	0.74529545	28	CON__Q7RTT2;CON__Q8N1N4-2;Q8N1N4	KRT78	Keratin, type II cytoskeletal 78	yes	no	0	0	0	2	0		1				22.858	22.858	2	0.015643	18283	DP1141_7	105.98	90.598		+	3484500	1864	28	1783	3040	4119	4119		0	9606
YLDGLTAER	Unmodified	1036.5189	0.51892433	20	CON__P35908v2;CON__P35908;P35908	KRT2	Keratin, type II cytoskeletal 2 epidermal	yes	no	0	0	0	1	0	1					17.655	17.655	2	0.0042927	9784	DP1141_6	107.01	35.058		+	65449000	1865	20	1784	3041	4120	4120		1	9606
YLSQQWAK	Unmodified	1022.5185	0.5185304	150	P13984	GTF2F2	General transcription factor IIF subunit 2	yes	yes	0	0	0	5	0					1	16.872	16.872	2	0.034831	9483	DP1141_10	85.359	65.583			42536000	1866	150	1785	3042	4121	4121		1	9606
YLSSVSSQETQGGPLAPMTGTIEK	Oxidation (M)	2496.2054	0.20538427	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	1	0	1	0	1					18.255	18.255	2	7.4935E-33	10744	DP1141_6	175.26	124.26			42245000	1867	521	1786	3043	4122	4122	379	1	9606
YLSSVSSQETQGGPLAPMTGTIEK	Unmodified	2480.2105	0.21046965	521	Q96RQ3	MCCC1	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	yes	yes	0	0	0	3	0			1			19.526	19.526	2	2.9233E-139	13230	DP1141_8	292.38	232.03			33844000	1868	521	1786	3044	4123;4124	4123		2	9606
YLTVAAVFR	Unmodified	1038.5862	0.58621603	122;323	P07437;P68371;P04350	TUBB;TUBB4B;TUBB4A	Tubulin beta chain;Tubulin beta-4B chain;Tubulin beta-4A chain	no	no	0	0	0	4	0				1		20.387	20.387	2	7.299499999999999E-21	14564	DP1141_9	173.59	128.9			96777000	1869	122;323	1787	3045	4125;4126	4125		2	9606
YLVVLYYNANR	Unmodified	1386.7296	0.7295858	615	Q9Y3B4	SF3B6	Splicing factor 3B subunit 6	yes	yes	0	0	0	5	0					1	20.526	20.526	2	2.9964999999999997E-21	15251	DP1141_10	200.1	154.42			138350000	1870	615	1788	3046	4127;4128	4127		2	9606
YLYLTPQDYK	Unmodified	1302.6496	0.64960415	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	0	1.5	0.5	1	1				19.328	19.328	2	7.6032E-67	12436	DP1141_6	202.28	154.43			711860000	1871	367	1789	3047;3048	4129;4130;4131;4132;4133	4131		4	9606
YLYLTPQDYKR	Unmodified	1458.7507	0.75071518	367	Q13085	ACACA	Acetyl-CoA carboxylase 1;Biotin carboxylase	yes	yes	0	0	1	1	0	2					18.081	18.081	2;3	0.0047839	10310	DP1141_6	94.692	63.834			79247000	1872	367	1790	3049;3050	4134;4135;4136	4134		3	9606
YMACCLLYR	Oxidation (M)	1264.5403	0.54027017	321;442;322	P68363;A6NHL2;P68366;Q71U36	TUBA1B;TUBAL3;TUBA4A;TUBA1A	Tubulin alpha-1B chain;Tubulin alpha chain-like 3;Tubulin alpha-4A chain;Tubulin alpha-1A chain	no	no	0	1	0	4	0				1		18.402	18.402	2	0.025938	11379	DP1141_9	97.602	72.749			0	1873	321;322;442	1791	3051	4137	4137	248	1	9606
YMDAWNTVSR	Oxidation (M)	1257.5448	0.5448215	621	Q9Y5L4	TIMM13	Mitochondrial import inner membrane translocase subunit Tim13	yes	yes	0	1	0	5	0					1	17.438	17.438	2	0.01901	10506	DP1141_10	134.05	109.53			27942000	1874	621	1792	3052	4138	4138	428	0	9606
YMFIRDYKSK	Oxidation (M)	1365.6751	0.67510739	76	O75486	SUPT3H	Transcription initiation protein SPT3 homolog	yes	yes	0	1	2	2	0		1				15.059	15.059	2	0.022081	6182	DP1141_7	74.173	24.139			10180000	1875	76	1793	3053	4139	4139	59	0	9606
YMPQNPHIIATK	Oxidation (M)	1427.7231	0.72312022	410	Q16576	RBBP7	Histone-binding protein RBBP7	yes	yes	0	1	0	3	0			1			15.32	15.32	3	0.034217	6525	DP1141_8	57.164	29.585			9500400	1876	410	1794	3054	4140	4140	313	0	9606
YNILGTNTIMDK	Oxidation (M)	1397.6861	0.68606601	337	Q00839	HNRNPU	Heterogeneous nuclear ribonucleoprotein U	yes	yes	0	1	0	1	0	1					18.255	18.255	2	0.033487	11215	DP1141_6	95.618	40.069			9000600	1877	337	1795	3055	4141	4141	257	1	9606
YNPTWHCIVGR	Unmodified	1401.6612	0.66118866	317	Q96FJ2;P63167	DYNLL2;DYNLL1	Dynein light chain 2, cytoplasmic;Dynein light chain 1, cytoplasmic	yes	no	0	0	0	5	0					2	17.838	17.838	2;3	0.0032586	11067	DP1141_10	140.45	103.76			56440000	1878	317	1796	3056;3057	4142;4143	4142		1	9606
YPEETLSLMTK	Oxidation (M)	1326.6377	0.63771883	329	P78527	PRKDC	DNA-dependent protein kinase catalytic subunit	yes	yes	0	1	0	1	0	1					17.834	17.834	2	0.011792	9995	DP1141_6	114.4	71.155			0	1879	329	1797	3058	4144	4144	252	1	9606
YPENFFLLR	Unmodified	1197.6182	0.61824444	286;212;287	P62140;P62136;P36873	PPP1CB;PPP1CA;PPP1CC	Serine/threonine-protein phosphatase PP1-beta catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	no	no	0	0	0	3	1.41	1	1	1	1	1	21.7	21.7	2	0.00060445	16546	DP1141_9	135.77	62.102			787000000	1880	287;286;212	1798	3059;3060;3061;3062;3063	4145;4146;4147;4148;4149;4150;4151;4152;4153;4154;4155;4156;4157;4158	4156		14	9606
YPENKEKR	Unmodified	1062.5458	0.54580778	426	Q5VYS8	ZCCHC6	Terminal uridylyltransferase 7	yes	yes	0	0	2	1	0	1					17.455	17.455	2	0.0055191	9400	DP1141_6	107.32	6.5753			205090000	1881	426	1799	3064	4159	4159		0	9606
YPHVEDYRR	Unmodified	1233.5891	0.58906958	281	P61289	PSME3	Proteasome activator complex subunit 3	yes	yes	0	0	1	4.5	0.5				1	1	14.972	14.972	3	0.0043226	5723	DP1141_9	101.72	82.765			56628000	1882	281	1800	3065;3066	4160;4161;4162	4161		2	9606
YPMAVGLNK	Oxidation (M)	1007.511	0.51100218	618	Q9Y3U8	RPL36	60S ribosomal protein L36	yes	yes	0	1	0	5	0					1	16.116	16.116	2	0.013457	8206	DP1141_10	97.068	45.28			18698000	1883	618	1801	3067	4163	4163	427	0	9606
YPSLELER	Unmodified	1005.5131	0.51311067	419	Q5SSJ5	HP1BP3	Heterochromatin protein 1-binding protein 3	yes	yes	0	0	0	3	0			1			18.325	18.325	2	0.017276	11369	DP1141_8	95.531	26.744			7617400	1884	419	1802	3068	4164	4164		1	9606
YRPGTVALR	Unmodified	1031.5876	0.58761301	324	Q71DI3;Q16695;P84243;P68431;Q5TEC6;Q6NXT2	HIST2H3A;HIST3H3;H3F3A;HIST1H3A;HIST2H3PS2;H3F3C	Histone H3.2;Histone H3.1t;Histone H3.3;Histone H3.1;Histone H3;Histone H3.3C	yes	no	0	0	1	5	0					1	15.259	15.259	3	0.033363	6749	DP1141_10	87.258	45.829			0	1885	324	1803	3069	4165	4165		1	9606
YSLDPENPTK	Unmodified	1162.5506	0.55061839	169	P18621	RPL17	60S ribosomal protein L17	yes	yes	0	0	0	5	0					1	17.037	17.037	2	0.00036875	9668	DP1141_10	146.79	119.74			106130000	1886	169	1804	3070	4166;4167	4167		2	9606
YSLQYYMGLAEELVR	Oxidation (M)	1849.892	0.89203604	142	P11498	PC	Pyruvate carboxylase, mitochondrial	yes	yes	0	1	0	2	0		2				23.161	23.161	2;3	1.0637E-29	18527	DP1141_7	176.87	133.33			117470000	1887	142	1805	3071;3072	4168;4169;4170	4168	146	3	9606
YSPSQNSPIHHIPSR	Unmodified	1718.8489	0.84886609	580	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	yes	yes	0	0	0	2.33	0.471		2	1			15.094	15.094	3;4	0.00049081	6185	DP1141_7	154.13	112.1			82340000	1888	580	1806	3073;3074;3075	4171;4172;4173;4174;4175	4171		5	9606
YSPSQNSPIHHIPSRR	Unmodified	1874.95	0.94997712	580	Q9NYF8	BCLAF1	Bcl-2-associated transcription factor 1	yes	yes	0	0	1	2.5	0.5		1	1			14.542	14.542	4	0.026935	5351	DP1141_7	90.759	84.158			36523000	1889	580	1807	3076;3077	4176;4177	4176		1	9606
YSPVVEAGSDMVFRWTINDK	Oxidation (M)	2329.1049	0.10488236	334	P98161	PKD1	Polycystin-1	yes	yes	0	1	1	4	0				1		17.454	17.454	3	0.030504	9851	DP1141_9	56.339	26.917			0	1890	334	1808	3078	4178	4178	254	1	9606
YSSAGTVEFLVDSK	Unmodified	1501.73	0.73003931	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	0	0	3	0			1			19.827	19.827	2	3.2828E-05	13584	DP1141_8	148.28	88.349			48603000	1891	110	1809	3079	4179;4180	4179		2	9606
YSSAGTVEFLVDSKK	Unmodified	1629.825	0.82500233	110	P05165	PCCA	Propionyl-CoA carboxylase alpha chain, mitochondrial	yes	yes	0	0	1	3	0			1			18.525	18.525	3	2.9108E-61	11681	DP1141_8	201.08	152.81			21345000	1892	110	1810	3080	4181	4181		0	9606
YTIHSQLEHLQSK	Unmodified	1582.8104	0.81035532	543	Q9BWJ5	SF3B5	Splicing factor 3B subunit 5	yes	yes	0	0	0	5	0					2	16.126	16.126	2;3	1.7958E-234	8109	DP1141_10	260.57	189.42			183430000	1893	543	1811	3081;3082	4182;4183;4184;4185	4184		4	9606
YVASYLLAALGGNSSPSAK	Unmodified	1867.968	0.96797818	113	P05387	RPLP2	60S acidic ribosomal protein P2	yes	yes	0	0	0	5	0					1	22.108	22.108	2	1.5268E-190	17622	DP1141_10	247.73	215.74			5555900	1894	113	1812	3083	4186	4186		0	9606
YVELFLNSTAGASGGAYEHR	Unmodified	2141.0178	0.017781914	200	P31943	HNRNPH1	Heterogeneous nuclear ribonucleoprotein H;Heterogeneous nuclear ribonucleoprotein H, N-terminally processed	yes	yes	0	0	0	5	0					1	19.37	19.37	3	3.0905E-05	13490	DP1141_10	112.74	84.76			0	1895	200	1813	3084	4187	4187		1	9606
YYPTEDVPRK	Unmodified	1266.6245	0.62445203	343	Q02878	RPL6	60S ribosomal protein L6	yes	yes	0	0	1	4	0				1		15.197	15.197	3	0.015218	6142	DP1141_9	81.525	34.57			0	1896	343	1814	3085	4188	4188		1	9606
YYTEFPTVLDITAEDPSK	Unmodified	2087.9939	0.99391815	47	O14929	HAT1	Histone acetyltransferase type B catalytic subunit	yes	yes	0	0	0	4	0				1		22.314	22.314	2	2.267E-10	17421	DP1141_9	159.58	127.15			7141600	1897	47	1815	3086	4189;4190	4189		2	9606
YYVTIIDAPGHR	Unmodified	1403.7197	0.7197494	320	P68104;Q5VTE0	EEF1A1;EEF1A1P5	Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3	yes	no	0	0	0	5	0					1	18.07	18.07	3	0.0013741	11489	DP1141_10	101.3	77.224			7630800	1898	320	1816	3087	4191	4191		1	9606
